ELF>m@X&@8 @IIPPP!!0 0 .%>%>%`Q1E&U&U& $$Std Ptd!!!TKTKQtdRtd.%>%>%""GNUGNU-e!pr}D*V $Q!x`|<ҤB^??R Y l<  g8 F 6   M  `mh Y e -i  Z u  U 6 K  w0 X[  " 8\  n) ,  .?F" { Ua  @ sB h ` = M q f) _S "  @s]5 j! + 0S 0   GMF A x g]}{  < B 04D&=l7     "'('N SBIwCTyaI Q L  +Se" piz 2  `36 2 Y 24 P3 2c__gmon_start___ITM_deregisterTMCloneTable_ITM_registerTMCloneTable__cxa_finalizestrrchr__stack_chk_failstrlenstrncmpstrcmplstat64__isoc99_sscanffopen64strstr__getdelimfclose__errno_locationstrerrorusleepmemcpystrdupdm_event_handler_createdm_event_handler_set_dmeventd_pathdm_event_handler_set_dsodm_event_handler_set_uuiddm_event_handler_set_timeoutdm_event_handler_set_event_maskdm_event_handler_destroymemccpydm_event_get_registered_devicedm_event_handler_get_event_maskdm_event_handler_get_dso__assert_failstrncpycallocstrcasecmpmemset__ctype_b_locgetenvctime_rcloselogopenlogunamefcntl64stdinselabel_closepthread_mutex_lockpthread_mutex_unlockstdoutsetlinebufgetpagesizeio_destroyio_submitio_geteventsmalloclseek64strchrfputc__fprintf_chkstrspnstrcspnmemmove__ctype_toupper_locstrtodstrtollfgetsumasksd_id128_get_machine_app_specificopendirreaddir64closediralphasort64scandir64setlocaleudev_enumerate_newudev_enumerate_add_match_subsystemudev_enumerate_scan_devicesudev_enumerate_get_list_entryudev_list_entry_get_nameudev_device_new_from_syspathudev_device_get_devnodeudev_device_get_devlinks_list_entryudev_list_entry_get_nextudev_device_unrefudev_enumerate_unrefmkdirlocaltimestrftimerename__snprintf_chk__memcpy_chk__sprintf_chk__ctype_tolower_locmemcmpunlinkctimegetpidfputsfflushfilenofsyncstrtouldirfdversionsort64unlinkatflockstrtoludev_device_new_from_devnumudev_device_get_is_initializedreadlinkioctludev_device_get_property_valuedirname__xpg_basenameblkid_new_probe_from_filenameblkid_probe_enable_superblocksblkid_probe_set_superblocks_flagsblkid_do_safeprobeblkid_probe_lookup_valueblkid_free_probestrtoullsetmntentgetmntentendmntentnvme_get_nsidposix_memalignnvme_identifysnprintfgetcstderr__vfprintf_chkfeoffwriteblkid_probe_enable_partitionsblkid_probe_set_partitions_flagsblkid_do_probeblkid_probe_step_backreallocferror__vsnprintf_chk__strncpy_chkaccessfdopenrand_rfstat64io_setupsysconf__vsyslog_chksd_journal_printv_with_locationabortdup2qsortgetrlimit64mallinfo2mlockallmlockmunlockallmunlockstrncasecmplocaltime_rmktimesysinfowaitpidsigprocmasksigactionsigaddsetsigismembersigdelsetudev_newudev_queue_newudev_queue_get_udev_is_activeudev_queue_unrefudev_unrefgetprioritysetpriorityforkwait4execvplockf64sd_bus_open_systemsd_bus_call_methodsd_bus_message_readsd_bus_error_freesd_bus_message_unrefsd_bus_flush_close_unrefsd_bus_error_has_namememchrsymlinkrmdirputchar__printf_chkoptargoptindgetopt_longnanosleepsetsidnl_langinfolvm2_disable_dmeventd_monitoringlvm2_log_levellvm2_log_fnlvm2_exitlvm2_initlvm2_runsetenvsd_journal_send_with_locationlvm2_init_threaded__fdelt_chkselectmknodgeteuidclock_gettime__isoc99_fscanfsemctlsemgetsemopgmtime_r__open64_2strndupmalloptsyscallsetvbufrewindtmpfile64pipesigfillsetgethostnameprlimit64dm_event_unregister_handlerdm_event_register_handlerstrcpyisspacesocketconnectselabel_lookupsetfscreateconfreeconis_selinux_enabledselabel_openchownlibdevmapper-event.so.1.02libdevmapper.so.1.02libsystemd.so.0libblkid.so.1libnvme.so.1libaio.so.1libselinux.so.1libudev.so.1libc.so.6liblvm2cmd.so.2.03BaseLIBNVME_1_0LIBAIO_0.4LIBAIO_0.1LIBSELINUX_1.0LIBSYSTEMD_222LIBSYSTEMD_233LIBSYSTEMD_221LIBSYSTEMD_209LIBUDEV_183BLKID_2.23BLKID_2.17BLKID_2.15GLIBC_2.15GLIBC_2.13GLIBC_2.14GLIBC_2.4GLIBC_2.28GLIBC_2.33GLIBC_2.3GLIBC_2.17GLIBC_2.7GLIBC_2.3.4GLIBC_2.2.5                       K   0t0 q0     H   x Pb b. b= bL   #[  @A g A r A }     ii    ii  ii ti ui  >% >%}>%~>%`| >% >%H>%>%*>%`2>%?% ?%P?%2h?%Y?%2?%*?%2?%(@%3@@%Zp@%4@%b@%> A%(HA%04`A%hA%X4A%A%A%0 B%48B%'hB%4B%B%PB%(6B% B%@7C%(C%0C%0@C%7XC%$pC%BC%7C%&C%:C%08C%m\D%@D%p80D%GxD%QD%8D%nD% -D%H:E%  E%88E%@;PE%E%<E%E%E%?E%E%F%@(F%XF%ApF%F%8F%CF%F%EG%G%.0G%GHG%`G%GxG% IG%OG%GG%8NG%G%8G%: H%]8H%@@H%hH%gH%H%yH%*(I%O@I%pI%XPI%I% QI%J%RJ%0J%HJ%R`J%J%SJ%J%J%UJ% K%W8K%.hK%(XK%AK%xYK%XK%@ZL%I@L%]XL%0^L%P^L%qL%``L%M%a0M%xM%M%@eM%M%eN%8N%PfPN%hN%hN%N%8kN% O%k(O% XO%npO%& O%7 O%oO%qO%qP%@u0P%huHP%R xP%uP%vP%wP%j P%6!Q%HwQ%  Q% PQ%whQ% Q%6!Q%8xQ% Q%pyQ% (R%(z@R% pR%zR% R%@R%zR% S%(}S%}HS%~`S% S%H~S% S%S%, T%@! T%8T%? PT%[ hT%T%c T%T%q T%T%PU% @U%XU% U%U% U%U% V% V%0V% `V%PxV% V%ȆV% V%W%! 8W%PW%; W%PW%P W%W%i X%(X%z XX%ȊpX% X%XX% X%xY% 0Y%HY% xY%Y% Y%؎Y% Z%x Z% 8Z%PZ%БhZ% Z%ؔZ%Z%Z% ([%X@[%. X[%? p[%H[%K [%؛[%p[%\ [%\%(\%gH\%p`\%r \%\%y \%p\%6] ]%8]% h]%آ]% ]%]% ]%^% @^%pX^% ^%^%r^%^^%ؤ^%b_%0_% x_% _%@_%_% _%_%ا`%  `%8`%HP`%*`%`% `%``%`%`%a%p(a% @a%Ha% Xa%Щpa% a%(a% a%Pb% 0b%Hb%* xb%b%0 b%(b%5 b%s{c% c%; Pc%hc%O c%Ьc%bc%xc%V @d%Xd%52d%g d%x e% 0e% 8e% He% `e% xe% e% e%e% e%  f%8f% f% f%$f%0f%>f%g%Q@g%Xg%hg%Pg%tg%g%h%0h%Hxh%h%ph%h%h%h%i%8i%Pi%hi%/pi%6i%ظi%Oi%i%fi%i%Pj%x(j%Hj%Xj%pj%j%k%0k%Hk%xk%k%k%k%l%H l% Pl%hl% l%l%l%8l%Nl%cl%Hl%tm%m%(m%@m%Xm%`m%pm%m%m%m%m%m%.m%pn%n%A0n%UHn%`n%Xxn%Un%n%mn%(n% o%x8o%Po%Xo%ho%ho%o%o%o%o%o%/o%Fo%p%Y(p%r0p%@p%Xp%pp%pp%p%p%Up%(p%q%Uq%`0q%Hq%Pq%`q%xq%q%Uq%q%*q%Pr%@ r%Q(r%a8r%@Pr%nhr% -r%r%r%xr%'s%(s%Hs%Xs%ps%s%s%s%ht%0t%Ht%xt%t%t%t%u% u% 8u%kPu%hu%"u%0u%4u%u%C(v%@v%Spv%Hv%tv%v%dw%w%Hw%`w%w%w%@w%w%w% x%x8x%Px%hx%x%x%x%x%x%@6x%y%(y%@y%HXy%&py%[y%y%8y%Ay%xy%_z%`0z%`z%xz%{z% z%z%8 {%8{% P{%{%`{%{%{%|%(|%X|%8p|%|%|%!|%1|%`}%?0}%hH}%:x}%}%O}%X}%e~% ~%xP~%h~%~%~%~%P~%%(%!@%p%$%|%%`%%%ƽ8%%% %H%ȁ%%(%(%@%0*X%3%+%;Ђ%+%D%-0%WH%"(`%-x%M%%-%a% .%j8%X.P%q%.%Ȅ%.%%%/(%@%X%hAp%%A% B%Ѕ%A%B%%0% CH% `%Cx%D%%pD%8E؆%'%0%E %88% FP%`Fh%A%F%(G%Rȇ%[%G%c%H(%@H@%lX%Hp%H%%}%`IЈ%%I% J%0%JH%J`%x%%pK%%K؉%pK%%@L %L8%P%h%PM%%%MȊ%%%@N%(%'@%NX%p%A%@O%Q%0Ћ%O%_%[%@P0%mH%`%Px%{%%@Q%}،%%Q%8%hRP%%R%%Sȍ%8S%%`T(%@%TX%Tp% %U%U%Ў%%V%4%@0%XH%`%x%Y%g%^%q%0Z؏%%XZ %P%Zh%%X]%%8^%(%_@%!p%Pa%0 % % %p 0% 8% @%` H% % % % %@ %@ В% ؒ% % % %0 % % 0%7 8%@f @%2 H%G X%O `% M h%k p%i x%PM %Y %5 %W %`X %X %%ؓ%%%f%b % *(%@r8%pX%@`%Fh%*%f%P`%*Ȕ%m%@%F%*@% P% X% `% h% x%@ % %0 % % %P % % % % %0 % % %@ % 8%0 @% H% %)%8%)%`,%Jؖ%C%pE%p*0%)8%@>@%*H%RX%PGx%D%F%*%iȗ%iЗ%lؗ%l%l%m%mh%ip%iP%QX%hx%k%pl%0eЙ%%%%*0%6H%?`%Mx%@%^%e%zؚ%%`% %8%P%h%%%%ț%%%%(%+@%7X%Hp%c%m%}%М%%%%0%H%`%%Q%Q%R% Sȝ%{.%.%.%.%.%.%.О%.%.%.%.0%.H%.ȟ%.%.%.%.(%.@%.X%.p%.%/%\/%/Р%/%5/%O/%d/0%p/H%.`%/x%/%/%O.%/ %`(%0%@8%@% H%7P%X%@`%@h%%00%2% %6%6%6% 7%`%ȥ%0Х%إ%% %p% %p)(%)0%P@%:P%<Ц%ئ%P%%%%>%)%/%@/ %(%0% @%p)P%P`%8p%<% % H% %` % % % % % % % %Г Ȩ% Ш% ب% %` % % % % %` % % % (% 0% 8% @%` H% P% X%p `% h% p% x% % % % %0 %` %p %@ % % ȩ% Щ% ة% %P %P %` % %` %p %0 %И % (% 0% 8% @% H% P% X% `% h%p p% x% % % %Д %` % % % % %` Ȫ% Ъ% ت% % % %` % % % % % % (% 0% 8% @% H% P% X% `% h% p% x% % % % % % % % % % ȫ% Ы% ث% % % %0%P%p%,%,%8Ь%8%D%D0%PP%Pp%\%\%hЭ%h%t%t0%P%p%ԩ%ԩ%ԩЮ%%%0%P%p%%%(Я%4%@%L0%XP%Xp%%%а%%%0%P%p%Ī%Ъ%Ъб%ܪ%ܪ%0%P%p%%%в% % %0%@%{H%P%X%,`%3h%@p%Nx%Z%f%n%v%%%%%%Ʀȳ%Ԧг%س%%% %%)%7%G%U%b %o(%y0%8%@%H%P%§p%06 x%< %8 %9 % %A %> %PV %X ȴ%4 д%W ش%0X %X %%;(%0%8%;X%`%h%;%%%;%%ȵ%;%% % %%;8%@%гH%EP%Uh%г%k%g%w%k%ȶ%8%{%%%a; %{ %1(%s{0%+v H%1`%qh%p5p%%q%%%0%ȷ%%@%%%0 %(%H%@P%X%x%0%%%@%%ظ%0%%%@ %P(%0%H%0`%Ph%p%%@%f%%0%fȹ%%@%]%%(%0@%]H%P%h%@p%gx%%0%g%Ⱥ%@%Z%%%%0 %Z(%0%8%X%@`%Gh%ýp%νx%%0%G%ý%ν%ػ%@%!%%0%!%8%@@%6H%P%h%0%6%%%@%)ȼ%м%%0%)%%(%@@%'H%!P%.X%x%0%'%!%.%%@%ӽȽ%!н%ڽؽ%%0%ӽ%!%ڽ%8%@@%H%!P%ƴX%x%0%%!%ƴ%%@%!Ⱦ%%0%!%%@ %(%0%H%0`%h%p%%@% %Z%ȿ%0% %Z%%@%%8%0@%H%h%@p%x%%0%%%@%%%%0 %(%0%H%@`%h%p%%0%%%%@%%H%1%s{%+v (%1@%qH%p5P%h%qp%x%%0%%%@%H%%0%H%(%@0%"a8%X%0`%"ah%%@%U3%%0%U3%%@%%%0 %(%H%@P%X%x%0%%%@%%> %%0%%> %(%@0%c28%X%0`%c2h%%@%U3%%0%U3%%@%ֳ%%0 %ֳ(%H%@`%,h%) p%;x%%Ѻ%%g%%%|:%5%o`% 0% 8% X% `% h% %Ј % % %p %P % % % % %p H% X%P h% % %Ц % % %P % %` % %H%`%%%@%% %%(%%0%%8%H%%P%%X%h%%p%%x%%%%`%%%P%%0%%% %%%%%%%%%%%%%%(%p%0%P%8%H%@%P% %X%h%%p%%x%%%%%%%%%%%%%%`%%%P%%0%%% %%%%(%%0%%8%H%%P%%X%h%%p%p%x%%`%%@%%% %%%%%%%%%%%%%%%%%`%%(%@%0% %8%H%%P%%X%h%%p%%x%%%%p%%%`%%@%%%0%%%%%%%%%%%%%%(%%0%`%8%H%@%P% %X%h%%p%%x%%%%%%%%%%%%p%%@%%%0%%%%%%%%%(%%0%%8%H%p%P%@%X%h% %p%%x%%%%%%%%%%%%`%%@%%%0%%%%%%%%%(%л%0%%8%H%%P%`%X%h%P%p% %x%%%%%%%%%%%%%%p%%%`%%@%%% %%%%(%%0%%8%H%%P%%X%h%%p%`%x%%@%% %%%%%%%%и%%%%%%%%%%p%%P%%(%@%0% %8%H%%P%%X%h%%p%%x%%%%%%%%%`%%%@%% %%%%%%%%%%%%(%%0%%8%H%`%P%@%X%h%0%p%%x%%%%%%%%%%%%%%%%%%%%%%`%%(%P%0%0%8%H% %P%%X%% %0%2 8%(%C %h%PD %P%D X%%C %%Pz %p% { x% % %P0%" 8%%`! %% %P% X%4%@ %% % p%0 x%P%Ђ %x0% 8%%# %J%$ %P%: X%%{ %%0 %@p%0 x%x%a %0%W 8%b%u %%e %P%E X% %PF %X%Z %p%PN x%%O %0%PQ 8%X%R %% %P% X%%`f %X%f %p% g x%%q %0%s 8%%t %(%PT %PP%@U X%%`B %%A %p%: x%X%; %0%P< 8%%= %%= %hP%p> X%%@? %%P@ %@p%0 x%ž% %0% 8%%pv %%`w %P% X%@%p %h%` %Ӿp%g x%% %0% 8%%a % %P % P%@ X%% %X% %p%~ x%2%0o %0%n 8%%o %8%p %P%p X%% %L% %`p% x%s%` %0% 8%% %% %P% X%% %ѿ%  %0p% x%%` %X0% 8%%` %%P %P% X%% %(%0h %Xp%pX x%%h %0%` 8%% %7% %P% X%U%% %% %np%P x%%m %80% 8%% %% %P%\ X%h%] %%0e %p%@V x%%@\ %0%l 8% %[ %X%4 %P%P X%% %&p &p&b x&&b &80&0 8&ž&@n &h&n &P&@V X&&@V & &P6 &p& x&P&Px &0&Py 8&x& &n&0 &P& X&&P7 && &p& x&)&P &B0& 8&&p &Y&0 &oP&` X&&9 & &Y  &p &\ x & &0 &0 &0 8 & &@ &P & &xP &0` X & &b & &b  &p &b x & &b &80 &b 8 & &d &p &pe &P&f X&&b &&0 &žp& x&&d &0&`d 8&8&`_ &h&^ &P&d X&& && b &p&0b x&@&i &p0&`j 8&&b &&k &P&j X&&b &@&0` &hp&0` x&&Z &0&g 8&@&0 && &P& X&& &&p &8p&c x&&PY &0&b 8&&Y &@&c &hP&0 X&ž&P && &p&` x&X&P &0& 8&&h &(& &XP& X&&  && &p& x&& &0& 8&8&` &`& &*P &` X & & &!& !&p!&` x!&!& !&E0"&` 8"&("& "&`"&` "&P#& X#&#&` #&$&` $& p$& x$&H$& $&0%&b 8%&%&b %&[P&& X&&&&  &&'& '&y'&b '&0(& 8(&(& (&(& (&P)& X)&)& )&*& *&p*& x*&*& *&10+&0 8+&>+&0 +&E,&1,&R,& (,&V0,&e8,& H,&iP,&eX,& h,&p,&ex,& ,&x,&e,& ,&,&,&0 ,&,&,&@ ,&,&,&P -&-&-&` (-&0-&H-&P-&X-&p h-&p-&-&-&!-& -&-&-&-&-&-&*-&Q-&@.&(.&PQ.&" .&((.&Q0.& @.&(H.&QP.& `.&(h.&(p.&".&(.&(.& D.& ).&Q.&.&%.&Q.&c.&b.&).&/& '/&0)/& /&H)(/&Q0/&P@/&%H/&R)P/&`/&p)h/&(Rp/&Ю/&z)/&Q/&P/&e/&)/&]/&)/&hR/&/&)/&)/&0&)0&)0& 0&)(0&R00&`@0&)H0&RP0&`0&Eh0&Sp0&0&)0&)0&0&%0&*0&0X0&0&8S0&0"0&-*0&hS0&@1&4*1&S1& 1&=*(1&S01&@@1&iH1&SP1& `1&B*h1&Tp1&p1&I*1&PT1&`1& 1&T1&1&S*1&T1& 1&\*1&e*1&2&*2&T2&p" 2&*(2&*02& @2&*H2&*P2&`2&*h2& Up2&2&2&`U2&2&^2&U2&@2&*2&U2&2&*2&U2&3&*3&V3&D 3&*(3& V03&@3&*H3&PVP3&0`3&rh3&+p3&s3&+3&xV3&0s3&$+3&V3& 3&-+3&V3& 3&6+3&V3&4&?+4&M+4& 4&i+(4&(W04&@4&y+H4&+P4&`4&+h4&XWp4&4&+4&W4&4&N4&+4&4&+4&+4&P4&+4&W4&`"5&+5&+5& 5&,(5&W05&H5&,x5&5&,5&05&@25&, 6&2(6&",X6&1`6&%,6&Ь6&Ь7&Ь87&Ьp7&7&Ь7&,,8&0 8&F,P8&0X8&M,8&8&0X8&`8&V,8&@9&q,09&89&,h9&pp9&{,9&9&,9&9&,:&:&,H:&pP:&,:&:&,:&:&,:&0:&,(;&@0;&,`;&h;&,;& ;&,;&;&52<&Ь<&XX@<&H<&Xx<&0<&X<&`<&,<&<&- =& 3(=&!-X=&3`=&-=&@4=&=& =& Y>&>&6-8>&@>&A-p>&x>&N->&0>&b->&>&@Y?& ?&YP?&@X?&Y?& ?&y-?&,@&,@& @&@&0@&0@&@&0@&@&0A&0A&0(A& 8A&HA& PA& XA& E`A&9 hA& pA& xA& EA&RA&0B&R8B&B&B&B&B&*C&6(C&?@C&MXC&@pC&^C&eC&zC&C&`C&D&D&0D&HD&`D&xD&D&D&D&D&D&E&+ E&78E&HPE&chE&mE&}E&E&E&E&E&F&(F&@F&hF&xF&F&F&F&F&F&`F&F&PF&G& G& (G& HG&X xG&PG&PG&G&G&ЍG&G&G&G&H& H&`(H&8H&HH&XH&hH&xH&H&H&pH&pH& H& H&H&8H&07I&4I&9(I&E8I&;HI&;XI&4hI&4xI&P5I&5I&@I&@I& 5I&`I&`I&5I&5J&5J&7(J&`a8J&`aHJ&XJ&hJ&xJ&pJ&0J&J&J&J& J&pJ&pJ&K&K&p(K&`8K&@HK&жXK&жhK&жxK&жK&жK&жK&жpQ&(Q& A Q&C Q&RQ&Q&R&UR&Pb pR&RxR&R&RR&@S&A PS&A XS&hS&A pS&C S&C S&:S&C S&2S&D S&(S&D S&!S&$D S&](S&6D T&r(T&AD T&u(T&JD 0T&8 @T&\D `T&A pT&F xT&lD T&xb T&pD T&b T&oD T&b T&rD T&0c T&T&hc T&uD U&c U&8U&c U&xD 0U&d 8U&_HU&0d PU&~D `U&`d hU&xU&d 0p&@p&@p&Hp&@p&Pp&Pp&Xp&Pp&`p&`p&hp&`p&pp& 1p&p&p&p&p&18&8&@&8&H&H&P&H&& & &0&`&`&h&`&&&&&&&&&&&&& & &(& &&Ј&Ј&؈&Ј&&&&&&&&& & &(& &0&0&8&0&X&h&A&&m&`&&&X&X&`&X&&&&&&&&&& & &(& &0&0&8&0&@&@&H&@&P&P&X&P&x&&&&&Ѝ& &`&p&&&&&&&Ȏ&&Ў&Ў&؎&Ў&&&&&_&_&F_&O_&P_&Z_&]_&__&_&_&_&@X&HX&PX&XX&`X&hX&pX&xX&X& X& X& X& X& X&X&X&X&X&X&X&X&X&X&X&Y&Y&Y&Y& Y&(Y&0Y& 8Y&!@Y&"HY&#PY&$XY&%`Y&&hY&'pY&(xY&)Y&*Y&+Y&,Y&-Y&.Y&/Y&0Y&1Y&2Y&3Y&4Y&5Y&6Y&7Y&8Y&9Z&:Z&;Z&<Z&= Z&>(Z&?0Z&@8Z&A@Z&BHZ&CPZ&DXZ&E`Z&GhZ&HpZ&IxZ&JZ&KZ&LZ&MZ&NZ&QZ&RZ&SZ&TZ&UZ&VZ&WZ&XZ&YZ&ZZ&[Z&\[&^[&`[&a[&b [&c([&d0[&e8[&f@[&gH[&hP[&iX[&j`[&kh[&lp[&mx[&n[&o[&p[&q[&r[&s[&t[&u[&v[&w[&x[&y[&z[&{[&|[&}[&~\&\&\&\& \&(\&0\&8\&@\&H\&P\&X\&`\&h\&p\&x\&\&\&\&\&\&\&\&\&\&\&\&\&\&\&\&\&]&]&]&]& ]&(]&0]&8]&@]&H]&P]&X]&`]&h]&p]&x]&]&]&]&]&]&]&]&]&]&]&]&]&]&]&]&]&^&^&^&^& ^&(^&0^&8^&@^&H^&P^&X^&`^&h^&p^&x^&^&^&^&^&^&^&^&^&^&^&^&^&^&^&^&^&_&_&_&_& _&(_&0_&8_&@_&H_&P_&X_&`_&h_&p_&x_&_&_&_&HH%HtH5 %% %hhhhhhhhqhah Qh Ah 1h !h hhhhhhhhhhqhahQhAh1h!hhhh h!h"h#h$h%h&h'qh(ah)Qh*Ah+1h,!h-h.h/h0h1h2h3h4h5h6h7qh8ah9Qh:Ah;1h<!h=h>h?h@hAhBhChDhEhFhGqhHahIQhJAhK1hL!hMhNhOhPhQhRhShThUhVhWqhXahYQhZAh[1h\!h]h^h_h`hahbhchdhehfhgqhhahiQhjAhk1hl!hmhnhohphqhrhshthuhvhwqhxahyQhzAh{1h|!h}h~hhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhAh1h!hhhhhhhhhhhqhahQhA%U$D%M$D%E$D%=$D%5$D%-$D%%$D%$D%$D% $D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%}$D%u$D%m$D%e$D%]$D%U$D%M$D%E$D%=$D%5$D%-$D%%$D%$D%$D% $D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%}$D%u$D%m$D%e$D%]$D%U$D%M$D%E$D%=$D%5$D%-$D%%$D%$D%$D% $D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%}$D%u$D%m$D%e$D%]$D%U$D%M$D%E$D%=$D%5$D%-$D%%$D%$D%$D% $D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%}$D%u$D%m$D%e$D%]$D%U$D%M$D%E$D%=$D%5$D%-$D%%$D%$D%$D% $D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%}$D%u$D%m$D%e$D%]$D%U$D%M$D%E$D%=$D%5$D%-$D%%$D%$D%$D% $D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%}$D%u$D%m$D%e$D%]$D%U$D%M$D%E$D%=$D%5$D%-$D%%$D%$D%$D% $D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%$D%}$D%u$D%m$D%e$D%]$D%U$D%M$D%E$D%=$D%5$D%-$D%%$D%$D%$D% $D%$DH% HiL1ɺIH5r1JH%H %L H% %L H%h %T H%p H% H% %T H% %L H% H% H% H% H% H% H% H% %L H% H%P H% H% %L H% %L H% %L H% H% %T H% H% w H% %L H% H%X H% H% H% H% H% H% H% %( H% H% % H% % H% H% %T H% %( H% % H%X H%` H%h H% H% H%h H% H% H% H% H%X H% H% H% H% H% H% H% H% % H% %T H% H% % H% H% % H% % reL;1ɺIH51%L %L H% H% H% H% %( L% H% H% L$% H% H% %T %T %T %L % H% H% %L %L %L %8 %L %( %P %P H% H% %L % %< H%0 %L % 1H|$P %8 %L HD$`HD$hHD$`%L H% H% H% H% H% % %L %L %L %L %L %L %L %L %L %L %L %L %L %L %L %L %L %L %L %L %L %L H% H% % H%0 H% %( H% %L %L %L %L H% H% HD$ H% H% H% H% H% H% H% %d H% L,% H% %H %L H%h H% H% H% H% H%h H% H% H%X H%X H% %< %@ %D %p H% H% H% H% H% H% H% H% H% H% H% H% H% H% H% H% H% H% H% H% H% H% H% %T H%X % H% H% H% %H H% H% H%0 H%  H% H% H% H% H% H% H% H% H% H% H% H% H% H% %` %0 H% H% H% H% H% % %X %Y % H% % %L H%0 H% H% H% H% H% % H% H% H% % % H% %L H% H% H% H% H% H% H% %L H%X H% H% H% H% H% H% H% H% %L H% H% H% H% %L H% H%h H% % H% %L % H% H% H%h H% H% H% H% L% H% H% H% H%h H% H% H% H% %  H% H% H% H% H% H% %L H% H% H% H% H% H% TH% 1H% % H% %L H% H% H% %L %  H,% H% H% H% HD$ HD$(HD$ H% H% H% H$H% H% H% H% H% H% H% H% H% %L H% %L H%` H%` f.@$%P$%tD I%AVAUATUSEt!L@ H5A$^H='$%HtH=f$%H $%HtL5$%H-$H8$%LH9m^1L% LL@$Hy$H9t=L-DHIs e1ML$HXZH9uLiLL1$$[s#%]A\A]A^LfUH=9Ht 8H=$HHtH5H3u $]H5mHtH5>Hu$]$]DH=%H%H9tH$Ht H=%H5%H)HH?HHHtH$HtfD=u%u+UH=$Ht H=#)dM%]wAWAVAUATUSHdH%(H$1HHLL9HD$1Ld$@H$L5uDHCA龀LHPPL@H1HL蘇PTIH/LHHPLLxLt~Yu]LH- &1L1ɺ H1H$dH+%(H[]A\A]A^A_fDH4$L\LueDH-fj$LLuUf.L\1ɺ H-Z1H<A[T$uSHL93f.1L~1ɺ H5~1D$ u>SH/LHD$#LD$HtQLHPLZwLD$LDžLD$H|$AE7H-b~XfD2$LLLD$tLD$L'~1ɺ Gd uAATUSHt[]A\HGPHL 9HLt[]A\H][]A\ff.@AWIAVAUIATUSHHFH@ H@`HtH|$H|$AIEtnLHI9t[Il$HHH9t,LHH|$pH|$AHH9uIEM$$HI9uHHt @dAUL1ۅuA9]LH@IHЃ8uHHPHHH9ufH6H9tF 9rF$9sLH|$H|$AuL=|1ɺM1H59| GfDH- |1ɺ_1L|HL{11<HHD[]A\A]A^A_DAዀHFH@ H@`HH|$LH|$AL41CH5p{W{L11H5G{.RfAWAVIAUATAUH-6 %SHH8HFPH|$ HHt$dE1HHD$IIcHH#H DwL_QH1IPH5zm1LLc Y^MIGHD$(f@I\$<@HD$L|$HH@PLHuB;?Ah @HE1L1LW4E1нfDLW1ɺ01L諽AUATUHSHdH%(HD$1HGPHH8{$u'E1HD$dH+%(HD[]A\A]fHHE1E1j11HjjH tHL-W-LwLI\1HHAąt%H$AHPH8HRHfOLV1ɺ`1L蓼*yfAWAVAUATUSHHdH%(HD$1HGPHH8W$u3E1HD$dH+%(>HD[]A\A]A^A_f.HHE1E1j11HjjqH tHL-U,LvLIs1跻HHAąL4$IFLx8MtXLL`HCPLHHx!fHt,LLHAHEI>eHEL4U1ɺ}1LE1fDL U1ɺw1LٽfATUHSHGPH8$u41E1LuH5T蝺D[]A\DHIE1E1j11HjjH tHEPHH8Qd HHH/HEcH;H L!THHjE1E11j1jj1@ H HHHx`HL HE`HH AąAHH;cD[]A\fHE15*LtIH5T1^@1E1LOS1ɺH5MS4D[]A\@L$S1ɺH5IT1E1]LR1ɺ1H5T׸( AąLR1ɺ1H5S衸ff.AWAVAUATIUHSHhdH%(HD$XHG`H-H2HEPHH88b L4R1ɺHHEH-H;HHh LRHHHt$ jE1E1j1ҿ jj> H IHD$ LD$H;aD$iHH9HHhHE`H2H (L*sI1H5MQ41HT$XdH+%(Hh[]A\A]A^A_HL=4R'LILr1ֶIUH9HjHT$H'H5D@H訹AƅHT$LD$H;HrLD}4H; aHNf@I$HHHT$HPH@L@Tf.L P1ɺ H51Q1H;'`LO1ɺ1H5OƵ1H`&L?qIPH-LH1UL ?LLo]LXZ_fD1ɺ!LL5O-LU1Hr0HJ HzLBM $HHH9fHfH*HfH*^Yq,AADpHMI9MfI*HWfH*^Y,=DAAHuWEqLYI$1L1LN$LAAHB(HtH9HmfH*H=fH*^YLD,EVADDD@HMAA@H1MIfII I*XHHfHH H*XLAfHL H*XcIIfIAM I*XdAAMAA?HȃfHH H*XHƒfHH H*X~AAff.fAWAVAUAATIԺUHSHhdH%(HD$XHGPHH8[ LK1ɺ(HH8HX\HfH@HI$'H;HH LrKOHHHt$ jE11AUE1ɿ jj7 H 1ɺRIL-KHt[Dt$ EH?H;G[HD$XdH+%(8HhD[]A\A]A^A_ÐI$LJ1ɺKH5K1跰H;ZLJ1ɺ-H5J1E1苰fDHL=K!!WLILl1NIUHLrHT$MH5uKL ŅtBH]1AVL NKLLBjLXZ'fDHT$LD$H;HrL{7HI$HHD$HB@8t.HBLA|L5<Z@Hp HxHtZ1HtSH9HNfH*HfH*^Yά,ȅ9DΉJHPI $H@HHtOH9HfH*HxvfH*^Yb,DiLA{f1ɺcLLmHeLHЃfHH H*XuHƃfHH H*XIHfHH H*XHfHH H*X-覰fDAWAVAUIATUHSHXdH%(HD$HHGPHH8rW HHH"IEcH;LH HHHt$jE1E1j1ҿ jjX3 H IHDt$EunL&H;.WHD$HdH+%(HXD[]A\A]A^A_HaHEP5$L0E1DDHL=G1LGLI1^ID$HHx LpLHLL$MH5aL LL$Mt*L1LLL$H5oGզLL$AHLL$HLhPLL$1L譫LսXZfDH!HE1E1jH1HjLHD$(PL H 0L$HLILg1LELE1ɺV1H5 EE1@LD1ɺR1H5DE1ĪLDH5E1虪E1H5HMLgPL\D1ɺ1H5E?%f.1ɺE1LDH5"D@ATIUHSHW`HGPH HHH8S HLHHH t-LHH AtXH;SD[]A\L|C1ɺH5DaL]C1ɺ1H5YCE1=L4C1ɺH5TD1E1LC1ɺH5CD[]A\@AWAVAUIATUHSHHHW`HGPDfH HH8HR HIIEPL8LhH1HtLLECEL1HLAF{ AŅt4AFAEI>oRDcHD[]A\A]A^A_f11LBH5/CLA11H5AΧ@LA1ɺ1H5AE1褧tff.@AUATIUHSH= tAHD[]A\A]I<$HRIHtHl= tLHH-5AHHLcSIH1It$XLZIT$AądL@1ɺ1H躦HDAVAUIATIUSHGPL0LfH1HtLLLIU`AD$IEPH HH8HEP IHhLKLHU AątAI>PP[D]A\A]A^@11L?6H5AߥL?11H5?辥@1E1L?1ɺH5?蔥[D]A\A]A^AWAVAUATUSHHD%w$dH%(HD$81ELHHE1L-B?L9L|$ M6I9txI~?; tD$M^H;EHm@LHT$HLHT$I1LaR賤M6Y^I9ufH1ELLasXZHD$8dH+%(utHHD[]A\A]A^A_HE1E11jLLjjL\$(H L\$t1|$A=$H]ئAWAVAUATUSH8D%׭$dH%(HD$(1EHLHE1L5=I9t^IfHL9tHH{9 tDt$HsH}EuLS=1ɺ1L:HL9ufH1E%LL>XZHD$(dH+%(uRH8D[]A\A]A^A_HE1E1Lj1jj>H [L$1A芥f.HdH%(HD$1D$F@t!HF H@XHt51HT$Ѕt(D$t!HT$dH+%(u4H1L_7H5<1ff.UHSH85$dH%(HD$(HGPH8u\H==HeHL^SI1H5;艡X1ZHT$(dH+%(uSH8[]fDHHE1E1j1HjjH A$Eu F$jH [e ff.fATUSH@dH%(HD$8HG`@ H%HH/HCPǪ$L H$HE1E1jH1HjLHD$PB H tX$tqHyuH]H}6 AątnAHD$8dH+%(H@D[]A\L:1ɺH5:HAtHy@HLv; IH591詟H]`A HfDH#HH#C`Jf.UHSHHH9t9HCHxHG`@u uHuHCHxuHH9u1H[]DHCHxL:K IH581輞HCH@H[]ff.fAWAAVEAUIATUHSHHjIHHHtbLHtHLbLLuKDL谙DL襚HL[]A\A]A^A_!1H!lHHDL71ɺ[1H57违LE1TfL71ɺU1H57菝DL71ɺX1H57gDL\71ɺO1H5X7?%f.ATUSHH $H1dH%(H$1H(k8/HHXHL$1IHPL=uF1ҹHLTHtGLH$dH+%(ukHĠ[]A\HLufDƄ$fD1ҾHijHXHHJL$c@AVAUATIUSAHIHHILWI}HH( L51ɺHHt`A1LLHHt71HtYAuvH[D]A\A]A^f.L\51ɺ1E1H5P5<[D]A\A]A^Ht A%AL51ɺ1H55E1a1L41ɺH54跚[D]A\A]A^ff.AWfAVIAUATAUSHH|$L$dH%(H$1)$D$\D$XDŽ$)$)$)$)$)$Ht BIՉ$$ED$L$ur$d$D$IF`H.r H/2IIH9ǸHD7BH H@@e EL HHE1E11j1Ljj^H IIL8H9D$HH-(L4$MMELd$Hp1DL4I9SLM6MLf(1ɺL%d(1LFHމIFPH8<$HL$`HE1E1jLjj肸H \$hLHLKSI8D$\%IFPHLHHxIq1ED$HbAEPL LUK?IH5M'12D$ML'1ɺIpHH H$H߅$(1ɺLL&蹌D$HML&1ɺ#L&1ɺ&H5&wQI~H1ɺPL :FLJ1ɺ[HL7&/D$HEL4$M_ML4$IGHP HtHHtwLHLH1ɺSILiJL L%1ɺg1H5%訋D$HML;|$(NfHX(H<$!1ɺLILI1QD$#/ff.@AUHATUSHL'I9AD$L1)fDI$HtH؃8tkA9l$LH@I$HH؃8uHxңAŅu1L$1ɺ H5$芊HD[]A\A]@Hx菣AŅu1Lb$1ɺ H5`$GHD[]A\A]fHA[D]A\A]ff.UHH dH%(HD$1HD$ HD$H9t HuPHt$HtHD$HT$dH+%(u-H ]HL$H1HZ1gAWAVAUATIUHHSHdH%(H$1j jID$`@u uLHH[LgD=$fIID$`)D$`)D$pHH,)D$PH+D$pT$lEKHHHHLHzfÀ`Me`A'IIAIH9u?HH9dHPHzyL8 LIIH"HD$H1Ht$1L!1ɺ Ӈ1[LHH_LHTH LFSI1H5!xX1ZH$dH+%(HĘ[]A\A]A^A_I IEPH HILD$ Ld$ LLίDt$ Ey1LHLR\$ rIEPHLD( LGInH HD$LHt$1L.FI 1BHL$ HE1E1j1LHjj薰H L$ tD$$u T$81LLd$P/6H5 H LLH=LLHu"Ht$L11n {LF!f =$f1LMEH5=1'IEPHxMe`AIIffMe`rHIU`HH!H9MH"H!EVLEt|E1+IHtH| u0AE;fLsLDH@IHH|Gatb tL> LEIDD$EL  AEeaLl$xL$ht$p|$lH=L=L DD$PL5K L%0OHLDLLDLDEHD3AWLE AVIS ATHlSHHD$01MD V$H EHt$L011Z #DLLyB1ɺIHHD$H1܂L@H@HD$L4$L9*IMHD$fHD$I^I9IfM?M9IwHhuL[1ɺ1H5>L! LBIMe`LD$hLl$xDM6L9t$:IEPL L H$HXM9t+MfDM6M9tIvH蔄uH$HH$H9D$uLHt$1L`I1LH9HhAuIHBc2 H LID$8H$LT$  HC8T$@T$   ‰T$Dvu HDŽ$H$Hv\ HDŽ$HDŽ$LuMLLHD$PH$H$tHD$HteI$H% L9 HpH|$h$HHH9HpH|$h$fƄ$Ho$H$)$L)$Ao)$AoU)$I9II0MA0L9fDHQH7HGH32H3BH HwHGH3rH3BH LjPHJXAHaMtJH\$0HHl$8DILHgTIHYbL9uH\$0Hl$8$HD$8HD$0$H|$HLOeH|$HHA?eH|$XLD$`H|$XHމD$d|$D$h||$ D$l|t$@|$D$pt$D|$ D$tH *D$xHD$HHEHHL$HyH9pHPI$HOL9FHHHHEL*Lt$|$TL1W|$8WR|$hcW|$HWQ@YcHD$xH@H=MHHEHHH9HpHD$0H !HHEI$HL9HPMHL+LDHHEWVLL1Q@RiAUbHH$H0HH9HPI$H$HL9HpHHEL+)Q@RLo1WVLt$x;b$H0HHHDHH`H9WHxDl$dH HEHDI $HL9HqHMRL(uWPL1@VLaH D\$pH'H?EHDHHH9HxDT$lH Hg?EHDI $HbL9YHqHMRL zWPL1@VLaH DL$xHHEHDHHH9HxDD$tH OHOEHDI $HL9HqHMRL'WPL1@VLl`$H HHHDHH1H9(HxH EHHDI $HL9HqHMRLWPL1@VL_H|$PH 8]H|$8.]L$|r$Hl]I$HmH;l$H$Ll$HHxH@hI9g MtI$Ht L9=H ei$HtHHt H9HHi$Q@LPLL$81L&_H$ZYHt$HPHHI9H9uMtI$Ht L9Hh$HPLL$8L&L1^Ht$H$[A\A^UDH L9IT$ID$H3UH3EH 8A[]DA\A]A^L 1Q$AT$1LIS@H5FXZfDM1LH5SF[D]A\A]A^DL DLLPCff.fAWIAVLrAUATUHSHH(L"MH5L!BH5LM`LC@LmPMt(I}HLLD$LL$ ILL$LD$LLHLtAŅMF1LH5PEH(D[]A\A]A^A_@LmPMIMHHtHϺHL$XAHL$t_HEhHHHH9LJH:1QL1H5AE[]`fDLM`LC@LmPLLHAŅCCPu H{XS`t*9sƅvƅL}PMAHsX{T9GHMhAƇAAIHLMI9MHHL@VWPATRL-|1LCHC@H0LsHL[8LS0HD$HEPHPPD1҃t~HpHHEhAH'~H HDHUHHIH9@LIL\$1L~@LT$RVL@CAYHEPAZLT$L\$DPPMLMt'LLLD$L\$FL\$LD$LL\$Q@HUPH|$HT$EHT$L\$HHHEhHJHHSHHGH9>LJASL 1Q@LgB_AXMHEPLMtLLLD$;ELD$t}L?HUPLHT$iDHT$HH.HEhHJHHHHH9~LJAVLL 1Q@AY^H|$HHEPLMt LDtwL>H|$LuPCIHFHEhINHHHHH9LJt$ 1LQLE @AXZMG0HhMG0H MG8HHH9tCfDHqHHpHI0Iw8LHqIO8HHHIW8HH9uALnPM1L -H5 o@HE`L`8M IEH9uA9tHMhHtL Mt I9vH ?J$PM1E1APL VH5WRQ1?AƇH0Kd&@D[TEfDDDMO1Lb H5y?@HMhAAIHLMI9MHHL2 @VWPATR"DHMhAƇHtLMtwI9trMHHL+ @AVH5`WP1ATR>H0IIL H$K@L H$O@L H$L H$)@L yH$z@L iH$@L YH$&@L IH$;LL$LL =MLL1=MLl L=MLL=@AULoATIUSHHoHt=H]L9t4fH}:HUHEHHHBH:HI9uIl$@Ml$Ml$Ml$@Ht7H]L9t.H}w:HUHEHHHBH]:HI9uMl$HMl$@H[]A\A]HwHtVxdu?HF$H F$L!H9u HH9t@H;BuLLHH?LHLfLHLÐff.ff.HI11L9*H59;Hf.988AWAVAUATUHSHL/HGMHF8IH$Lt$I9t#L~(HI~(L%>Aąt>M6L;4$uH|$tyH$AHEIHEIH(I;Hs1MLAH58:XHE HZPhHD[]A\A]A^A_O8ff.@AUATUHSHHH7H;L`L IHtLHH@IL-81ɺN1L8L:H;H@HjAątHA[D]A\A]IL1LDL1ɺ;1H5 01(fHSIOHHHtHQML9P8OfDHEL LHPHHCHtLHL::RAfL|1ɺO1H5s/_1f.HEL HPHHCHtLHLj:RH;f.HJHHSHHtHQML9PDoHEL rHPHHCHtLHL@:RUHEL <HPHHCHtLHL :R[HEL HPHHCHtLHL9Ra]HEL HPHHCHtLHL9Rg'HEL HPHHCHtLHLh9RmHEL dHPHHCHtLHL29RsHEL .HPHHCHtLHL8RyHEL HPHHCHtLHL8ROHEL HPHHCHtLHL8RHEL HPHHCHtLHLZ8RHEL VHPHHCHtLHL$8R1H5,E1{.XZHEL HPHHCHtLHL7R_H{EL7IHEQpH1@ATUHH5,SHhHHHPH1.fHH51HH@HPH1-Aą pH5,H1-Aą1" @: +HHH H5,H1,-AąAHH5,H1 -AąL1ɺ1H5*,$L1ɺ1H5*,D[]A\ALq11ɺH5h*T,D[]A\@HH5+H1`,Aą5fH5{+H1!,AąL1ɺ1H5)+9HH5+H1+Aą/H5*H1+AąfH5*H1y+AąfH5*H1I+AąfA[]DA\fHxH5)H1+AąM?HH5)H1*AąMHH5)H1*AąML\1ɺ1H5S(?*f.H5)H1I*AąfH5)H1*AąL1ɺ1H5')1L1ɺ1H5')f.L|1ɺ1H5s'_)f.LL1ɺ1H5C'/)f.L1ɺ1H5'(sf.L1ɺ1H5&(Cf.L1ɺ1H5&(f.L1ɺ1H5&o(f.L\1ɺ1H5S&?(f.L,1ɺ1H5#&(f.L1ɺ1H5%'Sf.ATUHH5 |SHHHH@HPH1'zHH5'H1'Aą'HH5)H1'AąH5o'H1m'AąBH5&H1K'AąxHH58'H1('AąHHt HPHH5!'H1&Aą <d$Lt HH)A"LL1ɺ1H57&/&D[]A\AL11ɺH5&%D[]A\@L1ɺ1H5%%D1L¿1ɺH5%%D[]A\L1ɺ1H5%w%CfH5%H1%AąfH5%H1Y%AąfH5%H1)%AąjL1ɺ1H5$$H5%H1$Aą.L1ɺ1H5$$OfDH5a%H1$AąLX1ɺ1H5C$;$fDH5*%H1I$AąL 1ɺ1H5##Lܽ1ɺ1H5##f.H5$H1#AąL1ɺ1H5{#s#?fDH5#H1#AąthfDH5#H1Q#Aąt^rfDL1ɺ1H5""L޼1ɺ1H5""L1ɺ1H5""gL1ɺ1H5}"u"ALl1ɺ1H5W"O"f.H(dH%(HD$4,$t n$n$t HT$dH+%(H(HL$ LL$m$LD$H5VKm$tT$ t$|$vm$m$1LJ+ H5l!1UP$H(dH%(HD$T+$t ^}$T}$tHT$dH+%(uvH(HL$ LL$#}$LD$H57~J}$tT$ t|$w1L*H5  1z#DAUL-ATIUHSHHH9u 3HH9t(HsLd#uHA[D]A\A]@LLHAąu1L]*!H5# HD[]A\A]ÐAUL-6ATIUHSHHH9u 3HH9t(HsL"uHA[D]A\A]@LLHJAąu1L) H5woHD[]A\A]ÐAUL-ATIUHSHHH9u 3HH9t(HsL$"uHA[D]A\A]@LLHAąu1L)H5HD[]A\A]ÐAVAUATUSI@@ &IH1LHHp L1ɺ(IHLMt'1LH LT1ɺ,IHHHH|$0 D (HHMHD$0A<$H8HwHXH|$0 LϷ1ɺH5($L1ɺ81H5[1]A\A]A^LQ(#1H5d\1[]A\A]A^ÐLY(0DLHXHH8M1L?(H5U'$=L"1H5+'$fDHD$0A}H8uqHwHuHH|$0L1ɺH5&$fLl1ɺ1H5t&$fLHEHHHuM1Lv'H5*d&$LoHD$0`opooDǀBff.AW>AVAUATUSHXH$LD$(Ht$0HD$8dH%(HD$HI@L&@HD$(HhD%g$EuHD$(f$HD$(D$L|$@L53$LhI$I$HD$ H9#fDuL1ۅuf;]LH@HHЃ8uH@LLLhID$PHIU@HYD\$@IE@EH5HH)H9 LjLH1ɺRAUI1LSH5bD$AYAZ;]LADHmH;l$  $#T$$ LAAL&1ɺaIH51mIE@HtgHHt_H9tZLjLH1AUI1LUH5D$,_AXgL-#$@L- #$HD$(HH@L%1ɺNH5LHH1ǃE1HD$(H|$0H)HHhH~HH'HD$(H|$0H8HhH~IHHD$(H|$8 H$Dp!HHHD$8DDA>H8HwHH|$8Lı1ɺH5"$L1ɺa1H51&L<#C1H5s_1HT$HdH+%(BHX[]A\A]A^A_Ë#HH@L#1ɺHH5LHH1ǃLHHHM1L#H5!$LJLF#\IH51sLo1ɺTL\1ɺ1H5d $HL #IH51 L1ɺW]HD$8;H8HwHuHH|$8Lȯ1ɺH5 $HOL{"IH531xLt1ɺZH HEHHHoIٹ1Lo"H5K$xHL$(oxo)$oo(o8HHHLMLH>LL`HD$8LHH8,HHtLLHHHD$(H8LLL`HD$8LHH8HHtLLHHH@fAWf1AVAULATL%hULHSHHxdH%(HD$h1Lt$01)D$@AEHt$HLAE AE0HD$(HD$ HD$HD$)D$0)D$PDHLHT$(H+AąHULd$(HzPLHT$HT$HLxM E11L1HAąHH5HAą]HT$H5ȎHAą^Ld$L!HLLwHH5GHAąVHH5HAą}HT$H5HAąVLl$LL`HELH@PHx豼HhLLL%Hsf1LHL1)D$@)D$0H\$H)D$P蕶IHtPLHT$ H}AąCHULd$ HzPLHT$HHT$H'LhML%y:f11LL)D$@)D$0H\$H)D$PHtLH HAąL%f11LL)D$@)D$0H\$H)D$P迵Ht$LHHhAąL%f11LL)D$@)D$0H\$H)D$PhHt$LHHAąL%if11LL)D$@)D$0H\$H)D$PHt$LHHAąL%!f11LL)D$@)D$0H\$H)D$P躴Ht$LHHcAąL%/f11LL)D$@)D$0H\$H)D$PcHt$LHH AąL%f11LL)D$@)D$0H\$H)D$P Ht$LH HAąQ L%Df11LL)D$@)D$0H\$H)D$P赳Ht$LHHAą"@L%i8f11LL)D$@)D$0H\$H)D$P^H\HEL}XLHH`MtIM`HL&AąAIHEL ĭHPHHCHtLHLR:1H5  XZHD$hdH+%(HxD[]A\A]A^A_@HEL THPHHCHtLHL*R7H5 1E1y AYAZHEL HPHHCHtLHLRE;f.L,1ɺ@1H5   f.HJHHSHHtHQML>P=?fDHEL \HPHHCHtLHLjRYfHEL $HPHHCHtLHLRMf.HEL HPHHCHtLHL*RJf.HEL HPHHCHtLHLjRTf.HEL dHPHHCHtLHLR^f.HEL $HDžHPHHCHtLHLRaHEL HPHHCHtLHLRgLHH觼Aą{HEL HPHHCHtLHL RoHEL NHPHHCHtLHLRvHEL HPHHCHtLHLR|OHEL HPHHCHtLHLRHEL HPHHCHtLHLrRH{IHEAPLApHH{L)IHEWpHH{LIHEVpHjLe1ɺ1H5P H YH{HT$EHT$ML rHjP H{LIHEQpHUSHHHPDHEtLtTH[]@ǃHH{EyH1ɿjI1H5DLmdkL^_uǃLH LH{HxHj1UILS1H5XZH[]H-HPHxH1ɺ]UILH51AYAZff.@ATUHSWTHLHPHtaH5H1Aą5LXMt9I$H5HF NI|$tI1H:1LpAD[]A\fH5a H1/AąYL1ɺ1H5뷐~t)L1ɺ1H5jE1vH.H5H1AąLi1ɺ1H5L-HG.L,1ɺ1H5f.H.k@IL>1E1H5AUIH5.ATUHHLH@HPH1HH5LHPH1AąDHEt)AD$w|DH5L1hAąLHrAąAD]A\A]AL11ɺH5D]A\A]H}wuHLGATIE11H5iXDZ]A\A]@1L1ɺH59gD]A\A]fDLT1ɺ#1H5 7!fL,1ɺ1H5f.AUATUSH8dH%(HD$(HHxHHHH5]HHPH1AątqHH5WHH@HPH1Aątr`H@fAHD$(dH+%(H8D[]A\A]L41ɺ1H5DL 1ɺ1H5DL1ɺ1H5E1bH5bH1Aą(L1ɺ 1H5M{fDHH5H1AąHHAąHH5H1PAą%H H5H1-AąH(H5H1 AąH0H5H1AąH8Ht:I(LpAąLH5`H1AąH@HI(L&AąsLH5H1WAąL1ɺ61H5fDL1ɺ(1H5mf.L1ɺ#1H5q=f.L1ɺ&1H5Ao f.L\1ɺ)1H5?L61ɺ*1H5L1ɺ+1H5L1ɺ/1H5kLę1ɺ51H5yEL1ɺ01H5SgUSHHGH@ -HBf4HHGHsTH-H@PHDL$Hxj蛭ZLYI1ɺ?H1DHEtL1ɺC1HLLPMtL1ɺI1HyHXHtHxHtE11Hx1衡HHLU1[O1].fDH@H[]D@HHH9HA1ɺFHIL1ff.AWf1AVAUATL%}ULHSHHHdH%(HD$8HGI1H@PLp)D$Ht$L)$)D$ 2HtLHUTHޮAąL%f11LL)D$)$H\$)D$ Hf11LL)D$)$H\$)D$ 跡Ht7H@ Ht.8ML11-H5$HEL /HPHHCHtLHLRDL%f11LL)D$)$H\$)D$ Hf11LL)D$)$H\$)D$ Ht3H@ Ht*8taML11-H5 ,$HEL `HPHHCHtLHLnRfDLxA?tLLL`LHLLHHPfL11H)D$)$H\$)D$ HH}HP}Hx tNHEL HPHHFHtLHLxR1H5E1XZ#1L.HXHAHD$8dH+%(uHHD[]A\A]A^A_fHEL HPHHCHtLHL" RxH51,Y^Hp>xHL7>AąHEL HPHHCHtLHLf Rf1ɺE1LH5kfHEL $HPHHFHtLHL Rf.HEL HDžPHPHHCHtLHL' R:f.AWf1AVAUATI1UHSHHHXdH%(HD$H1Ll$)D$ Ht$(L)D$)D$0腝Hf11HL)D$ )D$Hl$()D$0UHt7H@ Ht.8ILt 11-H5z$ID$L ̗HPHHEHtLHL2 R7DID$L HPHHEHtLHL RH51E1Y^HD$HdH+%(HXD[]A\A]A^A_HXM|$;EIPHBfH%LpML=B11LL)D$ )D$)D$0Hl$(fH11LL)D$ )D$Hl$()D$0ޛHt;H@ Ht28L 1ɺ-1LH5$ID$L QHPHHEHtLHL RID$L HPHHEHtLHL R{fHUIOHHЕHtHQIL~ P@fDHXIT$;8HzPHHT$赠HT$HwLxMjHEf11HL)D$ )D$Hl$()D$0|HtGI$HHH$E$HAAAuID$Hh`;fDHLAŅLLOAŅLLَAŅID$AHH99L,fID$HUHHHHkHtHQL_ E1P1H5mXZ@L1ɺ1H5Aof.HJHHUHHtHQIL P`fDL$1ɺ1H5LfL1ɺ1H5$DAWf1AVAUATL% ULH1SHHXdH%(HD$H1Ll$)D$ Ht$(L)D$)D$0UHf11LL)D$ )D$H\$()D$0%Ht7H@ Ht.8MLD11-H5Ji#HEL HPHHCHtLHL R7fDHEL dHPHHCHtLHLRH5`1A\E1A]HD$HdH+%(HXD[]A\A]A^A_L`L}A<$AąiL%mf11LL)T$ )T$H\$()T$0襓HtbHE H@PHxZH8HLHT$HjAąH8Ht$AąL%f11LL)D$ )D$H\$()D$0HIn`411LHAąAvL1ɺ1H5MfHSIOHH`HtHQMLPfDLH`H&Aą3HEL HPHHCHtLHL R1H5 7XZL,1ɺ1H5f.IIH9HEHSHHHHdHtHQL]E1PH5h1[]DHEL HPHHCHtLHLRHEL HPHHCHtLHL,RL1ɺ1H5qHEL HPHHCHtLHL`RvHEL THPHHCHtLHLjR@HEL HPHHCHtLHLtR HE H@PHxH@HLHT$HAąH@Ht$AąH{LzQIHEpHHEL ^HPHHCHtLL@ARRNH{蟬LASIHEpHZH{qLVIHEpHH{IAPIHELpHH{ L!WIHEpHRAWAVAUATIUHSH8D-E$dH%(HD$(1EtPMt E$E$W!A$D-E$HD$(dH+%(H8D[]A\A]A^A_@HL$$LL$sE$LD$ H5rXE$(DL$$D$ EAAHGL=ELD#E$u'{ SD$$tH9*f{H8I9DsED#D$u߀{ SD$$u9r uC;D$ wILL1hDT$dDT$D lD$fDHSHRHh L-GHtZL=LuA>"HmHt9}tL1L L^HmHu C$C$HH-L5rщ C$tt#f.H8L9CtuU1ɺLS1L LQX^]C$ SC$뱐D$ T$L1H5-C$R[P1A[[`f.H!HLu C B$H8I9ufC;D$ LK HLLL$ LL$HHCLPLq1hfD sAYEAZD 5hB$HL1LSL J1v_AXLL 1ɺVH5R@L- #Hօtf.1ff.fAWAVAUATUSH(H$`HD$dH%(H$IHtIIPMB uQ1LSH5-1H$dH+%( H([]A\A]A^A_fIPH1IH-LLJHpHW1HI$A$`A^YHHHD$H9ӺHD@fIMEu#ALBH{HHD$AHtl=D V#EHt$|L@I|$D$|HHL$TLfHI1I$1LHp4E HD$HI$M$ @f|I$0I$I$(MHH9 IT$fH L)$H$)$)$)$HDŽ$HDŽ$HRP)$)$ooI$8)$H)$HDo)$oZI$@)$H)$HD)$o")$ojH)$HHD$(HH$HLHHD$@H1ɺHLC|;1 @MuI$0TI|$RLHI11I|$T$RHHT$ I1LRfAZA[;DL{1ɺx1H{1I@I|$Ht$HL$HT$RHT$L>I1RHt$ VHAWHL$(Q H 1DI|$T$QHLrT$IR1H_1AX@H1LB HD$(HH1LHpA HD$@HeE$`EmIXHPHD$8H|$ HHHH|HHT$`HD$8H@HHKH#H\$PILd$HIHLl$XHLHDHD$0HL$hIM'ILd$0Lf.I4$IHHuMMuLd$HDI$ENTM$0M$(HD$0M$ HL$ HHHEHD$ H|$HD$HHHKLL$L|1:H5 F#Lx1ɺIAHtOHLSI{fDLl$XHt$81H\$PLd$HLHD$8HAL|$0LhH\$0Ld$HLt$ Lt$hMI]MLMu;I4$IH'HuMmDI$ENTHD$8M$0M$(HD$0HM$ HD$ H|$ H5DL$HDL$HHHED$HD$A?A HFh L5H5y1#ZYdf.1ɺHL-w%1fDLL$LT1)H5N#H@j@LrhH$hH|$1DL$HĮDL$HHH HD$H8HD$@8Ld$@DL$HL+DL$HHH8HMP1LH5a#PL=H|$ LbL|$`A1ɺHLu11ɺHLu1HwH8H|$DL$@ܒDL$@CLu1ɺUH5#Ld$HLt$ H\$0I$A$`ENTM$0HD$0M$(M$ HPHD$ 1ɺHLu1IE H1ɺSLaHp1SL$HD$XH HHH6L9bH fL9HH@HuI3Lt1ɺL1H5#vHD$H8HD$(8tQLd$(DL$@LDL$@HH0Hu6ML1YH5$^#HwH0H|$DL$@DL$@u2Ls1ɺ^H5#IEHBHD$H8HD$8twHt$DL$@3DL$@HHCHHu_LL$(b1LH5p#_MmHD$8LhL/s1ɺ HwHsHH|$DL$4DL$*HD$0H|$8LL HHD$L(HChHD$ DhHCxǃlHD$Ht$81DL$HH8 DL$HHL`MtWL5(EIElID$ Md$Mt+Ml$ I<$Mt>AEu6L&tEAD9lsDlIL61zH52#Lq1ɺgH5 #Lq1ɺuH5#HWHD$ 3fAWAVAUIATUSHjHBLx ME1HH-AMMtLA?u]MwHLNHL;tH5”L(uTMAMuHD[]A\A]A^A_DML11H5kH5_Lu AH@H5HLuA(@E1qH)1MAVL1ɿH5XZME1LH5 fH8HtfHFHt;tHvHu@HfHHtHVfDHfDAUATIUH SHH8Ht`H1 fHHPHt :HPHHuDHHAHt 8HAHHuI$ H9tHCHt HxHH9uI$0I$(I$ I$8HHzHRHE1 fHHqHt >+HqIHu1HHJHt 9HJHHuH H L+HH9DHS HtHzN~I$0H HSHHC HHQH HrHH3HSHH*HH IMLLI9tsIA$qH90dI$0f.HJH[HNI$8HBH H L+HH9ufDI$8H1HHPHt:t?HPHHuHd1[L]A\H5A]DHPH+HQI$8HxH@|I$8uH[]A\A]HPHHVI$8HxH@|QHQMtIPLM$8HAI$8HAHDHHAHtHBI$ I$8HAH9u,@HH9t H9HuH0HPHVH2HH9u@Hy{f.HH HI$8GH $H5nH=ogAWAVAUATIUHպ@SHHH|$L$HLD$LL $dH%(H$1ɡ!HiIHHIEHHIEHIEIEIE IE(IE IE0IE8IE0H$IE@H=#LHPAƅLL1AƅI}HLL'j11YH5m DHsPHL|$@]Ao$LAoL$D$`)D$@)L$PL|$ FLDhDH=8#DL#HHGLxM:MoHHL{3MWH$IIG@L{PIGLHCIGHHChI_HtHHt H9L A#AT1LU@H5lAXZH$dH+%( HD[]A\A]A^A_fDL-IlLh1ɺ<LfLJfI}HLLkh11SH5kNWfAUL-kM1ULbeL1A[1A_H8SIHHPTH@\I3$I3D$H uIWdIGlI3T$I3D$H XHChHHHzH9qLJULLAVh1E1AYLygAZ1ɺiL1^gfL-jHLI1AV@sL _AXIHHJIGHHJIG MWHIG(IG IG0MWMWIG8IG0H?#LT$0HD$0HP։T$(T$(H|$H LT$0HH[LXML\$(IL:1IL@LT$AL\$(LT$ISTIC\MCTI3D$I3$H uIPI@I3T$I3D$H RHt$H|$LT$(L\$0LD$8贯L\$0H|$D$IL\$蕯T$L\$LT$(tF AƇAƃH#HH #IIOL=#LxH=#H#AIEH#IEL(L-#5HLT$H|$LHP LT$AbILL1IH4L,HILAPL1AsHE1AT~IHH Lr@Ht$ H|$8@LT$'LT$L\$=LT$I1ɺAƇL1AƃLMt$ AVm#YL`^1ɺL1LT$9*"HLT$#H=#HPH H=#LHPLT$AIL"L1AJ@L Q#IL CH5f1E1 1ɺLLbL\$LT$L'IHLL I{LL1E1wILPvff.AUATUSHHt>Hu=LV1ɺD1H5L% HL[]A\A]HHmH;LhLrIHBL1HH]HH0HHH^t LE1%@ALOAH Ht=H0LLBNuԀ.tπ_tʍqՁt HIufAA<$tU H5 L1ɺUE1L[H5fMAIL11PH5E1@LA1ɺI1H5Wo]f.AWAVAUATUSH8H<$Ht$dH%(HD$(1HD$ HK>BH|$H5qiHHPE1Ll$H\$ H LH]HL|$ E7EtH@EwIEtIDA uA#tMtA<$u4ALuBHt<#uH<$LIiLL$L-11xH53H|$ Hu"HD$(dH+%(u[H8L[]A\A]A^A_L^1ɺ1H5L^1ɺe1H5E1E181ɿH5nRLhPLL$1vY^Rff.@AW1ҾlAVAUATUSHHXdH%(HD$H1d9H=FH\1ҾpH-Hi##ST1ҾjH߉#1ҾqH߉P'#z1ҾH߉#es1H߉#ГHHHt1ҹH=#H11ҾHD #\EuK1ҾoH߉-#އ1ҾmHA,HHD$HD$HDc#EEH=D$Ai#HD$EIHt:H01HH!ILDNuHD$HD$EH57HBTHDHH#H#1ҾtHvH߉ $HLx 1L%ʿMtwL-fDMMt\A?"MwLL H5LܼtH5m`Lɼ MMuDL1A1LdLJLwHHg $xHHg $nH߉ $ HHh E1Ht\L5Qg0ML1Lm1HmHt#}uH}@HmA HuD1H\$ D-7 $H|$HHD$11ILLD$8;HH9#H= $Ht6H $H= $ $Ht&`H $H $H $ $HD$HdH+%(HX[]A\A]A^A_fL)1ɺ<1L胿fDH5L詺uEDHut1ML1L1XZrf.H5^LQtMH5L> fDDU#EB#fF#O@&fD1ҾkHQ@HH9#=H H#HH#H5GLq~H5PLZ@̀4f fD;U#@L1ɺE1H5跽fH=誸#HD$H|$HHD$$HL5#M1t$ DL$$LHHy^^_JH=AL H52IH1H#H5LϷt/ML11+H5&ƼHS#H@#P@ML11H5԰t L b1LE1LagJL1ɺH5&H5iLRtH5iL?u[L1ɺ"1H5$ĻH=1f#衽IHEH5 LѶu MLP1LY1b6L% LL3Y8蒺}IHtIH*QH HDAP4L{QH5>P1غH 躽f.AW1ҾAVAUATUHSHψH1ɺHH_HH1ҾH7HL-L5< 1҈~H 1҈~H 1҈~1ҾHl1ҾHHGLHIIDŽu-D蓷HDX@II%%uAw@EtU@O+IaLH@8tHuL-1ɺ1LSLyfAwcILDIٹL4H5øH1[]A\A]A^A_fL1!L-v1L艸ML1L=)f1HDžGH[]A\A]A^A_f.LGH[]A\A]A^A_DAwdIHfDU1ҾHSH|uHH[]uD1ҾH|HuVtH-LS1H胷H11LxQfH1[]DHktHZtNAWE1 H "AVAUIATIUSHdH%(H$1Hl$@H1MMHMLt$fDMM+If1HL1)D$ )D$HD$()D$0q[HHtHhHA$PL=jHmHH} uH]1;@HHHD$ $H]HD$Ls MtvL+LLuMAuAI$I~øtGMvMuD$fDH5tL虸 H[HtD$Ht$Lz$L\O1ɺH5$A_D$fDMi1H-LHLN1ɺ1HH$dH+%($H[]A\A]A^A_ú"LL4iuCHkH'$맹tH-OLIHb_I$Ly$tAADŽ$PIٹ1LH5$%LN1ɺH5ɱ̶ff.AUL:KATUHSHH>uHLmHEL-#1IHhHLTH}^IHLID$HHH H >I$H(ID$H(L L(;H8AHD[]A\A]1E1LH5豲HD[]A\A]1LL1ɺH5gE1|HD[]A\A]fDH0AątQHA[D]A\A]D1LH5HD[]A\A]fDLL1ɺ1H5ϯ蝯ff.fATUHHhu)1H8HtYAHD]A\1H5kkAąu1LuK1ɺH5BZHD]A\1E1L?H5 !ff.@AUL@ATUSHH@I9t_Hf.HL9tHHs1HAąu1LJ1ɺH5袰HD[]A\A]@HA[D]A\A]ff.AT1ҾUHS~HH0IHta1LH߳IMt []A\DƃL1H5խ[1]A\fDH}8ZHHHxHHHǀ0H1H)8HHH0HHH H(H !f1LZI1ɺH5'?1HDž0L>ff.@AUATUHSHH>ty1IHtjH L I9u BHL9t:HSLHeu1ɺE1LHH5a~HL[]A\A]ILq1H5/GDAULoxATUSHLgxM9t]H/H{HTt3I|$0Ht H>tM$$M9t)I\$(HH!uHL[]A\A]HE1[L]A\A]AVAULoxATUSH_xI9tgHL5qg HL9tPHS8IM1HH)Aąu1L\G1ɺyH5)A[D]A\A]A^DA[]DA\A]A^ff.AWfIAVAUATUHSHdH%(HD$x1H6 H|$ H\$HHD$HH@ HD$PHHD$XHH HD$`HHD$hH HD$pD$(BIH@8IHH(HPIHIHCHt>LHuE1HD$xdH+%(HĈD[]A\A]A^A_LL%I$L|$MHHD$L5H"$D,$HHD$O@AG 1LMLAD$1H|$ LpBIL9}HIHHX Lx(IGHHIT$H$ pEgH|$UHTH$H T$ID$0IT$<@H|$L|$H"L%Hl$ .HOIHHCI](LIE C IEIP AIE0t HtIMLHnMM(1L1ɺ7LH.H"H9`Hv#襭HHmHhHC@@HHHC(Hi"HC `nLK(L%11L!L蠩H1HHVH3HC HHHC(HU"HC mLK(L1L/13H/$躬IHH蟬IHHCLHIE(H IEH"IE TmH@LID$(HID$H"ID$ X ID$0Ht IL$LHlgHAt$(MM(1ɺ~LۭH514H#軫HXZH.H(HHHC(HHCHW"HC nlLK(L)11H5ť豧HBHHHeHHHC(H HCH"HC kLK(L11[H5B:AL$A1L$ H|$pD$$L@11 H5ӦD$L2L@11mH5,衦L@1ɺ1H5h耦E1G$Lq@1L.1XD$LK@1L$51D$$L!@11H5D$L?1ɺ|H5bܥ6$L?11ZH5賥D$yH 3$H5ACH=RC諠ML1L1hNb1LH5ª<L褢L@L1%E1Q1LH5E1z1LAH5̢轤E1IL[L!1蔤E1[1LVH57jE11fAUATUHSHdH%(H$1H Ll$AAL虡H}HXHNH`HT$AHxLHHILHLHH) H)HHL$L/H}HXHONHn%t$HA_tT$AuATfTcfKE18聢HL PHL}PHH5P1ѢH H$dH+%(HĘD[]A\A]DL1HDžH5YqH$HxLHHILHLHH) H)HL1HDžH5'@T$AۉATTf.$ۉATTJATfT8萤AUATUhH1Ҿ{Kf1Ҿ~Hpw1Ҿ}HAw1Ҿ|HAroL>;1ɺHHDpDDHӎAą1ҾyHez1HtoHHtH誏AąAD]A\A]L1ɺ1L%}ZH5p舠LH1[LHE1A11#D]A\A]f.1L1ɺH5/D]A\A]fDL:1ɺ 1E1H5ߝD]A\A]Lť1ɺ1H5ϟf.#SHuNH=蒡HH߾HHD1H#Nd[#f.H5#=#~q#fAVAUATUHSH(HtHx茜H(fH@H0HtHxaH0fH@=H#tH芴1H耬H=#tH.)wHLHI9t HGHCHHG PhHHI9uH}xLexHI9t HGHCHHGPpHHI9uHHtHPHDžHHtyHDžH@H@HH9tHRHPHHHH9uH81Hu+f.HHPHt :CHPHHuH@Ht螘HG115u {8 tF11~4t,H=ݖ#H5HDžGfD1ϝu 8 t1话~@HG'H/H}HtFH}HtFHGHtFHD #ED#Ej= #,n#Pe#H=#HtDH## y#H=#`##Ht&HH#H#H#}#[]A\A]A^@D Q#Et#L(@ H5Oѥ#lH=5#Ht蛠H=t#H#Ht诘L5(#H-ѥ#HF#LΠH9mL%*L1^LL#H#L-H9t:fHIs LMe1 #HY^H9uLL1Li֤#ܤ#z#(DHPHHQH8HxH@oDf. fD[ fDfDLY1 H53̙mH5#=#k#5HIL HT#H5m+Hu&HDžG1H#H8ȝCH;軝sfDAW1ҾAVAUATUHSHdH%(H$1]E1HD%#XHHX L-Hu6u@IL1L%1蘘H[HD;:HkEtrHHt0|/)HuHH=H9HF t5IL11H5E1Hk#Ht$H誕ADžD$(%=@#HSH=#HPH$HHT$gBIHHT$1H\H$I~HHH=(#H#H[IH#IFH #L0L5#HA@HfK8脖H1PI1L@LXZPL_1+H5輖LK1LH5w蔖H$dH+%(HĸD[]A\A]A^A_Ax _]1E1LH5 !LE1{H5ۓZH w$H53H=3躘f.AW1LRhAV1AUATL%{ULHSH臕 #1+#=؟#tH1HH=x#tH辟mHLHI9t HGHCHHG PhHHI9uH}xH]xL/H9t!HGIEL(HGPpLMmH9uMEHHt$HDžH@H@HH9tHRHPHHHH9uH81E1Hu (LHPHt :LhHMuH0HHtHvLMtMHHt$苾HDžPHDžXHDžG Ht$AH8HD$Mt IEL8Ht)H^RHHHVMt,LH-RHHHVHHt$H AƅhtH5MHDAƅHAƅ8Ht$HH8HMt IEL8HAƅ`H>Aƅ&HRHh"HwHHH_UH/`HHHHHHHUXHH}xHHHPHHHP(HHEpHHEhAƅfHAƅuHAƅHAƅHGHGH9utHAƅ #tGHHtHPHDžHMpAƅpH#u:#H=##Ht&WH#H#H##AHPH#HQH8IH@IL|*1ɺx1LcfD# fDL1 H5=*$L*1ɺ1LHD[]A\A]A^A_fL)1ɺL1E1L)1ɺ1L衏L)1ɺHLt)1ɺ1L[[LR)1ɺ1L99L0)1ɺ1L1ɺqLL(L(1ɺL(1ɺ1LǎL(1LE1褎L(1LE1聎Lx(1ɺLe(1ɺ1LLLLC(1ɺ1L**L!(1ɺ1LE1HAH9uLM1ɺ1L׍HGHGLL'1ɺ1L觍11L'XL腍=#u#Lr'1ɺ1LYYLK'1ɺ1L22f.fDH-@HM@Hm@H@fDfDfDAHH1EDɾ AA f H.A-AAt H@1L*H5,1HDAWAVIAUATUSHHH9tGHIA @HH9t0H{LAąuCD9u5IAf.IAHD[]A\A]A^A_ÐHKLmMH@H HQLP1H5_XZff.ATHUHSH躈H;L`L5Ht&LHH訑HC[]A\f.HC1LbH5IԊ1ATL%37$1UHhHLSL:H,+L H}HXH*5HtsuK[]A\fDH6$HxLHHILHLHH) H)։H[]A\@6$tATfT1Lh H5Iԉ[1]A\D26$ۉATTMATL%$1UL\NHHSHhLH*LH}HXH4HtsuO[]A\f.H$HxLHHILHLHH) H)H[]A\Y$tATfTH IٹHMLPH51蝈X1ZU@$ۉATT9ATL%#1ULHH׀SHhLHw)L覅H}HXH2HtsuO[]A\f.HY#HxLHHILHLHH) H)H[]A\#tATfTH IٹHLyPH51]X1ZU@#ۉATT9ATL%#1ULHHSHhLH7(LfH}HXH1HtsuO[]A\f.H#HxLHHILHLHH) H)H[]A\#tATfTH IٹH*LiPH51X1ZU@z#ۉATT9II1HIxLIIǀHH)HHcI HЃ tCt?A@tAHH=tA uDADE1f.ATSHHH=j#/IHt}HPHxHǀ1HHH)HID$ Md$AD$@ID$PID$XM$$ID$(ID$ IT$IT$I\$8HL[A\DL1fH5茄f.AUATLg USHHo H]I9t4IfDH}1AHUHEHHHBH蕁HL9uH[]A\A]ff.fW0HGw8LO LG уO0HO(h@IHLt'HxXHPXtNHW HP`HW(HP`L LH`@HxxW0HPxt!HW HHW(HL LP0SHy8uQA0uKq4HQ HA(HBHHAHQ HxHHpHtxHq HpPHq(HHPHHPP[D H]qL11H5jXCZ[D HdqL1qHq4uaHAA0uGHq HQ(HVH2HxHHQ HpHtsHq HpPHq(HHPHHPPHh<f.HqD 1L0H5XZHH蓀=@tlA'AtA uHfDAt1L1ɺH5 葁HHfDHdH%(HD$1HHT$/tD$HT$dH+%(u3HfD1L"1ɺ H5|ff.HHH5dH%(HD$1HHT${AAtHT$dH+%(u*Hf.1|$wظu1<$`AVIAUATIHUHSH}K<4HIH"|J<3LHA|uE1Et[D]A\A]A^Eu AuE[]A A\A]AAA^ADÐUHH(HGH9Gu"5}H} 茄u>H]}1ɿ1_L H5H} Nt襁8~H-1P1L LH5AXHZ]|fDAWAVAUATUSH8dH%(HD$(1LT$pDO0OI)MIHI ALcI MăuH&#HtD9-#<@HE(HH9HSH HQH HxHPLSHHPfHSHPHHXHCCH#C(C8CHBLs0S,1ELK@fS(HD$ Lc8Ld$ H} LO|tA,HD$(dH+%(OH8D[]A\A]A^A_fDLѰ1ɺ1H5D}E1f.LW1ɺH5}E1@L9KH9Hc #L)1H5HHHt#HH)LM9H5H>LT$11ɺSLATLL$ Ht$}I9XZHt$LL$LT$I#HE(HSH HQH HH#HE1HCHZHSH51APL/|YE1^oLT$H5Q1P1SAPL-LL$0Ht$(F|H Ht$LL$LT$Hco#HLP1jSSAT{H0E1LT$H1ɺAS1L\$ SAPLLL$({H Ld$LL$LT$~_yZzf.AVE1@AUIATIUSHdH%(H$1ILHI|$ L<}Hl$HLt(Uƅx H=wVAID$(HSHsHKHQH HHH HSHCHrH0I9tH]HEH{H;C u1ADH$dH+%(unH[]A\A]A^|8yH-1PL &1LH5GzX1ZH z3H5H=Bu }ff.fAWAAVIAUATMUSLH(H|$uHD$H.H #IcLH L,<1H4$ ~HH9$L)H E1Hu$pHIL9H#IK4cA9}{L$HT$HLt_$<#LhH'LEH $I<$MH1_ID$@ tD|$ HbA9|H\$T$HE|AIAAA@A~ID$xtC@@:RfL1ɺ1H5$df.IcV(HHtH $I<$1H<_ID$H $I<$IHٚ1^_DH $I<$IHi1^*DH $I<$IH1^DH $I<$IH1z^DH $I<$IHa1R^DIG8HifDLaL%HID$xƄ$L=@LL1ɺ1H5/cfDAWAVIAUATIUSHHLjHco(dH%(H$1D$ AE  AEL=:"HT$AT/HDAT@tIEHtJIcT$(t?H5y$LcHH;MHLHL P1\ZYfAH$dH+%(_HD[]A\A]A^A_fDL=!:"HDM$AD$uLt$0A$ALᾀLHKDiA@t!A|$Ht$'*HKDiH $E1Ƅ$AtDHDIl8Ht5H^~)HT$ H$HTH $D$DifHD$'H #Hj#A@EjL ELVMDLQH;LP1RHAVu[H AfDIE(AEL=8"HDMEHLD$ADL$HD$AT@tXIEHt IcT$(uDAEHDAD$H{LAfDH;LH1ZLk띐H5!LaDL$LD$$L=/aLp7fDL=7"%@L$H5!LDH]HH[fD$La1ɺFH51D_D $LLD$DL$HD$\H{HI6HL$DL$LD$HcH{LLD$HDL$HL$:7HL$DL$LD$IH5=DL$LLD$cH{IUIt6DL$t|HCLkLD$HPHH0L2LH APH@0@8AE AEf$L)1ɺDf.HCD $1ɺeLH@0@8fD1ɺ`D $LH5-]D $`ff.@AWAVAUATUHSHHH $dH%(HD$81B@LB t1AIMwL_HD$HHD$8#HD$0Ll$E1HD$HD$(IEA}HD$ &IEHD$I*fDx#LM~RZLLH$^#L'^IHuH} QIHf@$AGHD$HtLxMMDYIUHI}BnFh^Ht$(H|$IcAMZAGHD$08AML|$MfDH} zIH.f@$AD$HD$8dH+%(+HHL[]A\A]A^A_SuSH|$XH}LhL HH%Ht$LaHD$0IG6DqH5t$ LK51s E1L{ZH|$(TXXZ8D]Ht$(H|$ I&`AuIGuHD$08u1fLK1LYH5ݩhZH5ǩ11ɺLOH4$>ZHD$H4$HD$ H|$E1HD$0WLK1L#H5ZY@H|$KW1H5:1ɺ1LH4$YH4$LKL1E1H5uYH|$VQ\E1LH5>YfAVAUATIUHSGHR t t @uHHA$"AA\D$ Tɭ/}HcUH50"u []A\A]A^LHHcTtLt[]A\A]A^fMA$2i5u+1[]A\A]A^u9b1fD1LH5YW1ADHAI9D$1DHAtHzIt$HZ1`HsH;1HIIHAEA9$u.LHLH%uMmMd$Mt MufDHCM LHxMl1tZH;1U 4f}t%HE f5H;1)fftH;1U HHcE E 1L1ɺH5V1S@AWIAVIAUMATUHSHHIpHIH1AEAEAD$(EtvIE(HtmIL$ AEA} HAtQID$HH{I\$MtMgHL[]A\A]A^A_fDAEu H ШHcH>fD}xуH}LLID$ID$ HqMd$wI~ HIf@UID$ T$ H}IL$ T$ L H5S1E1TIL$ IE AEBHH5HDHAIL$ AEAE AIL$ AufIcE HA fEHIL$ AEtdT$ H}1AU IL$ T$ HjID$ LcID$ LIcE T$ 1H}AU IL$ AuT$ H?DT$ H}1AU IL$ T$ @T$ H}1IL$ T$ fDL11H54S_ff.@AWH MAVIH AUATIUHSHHHH9HLLl$PHDLD$1MEH $H $LT$#ME1HqLLL PLDxDlLDLHEH@MHHLxMIcLME AU(MIxEWLEAu.fH[H!uEWEAAGuEML GH5<11E1Q0DMML1E1*H5ՠeQHD[]A\A]A^A_EWAD$UAGJf#EPIcALEgA  HDmH HrQH$IIQAH%HP1AH-+$H DH'AUMLS1ɺH51E1wPAYAZ fDEWAEA AGLHC8?EML?jH5<11E1PDEWEAD$DmHH H\QPAAQIIH$Hu$1HH- $t$ H HAUMSLu1ɃH5Ϟ1ZO_AXfI} EM2L<1ɃH51E1OAE(DDmD$HLAPMH dAAPAAPE1LLH~kfI}  f#ERL fDLo1I9L#DKLDxDHDLHEH@IHHt LxMEM=L<1Ƀ@I} L CHLEEH-LH<H11AVMXL~Z1ɺTH1E1aM@HH 11DeQH.$IɾQLHAQH!H-$AOt$ H HASfDI} HcL LDEL)<H1AVH-1HLYQ^L1fDDmD$HHH QPAQAfDLcL$LL$@EM^L<H1ɃATf I} HkL LDELi<H1ɃAVf#EL %EL › Lz<H1ɃAVAWE1AVIAUIATL%#"USHcHdH%(H$1HII,LUHg}t'M1LsH5_JHIE1P@utI1LP AuLLt3H$dH+%(u3HĘD[]A\A]A^A_D` fDLLұAXMAVfAUATAUHSHH0dH%(HD$(1Hܾ)D$HD$HF HD$HD$ H<$H7Dh@1HL$IH-H$EHHD$L5HIL1P1LIXZH<$Ht Ht$HC HtDhHD$(dH+%(H0[]A\A]A^HHHED$L5HIL̙1PyfDL5eLLHH$H{EtHoE1KL5fAWAVAUATUSHxH|$Ht$ HT$(dH%(HD$hHHD$HH$HH $Ld$0HHL$HIHH $L=HL)KnLt$Ld$0f11LLIF)D$@)D$0HD$H)D$PHH|$Lx H@Mf.A?vMwA<@u AFIYHD$L@L9uCMmL93IuLgJuHD$HHD$f1L1)D$@)D$0HD$H)D$PHHHD$LxMteMMI} tIUHEf1L1)D$@)D$0HD$H)D$PIHyIU IV MuH<$HHD$ H\$(H@HSHt!HtHZH9XHPHD$hdH+%(THx[]A\A]A^A_MMsH<${I}H5ILEH5GLLD$HLD$uI}H58HLD$tIH5LHI}H5lH|$HtH|$H5> HIU HfDHH@HuIF HAHEHH@IEHELhfDHD$ HHH@HL$HAHD$ HHHBHD$L`M0H-Q!f.Md$HD$L`MI<$HGtMl$MI}HGu{IEID$IDLmIEJIHD$H|$ HH@8HZH9XoJHf.M[FAWIcE1AVIAUE1ATIU1SH "H($HHHT$HD$1HL$;ILLLLHLEHHHH(CA9$uAT$tCutCuAD$wPHAD$f9CwtsVf9rMtS{YELLLLTuAD$f9CFtsVf91MuLD$HL$LLHT$D\$!D\$HI}L 1yH5lBH(L[]A\A]A^A_f.H KAt$f9stSf9} ]fIL$Htj)GC=AD$f9C@AD$f9C Sfrf9dL~1-H5͐XA 2DAVAUATUSHdH%(HD$1H>HH/HAhBIHu`H0IDHLH豴L$$MEl$HD$dH+%(HL[]A\A]A^IL6~1E1H5֏f@@1E1LH59@}@H0LDHH `H$HH;(IHfH@ H@DhG=H;LhLhHHtLHH2FHH0IL$HHI$HIT$HL"LBA9DH@HH RHHL ʺ PL|1H5y ?XZKfLˏ1 H5Q> L1ɺ H5!>L1ɺ H5>sAI6<fDAUATUSHHD%y#EH~ tAHD[]A\A]@H0LFH1L-#HLEsL蒨HC HHtsHAąH0H HSH HQH H H(H3AHSH(HH(:@LN1L{E1+ H5M=HD[]A\A]L{15 H5=CHsLH5VH@H+L кF 1<HC ZYHt HxHC he:DATUHSH~ HCL|t%H5ɋ1E1O<D[]A\H8HPtntiHS HH8AHJ[D]A\AąiL1ɺ1H5D;{f.HHHQ:tcHS HPfH8HPt&eLz HHHQ:ufLazf.AWAVAUL-O"ATIUHSHcHdH%(H$1HMtH~zuH0D$HuLHD$HL|$E1LMTLALT$LT$Azt'M1LvH5щ\:HIDE1P@utZLHP AAvLH&|$u7H$dH+%(HĨD[]A\A]A^A_Dh fH8At$Ht1HPHHtHHPHt;2uHPHtKHQH8H@tH8DL֠APfDD$fDH>#L_uw1E1H54D[]A\1E1LruH5V3H{D[]A\L!u1}H5!3H{6fDH{L11H56=#*AWAVAUIATIUH-v "SHcHdH%(H$1HL|H&zuH0E1HuLLQAHH\$0LE1THM8MHfDMMt.If11HH)D$)$HD$)D$ ^HtEu,H$dH+%(H[]A\A]A^A_I8A|$Ht1HJHHtHHJHt;9uHJHt*HNI8HBfDE11mH4AWAVAUL- "ATIUHSHcHdH%(H$1HMtHzuH0D$HuLHD$HL|$E1LMTLALT$LT$Az t'M1LrH5q0HITE1B@u Lj uOAvLHϳtK|$ujH$dH+%(HĨL[]A\A]A^A_LHAIfH8E1LLH54|$ItH8At$Ht1DHPHHlHHPHt;2uHPHt/HQH8H@;D$fDH2ff.Hff.@AWAVAUL-"ATIUHSHcHdH%(H$1HMtHzuH0D$HuLHD$HL|$E1LMTLALT$_LT$Az t'M51LpH5Q~.HE\AE1A@uHMT fAu^AvLHLT$虱LT$|$H$dH+%(HĨL[]A\A]A^A_DLHAIfM71LpD\$H5}.D\$Bf.H8At$Hj1HPHHOHHPHt;2uHPHtWHQH8H@H8LALH5IID$.fDHF0fDATHI#UHSHt@L#HPL$HHHu4HHIH[L$HH}HL$HHH HtHJHhLlH)HL%#IپPH}L1ZLnY L)H}HXHHt(t#[]A\L%q#1HhL LyLH|yLm 1H5{+[1]A\H #HxLHHILHLHH) H)H[]A\L=L#ۉATT(ATfTfDAT1Ҿ$UHSHt|1Ҿ$HEIHteL%V#1H YH{L L9(H}HXHYHts'uZ[]A\DLeH#HxLHHILHLHH) H)։H[]A\@#tATfT1L:l H5iy)[1]A\DR#ۉATT>AWLcAVAUATL%"UHSHHdH%(H$1KM,HzuH0D$HuHHD$KLt$@E1LMľLALT$聿LT$Azt'MN1LgkH5sx(KIE1P@ut]HHP AAuLHɫ|$u:H$dH+%(CHD[]A\A]A^A_fDD` fH8uHt1DHPHHtHHPHt;2uHPHHQH8H@mL8IcHD$Mt\Ll$DMMtGIf11LL)D$ )D$HD$()D$0HtH@ Htu D`HL1Mt$L/j1H5*1#XZ@D$fDH%K*ff.AWLcAVAUATL%j!UHSHHdH%(H$1KM,HzuH0D$HuHH@D$KLt$@E1LMľLALT$LT$Azt'Me1LhH5u~&KIE1P@ut]HHP LcAuLHI|$u:H$dH+%(CHL[]A\A]A^A_fDLc` fH8uHt1DHPHHtHHPHt;2uHPHHQH8H@mL8MtdLl$DMMtOIf11LL)D$ )D$HD$()D$05HtH@ HtuLc`HL1MATLg1ɿH5A(e/#XZfDD$fDH%'ff.ATHILcMtUI@BvD#MLdgH5tPH߀#1h@B 1Ƀj$XZLA\fA@BLA\@USHHtAHHHt\H;HhtuHSHHPHSHHCH[]1L1ɺ&H5u#H1[]fDL̽1ɺ)H5t#1h!AUATUSHHtmHIHIH9u:f.HH9t(HsL\&uH[]A\A]HLHL[]A\A]1L1ɺAH5:t"H1[]A\A]fAWAVAUATUHSHH6L"HT$HvL9tjI@Mt$L3 LHXHTIHt|HLH)H]H9u CHH9t8HsLl%uM$$L;d$uH[]A\A]A^A_fLHLuH-Xs)DH-Js1ɺA1L H!H1L1ɺs!H1[]A\A]A^A_ff.AWAVAUATIHUHSH(Ht$L$LH7IH4IFIHD$8IXL)LHpIHLLH'LLB(HD$L|$uBA?tTHL H HL$HuLl$LcLHD$vfDIHHLtA?uH(L[]A\A]A^A_Lc1H5q| LLE1@Ld1ɺH5qI H-qq1 HLqq H1L/c Fff.UHHGU0HOH8t]LM LE(uI<$MHDuHT$dH+%(uH[]A\A]A^fDt@AUHMATU1SHHdH %(HL$HOHt)H8I-AĄt H$@LHXH H<$HD$dH+%(uHD[]A\A]AWAVAUAATE1UHSHH(dH%(HD$HGHtD H}L7I H9tHAL|$HD$4HD$LDHx< H|$BH;\$tCH}HMHD@uHT$dH+%(uH([]A\A]A^A_D ff.AUATLghUHoXSHHLH@H{hI9t2HGHHBHGuGuH H{hI9uLL;t#L-fDHC LHPL;uH9kXH[]A\A]AVAUATL%JUSHHH@HdH%(HD$81Lt$Ll$,t$,HLLHD$N!H;tDHC LHPH9uLLD$HHLHD$!D$u!HT$8dH+%(uJH@[]A\A]A^@HHL$0LD$ LD$ HsHtD$ )D$:f.AWHAVAH1AUIATUSHHH?H/H HHII1HHHHt2ILDLI)I9LGLD$AULD$tXM|$L)tfH1DLHN$8HLLAUt+Ht>IEHIL[D]LA\1A]A^A_@H1[]A\A]A^A_H[]A\A]A^A_@HDHL$0HL$1fDAVAAUIATIUSHH5d#\HWHDHH HHQ Hu,EE1Hu6[D]A\A]A^HHÀ; HAbt8 M1ɺPH:LP1H5E XDZ[]A\A]A^EdRE18 1M麄PHh^H5OPL1 Y^$@H?M1LJQH5 E1E8 M1ɺ~PH^L(P DAWAVAUATUSHH $HH $H81ҾdH%(H$(!1HAAA9t-H1ɺPL- L?]1L AXAY1ҾHLhH+]HL1ڬLAPLHG#H5ۈ1ҾH#LVM-#{1ҾHH`eIHtmL5!HLH5mL RLO1ɺ w-g#LL ufDg#1ҾHLh"HHL1ǫL.Ovh"Ƅ$ L-0LO1ɺ1L5 $ 0#1ҾH1h2-1ҾHH 1҈H5iHIL5LLx1ҾH HHt!L5hHLH=Z7 H1ҾH1ҾH|81H1ҾH1ҾH#2#RLZ1H5 1ҾH_H 1҈H5GZH8HIM 5HELH3 tH5~EL hHHtQL` MtHHfDA<$u ID$8u ,H1LPMd$Mu1ҾHv7H 1҈-H=!L 1ҾHL #'H 1҈H ЈHLAą1ҾH.1Ҿ%HHDžH1ҾHD L5HHEtH5XH LHo H5! HH5fXHH5XXHjH5DXHSDH5:XH<-H5H%< H1HHc?L-Ht 8ILO1Lc1f1ҾHf)D$)D$ )D$0)D$@)D$P)D$`)D$p)$H;HLh ME11L=JWL50fA}u3I}LH|$H|$LDDDMmMutpH`H"L$ HNLHHD1ƥxRLt$1ɺLLKt |$THHtEtHt 1ҾHAK#1LYJH51E1H$(!dH+%(=H8!D[]A\A]A^A_fDfDH$ H"1UDLJ1H5LL-1ɺ1LILLI11L11L 'JLTL1Dž|DH5YHVL-I11LIL*DLt1ɺ=1H5?WpfHL-#I1hL21LJ YA^H$LL8@L G1ɺL-1LHSH #D1ҾHL5HHfH$ Lx$8%=@L-M11LFLƅh"Ƅ$ f.HT>H8DLEUL-I11LIUL6H$LPuk$%=`mL81ɺ"1L-LLgHLZL#H1ɺ$L1=H8L81ɺ1L-LGL18j1ɺLILQ1LG1ɺ{1ҾHL$ HQHLL-u1РLH9h"Ƅ$ H#L1HPH{LESH5~HsIHH#L5i#L=PfLHIHtxLHxduH=<#LuLL%#uIM1H$ L-H?Ƅ$2L8ttL-&8=#LHIHFHDHH APL #LQP1H IfDLDL-1L@HHt7HL5H%1HHHuL-DH=ZRH5[RfHT$)D$ L$L$ HHFD$'LPD$.PD$5PD$-MtLH0#LH$0LDhDH<$DLHHdLhMWMH0#LH$LDxD>H<$DLHHYLxMLH=M0#àIHfH@H=0#藠HfHhU`InsI?IOL8LHHIOHIGU`H@LA81LPHGH5PLL$ 17XZLL$1E1LJAH5^L}L$@ 1MH "HWGL0L$@0LLL$wL$1HL$8HT$4LH5zPD$8Lc|$4Ht$H-1HHLs>HAULL$h1E1`Y^UfHD$HHqJHI H@L8MH->L1ɺH;fLL$1E1Lb<FH5ML<HLw<ZAVH5LL$t'[H@L8MFLxLxAL 11vH5NAL11H5%|8tc|$@HHCIHWHDAPLSOH5E1PLL$01[H =LL$L1;11LH5'fATIHUHSH;*#HHLHsHu[L1ɺH5&I$I9u 'HI9tH{HuHHCHBH[]A\D+ff.AWAVAUIATUHSH(dH%(HD$1Ld$Lt$\$H)#LLHxI9L*AHH@E11ɉAD AAD HAUL=-1RLpALLL\$$H)#Hx_AXI9H9iL1ɺIHH-(#LLLL$\$H}LD$LHH-LL$L:LL|AąAHD$dH+%(H(D[]A\A]A^A_HAUH- 1RLW:HY^LL3|AątLt1ɺ1H[XfDH@L8L-(MH‰քL9vH@8AL+:AA % ʹR P@ AU% H-PH1H LL<{Aą}L}1ɺ%1HdaLxLD1ɺ1L+(fDL8LE1Ht$H=#&#莪f;H@LMM&L1ɺ L1E1fA@H AIǨL7%AWA AUH5U1A8H 1LHZ MHAL A AAD E@H@8L=$L7 % LRP1AUQ\$4LH H$#LHxI9HeIHH-$#LLLL$\$H}LD$LHHLL$LLxAąL1ɺ1LAU*1L6QH5E1XZf.t!%H@LM)LHfAWAVAUATUSHH $H81ҹdH%(H$(1Ld$ IHHD$LHD$ LL1Ʉuf1N@1ɈHBHttLH=f#HLHuLg1LE1gfHL$H9L$L%@IH-H@H|$H@#A}H M@%Lb# PD RAA%AAU к9P1ATL%\LH0fDLf1LE1cDLf1ɺ)H5gL?@1IH5LALif1ɺ/1H5.A"LAf11-H5dg$H|$J'H $H5iH=iHK#Le1ɺZ1LE1H#@HtHHtH9t H@DH"UH H=#dH%(HD$HHD$H$HHD$HtH11~DL$EH=D#HtJuH-;#HtHUuHwHWH= #HtH=#HtH-.#HtHUuHjwHH-#HtHUuHGwHH#1H׋T$H1HT$dH+%(u9H ]f.L 1H5{fAW(AVAUATUHH==SHH#H#H(H[@H@H@ H#H#H.H#H(JH(@H@H@ H#HdLh@LH@H@ HT#gH=#L`LsHHLLMHH3#.HH#H$#H5#H6#H'#芈HHHP 1L  uD IcHRDuHuH=T;IH<DHHrHD$HHD$H[ H,Hu,d@LLHH^H[HEH=LkL1LLxLRrHuHEL4H-1HnLq0H#fDH=y#q1L>a1ɺH5}HM#1H[]A\A]A^A_L`1ɺH5;H1[]A\A]A^A_L 91L1ɺH5L1H5H#rH1[]A\A]A^A_@H-LR1H1L-`1ɺ1HfLR91H5KHf#jH-*1ɺ1L_HL1H5H"fHt$H="D H"HtDLo8H-LqH)LaoLfDUHSHnH\H"HxH9t!HH.H9t H1[]HDtuHGHH[]fDHGH[]ff.fAWAVAUATL%UHSHL7dH%(H$1Ll$IL9uIf1ɺ[LL^IIFHBHHIH9HI~LHU8HD$8uH9tЉA %ALA LQ1P Av% кWP1~M~H LH="LI HwH|$BH|$/(DH$dH+%(uHĸ[]A\A]A^A_ff.AWAVAAUIHATUHSHHdH%(H$1IH@`uxH;L|$ HLIM $M9D$8%=`pIL$8Lt$HLL$I9H $Ht1LHLH$dH+%(HL[]A\A]A^A_fDL|$ HL訿uD$8%=`EL[1ɺ1H5wDHt$LȉD$H"HxE1H $LL$I9*DAA A% Hw"MtIQL$HAɿUALPA AVL5n%RL 1P1H0LL$MHD$H % IHt L9HH5"IR8L$HULQA1PA VAL% кP1fH|$0H0Ht$HHH;IHIL3L1 ILV31ɺH5=1E1ٿ@ILV1ɺqH5 1E1詿j@I$H3I9*HPID$8HIRL-L&L % 1RzP1;H H诼H`"HHLHsH1ɺ~LLXI$I9u,fDHI9tH{HuHHCHBHLE1/pf.I$HCL9:LHLHrHy"@H@LLt$HHt$LDD4$ȉD$H"Hxf $I9LHo/HIHI1L41H5 謽mIL&1ɺf.L|W1LE1亼b#D+_L i"@LP"H@L8MAU AL%%A H5+1P1̼XLZbLt$HLV1ɺH5虼ZLxvvfDATUHSHfC;CsHHHKL$HCHt*Ht%AD$`u1LHHAAD$`D tL[]A\E1[]LA\DAWAVL5MAUL-/ATUSH1HXdH%(HD$H1I#HHH16IHAG8%;uMLLLHuIHt L9L "AT11ɺAUL.H5.DA<$1.0XZtA<$0.90jA|$^AHEHth H}rHjHD$HdH+%(uXHXD[]A\A]A^A_LH^E1LT1ɺ1H5E1蔺}ff.fAWAVAUATUSHH $HH $HdH%(H$ 1HxHH}tM Јu<H$ dH+%(OH []A\A]A^A_fD11fLhL$1LHW%LZ2LOL$LLtZL=M11L-7LA@LTLg11D$ :D$ 1Hh2ILH,.ZLD1H5!¸11Ҿ|}uH$1HhH@,HYkH$H1ҹHHh2޻H)ƃgBf1ҾH|u])HH8HHFHt 8HvHu1H߾躅HHt1I!LH5T1VDLL'`HML=LV+P1X1ZDLP1ɺ1H56׶fHSkf1ҾH)D$ )D$0)D$@ɄHH8LhI1L$LHJ*LWUHt$PL@1腽H|$HD$HHLt$ H*0L1HH$1MILH)HWHL~x.IL)11H5薵|LO1ɺ1H5ʻkjfDAWAVAUAATAIUH@ASHHdH%(H$1 % AHL|$HL襲xyD$(%=`HD$8HHHD,HIHXH$dH+%(xHĸL[]A\A]A^A_@AV IAUHLdHHD$1EXZHHL?HHLHȱD$(%=`(HD$8HH9AV %AUH5I LA1R P1詳Ht$XHH 1ɺ E1L}MH5ȹnfkIHWHt$HLFAVH-M1AUL HE1 YLM^1ɺ H1:fH.HD$H\$I1L' H謲LL1ɺ H޿1E1茲Ht$LwL11 E1^fUH-1EAVH L #XLLZ1ɺ H1WHH-B1EAVH L ȱ_1AX H1LK許HL E1AVH\$ HrA[LlK]1ɺ AVIL 1AUH\$ H0AYL*KAZ1ɺ {@ATUHH=/"SH[IHtaID$HI$XLHHPt L[]A\IٹE1Ly H5萰fDIٹ1L H5aff.@AT!UHHӳIHt(1ҹ!HHɳHuAD$ HL]A\LI1ɺG1H5"HHHHAWAVAUATUSHHoPHLXE1MtsHHHO@H9u ZHH9txH;HuLh E1Mt@DpL%DLLEtIfu1AfA9t.HD[]A\A]A^A_@E1DfE1HLE1AfATUSH/H]H9tEIfHEH} HCHH}(H}0 HHHL9u[]A\fAVAUIHATAUHHݫHLHI,tEH5"LAąu=-L萯HtHxLHE1AHD]A\A]A^@HE1]DA\A]A^ff.AVAUATUHSH˅~AE19IH01HxH*Hu AƄ$H;fEt$fEl$HCI$ID$L Lc[L]A\A]A^fDH5oAt2H5!HE1ިuHE1oHAAE13tAE1!fH50!A艨t;H5!HAktH5 HE1PAE1LYF1ɺ1H5<AWAVAUATUSHH $HHfAH AdH%(H$81ID$,I)$0H$@H$0HN`@HHD$4HLPZYAt LcD$,Eu0H$8dH+%(VHHD[]A\A]A^A_@1IEL|$0HD$LHH$4HJDHD$H9AH$0L5L<u,CLK< <D<$AfCH\H;\$S1HHЃ< <usH{H ILL1YHL$LAĸA9DO1fCH\H;\$ffAD<8SHsLI萦|$0eui.|$0naa.D$CLK<<HCME1HD$fE$IcLHH1A+IL9d$uILL1=AĸHL$LA9DO1JEDA6@D$LE1mI9s-KK /LHC/I@I9rHL$t$1LHCME1HD$E$IcLHH1A+IL9d$uILL1=AĸHL$LA9DO1JEDD$HHC ME1HD$E$IcLHH1A苬IL9d$u[HC ME1HD$fE$IcLHH1A;IL9d$u HCME1HD$fE$IcLHH1AIL9d$ufDAWfIE1AVH:MAAUATIUSHHdH%(H$1I)$HN` L)D$)D$()D$8)D$H)D$X)D$h)D$xjL$1< L:tu z1HcLLF!Dc`AAu!11HKLXHMtIAH$dH+%(HĘD[]A\A]A^A_DHLE1AjHLHAXZEt$E1t2fz0BHcLL#8fDHH|ADLT?1ɺH59#ff.@AWAVAUATUSL$HH $L9uH(fdH%(H$@1IH$ )$)D$HH|$ Hfw8H/HHcH>fHF8I;z QCL$fv{H$tGL$L"tFHfX tE_H]Huڀ$E1@L$E1LLHl$LHH|$_H?HDH9wHH9t8_t@f$HL\LHH$TL訥IH<H$@dH+%(KH(@L[]A\A]A^A_Fb@H}HH9HSH?H9G9uH#IFa@^H}HH9HSH?H9G9uHˤI'|$t|$1|$0H5VHСHHϳf.H1MULZ1ɿH5XZtH$HALjE1HH$ _AXbfL$HE1AjLHLH5LY^Haf1E1D$H$ L$ HHALL)$ HjAA\A_$ L$tLL$HALHHD$ AHtLPAZA[tDL$EHtHEHt H9L="H5;LJ}L/HD$̞HPHLEA/@?LD$H1A,HA,@t HDQtI`H"H$0HHHHD1A1ɺLH薑$ LLHH99H="HtHx跡IHLW91ɺa1H5:DH\L$ L 蛥Lxo$ fDI9LGH$ fu OfItGB<8 tMt;LfHIt#x tHpLLBƄ<${L(HX-L?81ɺ_1H5E1LD$ L 81ɺ1H5ՠDAWAVAUATUSHH $HfH^ dH%(H$1IL~ H|$I)$HL9t{L-fftH{u4HL9t[kftf uH{HtLڜHuft̸H$dH+%(H[]A\A]A^A_ÐLLHHt/HH5yHHtL1;늺LLHID$8Iǁ;z t|9z 9:t*AD$a@tID$I9D$.LL-HHE1AjH,LLgZYt@H萙LLHH*ID$8IǁJ%9t(1L51ɺ;H5d貛1qH H ι+tH5H1H5HH5vHA|$8IAWAVAUATUSHH $HHdH%(H$81IHHHt$,I=t D$,9Et0E1H$8dH+%(HHD[]A\A]A^A_Ðf}L} Lt$01ҹLL*HEfI\$ IL$ H9t"H{HtD}fD9{_HH9u߾ HL$軝HL$HHkULLHL$UI|$ HCIfS7ID$(HL$HCH HI\$(Mt%LLHL$T$詜T$HL$]fAD$`@@M|$ID$HD$I9u@M?L;|$zI_LHL$H6HL$AuҾ 軜HL$HIAT$`aAGAw H5D,fEjHLT$HL$T$LT$I|$ IB HL$T$I IL$(ցIJLсMT$(DLeHH MT$0HAT$`HWHDAUfwIJ4)I$HRL9IHzUL ȔDBfAwHL LT$L1ɺ P1AVH5 WAVԗLT$(H ABfEDƄ$/:_L H2|$0_ LIDL9wHL9t8_tf}@|$0t|$11|$20H59 L賖HL貨DIMt$8X I$Ht L9wH5"Lؙ D%91ҹLLHtI9*HH5 L`t H5 LHHt$0L{Ht$XI%;B \ID$8  ʉ@  9.I $%HL9 LIVL1R PAWH5j1趕H f AHHLm fHLЗI|$ HCID$ HID$(HCHI$I\$(LeAL$`I\$0HL9HHEL БPfwHIQLG 1ɺ( AU1H5AXZLЗI$LeAL$`I\$0HtiL9tdHPAGL IfwIMRL 1ɺW AVwfDHpL?f.H i"H]"I$LeAL$`I\$0Ht9L9t4H@JL fw HIPL4 1ɺr AWH"H="@GLHL$HL$0%AGAH5m D,ID$8 % I $HtCL9t>LIHL1R PAW`LLHL$AD$`HL$L #"L,1ɺ 1H5ے L "L,1ɺ! H5]1詒_L,1ɺ` ff.@AVAUIATIUHSHHHv8HdH%(H$1HD$%;G 9G tj9j9GLLHD$HnfUHH$dH+%(HĠ[]A\A]A^LLHD$HufLL`Hu@HT$tHD$eIE8I$;z L,+1ɺ1H5IE8I$;z L*1ɺ)1H5ΐAE8I$%DLLHD$H LLP HD$Ho LL- HD$HL LL HD$H)LLHD$HiLt$ L fH5L/t{LHLt$ L 6H5|L@L藑HtOJAE8I$%L)1ɺ1H5 L(1ɺH5Ԏff.@AWAVAUATUSL$HH $L9uH(fdH%(H$F1D$lD$hD$d)$)$ )$0)$@)$P)$`)$p)$)$)$)$)$)$)$)$)$0u8AH$FdH+%( H(FD[]A\A]A^A_fD1ۀh2Ht"H$6Hh21,HHfAL=(#L5LZHLHDʀ=#IEHAQA1RSRP1H0`<`LL1M9t1I}(HtBI} Ht2MmM9uD-0"E=`#t41HL$hHT$lLLD$dH5.N|$lHh1H$HHL$8H|$n-Hh21H$HHL$HH|$:-bH|$(H|$H5f/HD$(HH|$113D$49H1L9tfHL9uHcD$HHt$@WHt$@HHD$ LMtLL1Mt ;\$.D$dAH$HH|$@DH1,~DT$LL$@Hc1H|$ LHA)IcDT$P蝏DT$PA9D 1LHH|$@LD\$PHD\$PI9Hl$XL|$ DLBDl$PgfwHM 1Dl$APHcLQLPA)RIcH1H LD9vHL9HCHHHH9HBf.H8/IEHK0Ht .tuLHS sL DCHҍ~IDE"fwHM 1Dl$HcHLIQLA)PIcRL#1ɺ1L,fDHLeH5+L誄tH5L蒄L%"H"I9tE1L-/&fDI|$HHtLQtM$$H"I9u҅= "LLh211L$+;8 k1ɺLPHtL"PLL$ 1ЇAXAYLY1ɺ1L裇Lw1ɺ1L聇LH|$ H1]=LR!1ɺ1L9fH|$ 薄H|$(|$4+1.8gP1LPHL!PLL$(1̆XZDHC(Hɐ"@H@L 1ɺ1Ls虈8҅H1ɺPLL$(1LL;XZH|$(t:V8菅1ɺMLPH L PLL$ 1A_X|$4L1ɺ1LąADl$PHl$XHt$ IcD$L|$p1D\$PL$ȌLHD$p;~HCt$LAH/?HHDVSAPLfPLM1H D\$P$Ht$(HLD\$PƄKD\$PHt$(H|$ D\$P*D\$PH|$(D\$PD\$P$H|$(D\$P}[D\$P#H|$(D\$POD\$P)Ht$HH|$D\$(D\$(4|$4D\$D\$n|$4D\$8~D\$,HD1ɺDSLLASD$ PLL$`1ڃf$HDŽ$)$)$)$ H HH|$ L31ɺ1Lm8L1ɺ 1LDl$PF="LL11HA(1DڿϦD\$P!MD\$PD$RL1ɺ1LƂLZ1ɺ%1L褂oL\1ɺ)1L肂MLy1ɺ-1L`+LW1ɺ/1L> L51ɺ21LH|$ 88qSL1PLL$X8L1݁H|$0C]A\趄1ҾHWD$4H$&HL$8HtHD$H1"pH|$>LL$FHFL0HH$6gHL$8AM'1HOHJ"lH5HSIH,HL<H|$ L'LLyp"LpILs1L1hH|$~HD$HE1H$E1E1D$HD$8D|$(H|$3HH{.tL{L}P݃ wHS"f)$L$Hs2LH$S+H$LL$P$S/)$f$HcHDŽ$/|H|$8 1辅H 1HD$H訅H|$P 1HD$@萅LT$HAT$AA9vHL$@E9A9A91ҹ0LDL$H$趂DL$HuƄ$D$(AADL$L1ɺ?1L~D\$L1ɺ=1L~D\$kD$4D|$(9FD9aH|$EA)AŅ Au$H5H|$H w"Ht$xH8~H57@AQL4A1ATOLU11AW}H JH;H t1H;H t;t;H t'H;H ufH;uAUATUHSHHH9tIIL- HH9t2H{uHs(1LαHCHtHH`H9uH[]A\A]LK(L1L tATUSHH $HHdH%(H$1H$HHhHlHHqAąubHh2@1HwsDžnAH$dH+%(HĠD[]A\@ILv1E1H53s@1E1L2H5 Ysz@{uH1ɋILwH5P1 sXZ?fL 1ɺ1H5ruDAVAUATUSHD%y##A9EAվ1H@HH=LMUL5f#1HLD "EDAABL1qAąBD`qD%э"A#*AL11H5~E1qHD[]A\A]A^fAHtHD[]A\A]A^1L1ɺH5gqHD[]A\A]A^LL  H511qc@1ҾHHD$D?HL$HIL 1ɺ 1H5pDs1ɺE1DL'1H5^p`A@L 1ɺ 1H5)wpfrL- 1ɿDL1L'DpD\juE1`A\DL 1ɺ*1LpɐUHdH%(HD$1D$@H%=uaHL$uILR1ɺiH57oT$HD$dH+%(H]@H踚HuL@ 1ɺmH5%o=٘"HD$dH+%(HL811ZH5]n@%=D}#6HD$dH+%(u:HH]uLa1ɺo1H5!onUqDAWAVAUATUSHhHt$T$,L$(LD$8dH%(HD$X1HD$@HD$ HD$HHD$@u(HD$XdH+%(0Hh[]A\A]A^A_DHL11 H5nmLHI9{L5L-xDHr@IT$0ID$ L 'jAL$HIDՍyHIDfwHM HLg1ɿVH5R P1*mM$$H I9t-ID$LHtHHt H9oH5w"kLI9D$L-ըM$$I9ID$Ht@btLp HP I9ua fM6I9L fA~uINH7 HHt H9Lwv"IT$0ID$ L hAt$HIDՍ~HIDfwHM 1QH51ɿAPLYR P1kI~H >nIHI|$ HiM|$ ID$fA|$M$$Lp0D$I9f.LML9bLl$L=MfDMfMAVftMt)IEI9ufHI9|L;`uAD$b rHH LHHAANIF0f A$HIv I$I$M$H3PH38H uI{ISH3xH3PH . I$Ht L9_Ht"HyL gIDHIDfwDH=gIIAS1ɿLL\$ Rr P1VH5!jIF0I$H H= 1L\$HHDHt L9L t"P11LyASu H5vL\$(iA[XH|$gHHD$I~0gHD$IF0AND$IV I4$H"L9H~HqL fIDHIDfwDH5eIIHL1WH5P1R iH IV(H/IFHtHHt H9H=r"HHT$kHT$I$H/L9&L@IN0IF L ;eAvHIDύ~HIDfwHM 1RH5 APL\Q1P1AhIFH H HH H9 HzbjIHt"I~(qeMf(D$fDM6I9dLML9ffA|$Mt$0MM|$M`IIII3FI3H 2 HQHAI3VI3FH  IHt L9IL-aq"ID$ H=9L ^d L H5HHDH1ɿAUAVP1fMt$ H MLLiMt$(MLLiIT$0ID$ H5L OcAL$HHDHHDƍqfMAVL1ɿAUH5 R P1WfLH hIHt#I|$(cMl$(D$DM$$I9SLML9L5L-b M$$I9t|AD$ft tIT$0HtI|$uIL$ pMHIDfwHH=MbL RH594 1QL21ɿveM$$Y^I9uLML9t1ML5VffA}uIU0Ht I} MmI9uLt$@HD$ I9tLLL-}IH@IVH9 LfDHH9 H;PuM6I9uLIL9WL|$MHl$ 9In Ht^HLguOI~0@DMmI9tOfA}uM} MtI}0tI}tH;\$tMM9tfA~tM6I9uMmI9uL|$Hl$ L9L5L-`DM$$I9~ID$ H 8. fA|$uI|$uIT$0HtID$ RH5WL `L$ HID1P1cM$$^_I9uL$/  D$( L11 H5*cH"fHD$H D$,H8H9LHWL9LfHH9H;PuH@0HH0HHLH3H3H HPH@I3QI3AH {H?H;|$udLm1ɺ 1H5Kb7IL$ IT$0H0HIDHIDHt8H9t3LNQH51ɿRL& 1aY^DL k"Iv HH H M$I$M$H3xL3L rMHIxL3HH3xL YA$THI4$HH=ik"IH L9 HPID$0MRL LW PMEH511`L=c_AXIHI|$ D^Mt$ Mt$(D$ML5fDID$ H=L ]L>H5'HHDH1ɿR AVP1]`IT$H b`Mt$0HB0ID$1TIH @L1薣IHIII3I3FH uIII3VI3FH uIEI}Hth /]L']IHcL9ZLhIT$0ID$ H5L 6\AL$HHDHHDƍqfwHM H1LAUH5R P18_H L|aLHD$oaLIda IbH|$7 M. M% H I|$ HD$0<\I|$(2\IW HHT$}HD$Mt$(ID$ HD$0LhM|$AO`I IG0 HT$It$LHIW(HPIW(HIG(赅D$!IHL9HPHt$HtHH9upHH9dL;xuAGb SID$ H5QRL [L  HAVHD1H5cP1]H}H QHfH@IT$H|$@HP HL$HHt$ HHHL$HH0HHD$Hf.IEI}Hth ZLZI$HL9HRAPL Y1ɿRLSa P1VH5\I$H HL9H@HMN 1ɺd PLH5B1\MN LLL$(YH}L`XZLIHtHt$LHbIH}HL8MAfIV H8.I4$I$HvI9mLFHҍqL XIDfwDH5vXIIW1H5]APLP1R [I$IV0H HCL9:LHH11RL" H5Q[I~0XIF01AYAZAND$IV DHHHH9LHM1ɺh H51ZIV1LIHPIvH#^HHtMM6LI9H=d"e@Ld"@Hd"5@L qd"V@L-ad"@IL$0LHu H (HAT$MrfwHN *QLW1ɺ PH51YAXAY@IL$0HIDfH @I$Ht L9dH5c"IN0IF zL 5VHIDHIDfwDH=VIIHL<H VQ1PH517YH FfDL9LL9tGfxu@HH0Ht7Hxt0H:HrH39H3qH uHzHrH3yH3qH @HH9uA|$dHI$Ht L9H=b"IV0IF L ;UANHIDDAHIDfAvVLu1WRT P HM LBHylHpHM HRLJ%IT$HxeLhIE RL UV LH5HID1P1WI}0(UI}(ULIE0IE(XMZD$KLa"L1ɺ 1H5RW-Hfa"L Za"HHD$8HtDT$(AA5LƼ1ɺ 1H5VA$M$+<I$Ht L9H5`"IN0IF zL =SHIDHIDfwDH=SIIHL> VQ1PH1ɺ UL eSLFH5"VIFII~ HBH{SI~(rSI~0iSLaSHD$0LLd$(AZA[D$@Lɻ1ɺ 1H5YUHzA$sLO1ɺ 1DH5AAUU0LL1ɺ91H5[/U D$IIv M$tH"_"HpUH _"0L1ɺf H5vTWH|$HD$0 RLRLRH|$0RL11 H5'uTP+Rff.AWAVIAUATUSHHHHt$@L$T$LHL$PdH%(H$1H$L$HD$H$H$HD$pHD$(HD$xHD$pHL$HD$0H9t8Ll$L|$0DH}tLm Mt f} HmL9uLl$L1ɺ 1H5fS1GHD$HHt$LÖIHoID$ Il$ H9uHH9fxuLxMtIH9ufDHmH9tHuLUuI~yHpfL`H$H$L(HPH$HH$/IH LLHIH uLLHIH LLHIH LLHLLĬIHIH9 Hl$IH M?L9 IwHTuI~Hl$ Hl$7LD$ HH f HBLD$ HT$TLD$ H AI|$ L@fDx IL$(HT$H(HHIL$(HH$ID$(Lb\ H$L*HBH$HH$}DHD$H@Hth H\$H;NHNH$E1L9t HAL9uL1ɺ)1H5cPL$IM9x MgID$ IT$ H9Mfx6HhH)AD$`Ht$lLD$lSIDT$lE;IH YLLHtFIH LLHt)IH OGLLH] IGH[HHOH9FHRHRI1PL&H1H5OIIGHBHAXAYHIL9tdHfHH9I$Ht L9tLHL X"1LT1ɺ-H5ZINHL9uL$M9 E1fM?AM9uLE1ɺM1H5SNH$Hl$H9n Ld$(HCHxHx0tI~@Htlf@@ H|$p@0HSHJHHHJ0o HoQP(Z HL$xL HHHL$xHHD$xHB``HBHH9_H$L|$L9D$HLd$(Lt$DHmL9`HEHP0HtLH p(1ɿRH5ؿl1L*MH$Y_L9+LuHI~0LLGHXHLL1M1L 'LWHWL3H3L HI^K`HAH98H@MN Pw1WL1H5eLH$A[ZL9u KHL9t@H;XuIV0HHHpH@ H3 H3BH uHNHFH3JH3BH DHmD$HL9Lt$H$H;D$)Ll$ ILt$X@MmL;l$IEHD$H@HD$HuHD$L.1ɺH50LH p(p01rKH$AYAZHD$HX H;l$ Ll$8E1f.LeM|$ Ml$ M9t.DfAuIwHtHNWM?M9uHmH;l$ uHD$Ll$8LH0A}HL$MHIEHHmHHaH9XLJVIGHHHH9HBHIL81P>&I$HtKL9tFH@HIL1P5H5ɼ1JA[]DH!T"HT"I$Ht L9HS"IĨPI1ATLk1HS"L$L;l$IH\$(Lt$0Dt$L|$L|$MeEtLH蜠MI$HL9LH1H51Lx0>H$LA$HH LHHt\HH LHHt?HH 5LHHt"HH LHHqMt AD$aMmM9H\$(Lt$0L|$L$H$D$D$0D$`HD$hM9L|$MMfMoM;IEI9.L5G"HtLpHD$0IwI9DHS0HH HBH3H3FH HJHBH3NH3FH HDŽ$E1fD$u |$ HL$hH$LHשoH$HHD$(>LHD$X}>H8HD$H$HfLK0HLMH5MLDȃ=e"H1AV1t$8R+;H Q?IH<H|$H0H|$($H|$XH{ 8H{(8IE HHD$`NZHD$(Lk$HC HD$HfSHC(HD$XfAVIFAM`I} Mu0" HD$`HsLIIE(IFIE(L0Mu(PbD$`M?L;|$|$`L|$L$D$D$@!D$ M95L%V@M6M9MnMtH1LHHPH1LHHuA}dIUINHL9tLJP[1MQH5Ȭ1ɿ:XZHtHCAe``HI9 1DD$fDL C"k@L C"y@At$XH=t"L_x f.M7I$H*L9!LHL1ɺ1H5<9HHH$HD$LH9wM$Ll$MDt$HIHl$XLL|$`IHSHC L{H3EH3UH IWIGH3UH3EH HCHMaI$HTL9KHJHHNH9EHBQMLۢ1PH5188A[LX1ɺH5Ȫ181ML1ɿH57HHCHBHIELM9Ll$Dt$HHl$XL|$`)D$pϦD$tD$D$01L1ɺlH5*x7D$0D$D$@HD$PH.|$#L YA"@HH FA"HH6A"LH5 T$$LL9H5LE1D$(9H5nLA9HT$$I9D$)fDLHT$xf$8LHD$(H$8LHD$X8H1HD$PH51H$MLR36^_WMtI$Ht L9H@"HML#1PH515LcAYAZD$@D$tD$D$pϦD$L1ɺn1H5(v5HnL2H|$(2H|$X2H|$H2L?11=H5ԧ"5=D$0D$@yD$DD$$ϦH@HTL-L1H5&L:IH1H=1"4Aƅ1H^B#;H$H$D-==B#IH^HD:1HHMLAWAIH1.AXAYHDD$$L$D1L.DD$pL$t1HpL.LJ;Å 6L7t5 vH5Lm:H1ɺD$xLH5+P$PD$KHID׍qHIDfv^HL1WR4 PHS0HC MKHIDԍqHIDfv(RL1ɺy PLJHN HRLy N 9P1|HxHCHtYHHtQH9tLHzHS0HC MKHIDԍqHIDfwHN 9HL1WR PcH=""f.ATUHSHdH%(H$1tj8AąH2{Au)H$dH+%(HĠD[]A\H`fDS]Aą@th2WHHh2Q9@%=uy11҉H脤Aąu]LN1H59#@L,1ɺV1H5nf.P%=%#HfD1ÃHAr|DL1ɺ[1H5gQfH@u>Ht :Ly1ɺp1H5~H uߋ%=h2HHh2|HOttfDH81E1LH5i%=BD%$#E2HE18"11ҾH?Aą,LՆ1H5OLeH51LtH5"Lσ fg1E1Lh2LH5jTPHLJHfHLJff.F$G$FPGPf.ATSHHHtLHL[A\fDL%o"Mt4HW8bLIHtCHSt_LfDL1ɺ:1H5zoDLd1ɺ=1H5RGafHHt8H9t3LHB1E1LH5"L "SHHHtHǃ[DUH-ʌSHH@ uTHC@HtH9u0L "HHL1[]cLHf.{8HHtH9u?L P"PH b1PH-+1LͬHXZX@LJfAVAUATUSHdH%(H$HH H=w11H$dH+%(H[]A\A]A^H IHպLLHLT$==ILHLY$=t =SL1Dt$D$(D9A9H9HH-H9$HRHMRL̚AVPefL1Dt$D$D9t[A9tVHtHHt H9Hy"HMRLeuAVPH51*H `LeSfL 1ɺhH51+f.HR~L̩1ɺH5j1f.H"ff.@HHdH%(HD$1HtH1HL$t<|$LUKSt"HT$dH+%(u@HD1f|$uL1ɺH5ff.fAWH5*$AVAUATUSH8H|$dH%(H$(1HD$ IH$ D$LHP HE1B\-E tքtM L8HADG u^#tMc{ILHtaH5JL ty H5GL ED$D$`IIkJf.}LHHD$t)D$ D$@D$ \$ \$ tH5yL HHD$Ll$ @ALHAMc117fu<"tPu PπgHcуD IA1BD5< t't#HAWf tfu <"u'>|$ JHt$M1P1LH5r L H=+#YHX^HHHt5,tD$ tADfDfDH=1+#H5+#eL1ɺH5G ifLuDH$(dH+%(H8[]A\A]A^A_fL|1ɺ1H5ͅ_ DHt$M1PL1H5( LH=9*#LpXZL軵HHt;AAEt"D$ AtECD5fBD2fDH=)#H5)#\$9L1ɺH5 D$ HD$ HzLHHILHLHH) H)H/HD$ HzLHHDILHLHH)A H)HGD$ ۉADDD$ ECD5BD2 ff.AWAVAUATUSHH $HH $HH $HH|$HLD$ dH%(H$x1HH$HF8,AL$p!A LAL%;"AA LH1T\L$pLLt vH/LƄpUL@H1LHLH$LHHD$?AŅ`$%=@UL%IHCHD$L$pHhHD$LHHox.HXu{t߀x.u{.u {tDHL$1IؾHL* Ht$LuH$AÉA AA H$L$8D\$L9H H=w&#HAHt$LD\$1ɺiID$ LH5{1ML$(ID$aqLA\Lg1ɺc1H5l{JAWfAVIAULnATAUSHH<$Hl$Ht$dH%(H$1)D$D$eui.)D$ )D$0)D$@)D$P)D$`)D$p)$DEHcE1A)HL>HIcA9~6IM9uH $HƄ$HQNH$HtgHHt_H9tZH@Hr1ɿPLL$1LwH5?zXZH$dH+%(uHĨ[]A\A]A^A_@H "f.AWfL~AVAAUATUHSHH<$Ll$Ht$dH%(H$1)D$D$eui.)D$ )D$0)D$@)D$P)D$`)D$p)$EHcDM1A)LLHIc'A9~RHI9uH $LƄ$H%PH$dH+%(uhHĨ[]A\A]A^A_H$Ht HHtH9u:H"H1ɿPLL$1L$H5xXZ@H@eDUSHH\$ HH8HHxHHHHǀH1H)HBHD$(HBHB HB HHB(HHHHBHHHH[]@H-Lj1H "H11L}A"H1[]ff.ATUSHPdH%(HD$H1HsHH@HHAąHC@HtHHt H9(L "L%w11VLLw<$LL LELw11XLYHvL `LDL\11cHL1D[LvD+P11XLZL71ɺ^1A HD$HdH+%(uhHPD[]A\L1ɺT1H5vDLJ1ɺQE1LH5uff.@AUATUSH(dH%(HD$n"t#t(r#HT$dH+%(H([]A\A]Hl$H\$ILd$ II-#LH5R7#AEt #DIILH5duLK#ff.AUL-6ATIUHSHHH9u 3HH9t(HsLduHA[D]A\A]@LLHAąu1L=GH51tHD[]A\A]ÐH#uv ue="toL@11KH5hk="I#=c"uJP"H=B"uL1ɺF1H5jHHL<1ɺT1H5j";L1ɺODH5j1?fAUATUH-@/!SHHLHTIHt{HL9tIH HHHtH9uEL "RL^rPH5eq1XXZHL[]A\A]LIf.HHHHtKH9tFLJHH5qoPL1Y^LH[]A\A]fL "AUATAUSHDELHMtqH--!HTAąuiHHHHHH9LJQH53pPL:1Y^HD[]A\A]fDHHHHtCH9t>LJAULPH5o1XZDH[]A\A]L !L !P@UG@HxqGD~GDuH]ÐHEHt7H9t2LHL߃1H5Fo*L 9!HHtH9u3L !1LVH5n1]@LHf.AUI1ATUHSHH(dH%(HD$1"HpH$Ll$HJHDHHUHH9HRHML%CnPL1LRS"H u}@1HwHNtjAHD$dH+%(H(D[]A\A]fH!e@AL11H5m|f.1ɺLL]Uv{8HUHtkH9tfLJH1ɿPL1LAUS H HqLL11AL !fAVIAUATUHSHHDoTdH%(HD$1HH$D$E1E}1HT${D1HhDo$ыD$MLEHAEAHD$dH+%(HD[]A\A]A^ú1DAątDm@AafDGHAGLfD1ɺL1H5k$11MLt1ɺ1H5skWD$f.HL,1ɺH5(kAWAVAUATUHSHxdH%(HD$h1HHt$$HL$XHHbHEFI PARTH9D$uyDt$`H\$XDl$dEtdE1L|$"f.H|$ALE9t8LHHuL=1ɺjH5k"fE1HD$hdH+%(umHxD[]A\A]A^A_AL11YH5kf1ɺ\E1LH5sk@Aff.AUATUSHdH%(H$1HHHHG`THH9LhD% "D9eh>1Hھr?WHHM1LjxH HHEpDehP1H5hXZA4fHt{H9L1ɺ>H5h1E1H$dH+%(HĨD[]A\A]fDL\1ɺ]L-i! @L%Y!D- "D9mh(HLHD$0HM1LiQH HHEpDmhPfD1H1AąV}@1HھrHw "H1L%gMH LLRiHHEpUhxP1iYH^LLP11{A4L`C8|A<$MIH٦HHDHE1HH nAPH5fQLQP1H "E18H1PL{MnH5f1x_AXLl1ɺh1H5kfOf.HupM1Lu{`1H51fAHEpHA[[rHMup1L5{AfD 8DHM1PL-en1L%{LAYHAZ AąL1ɺp1LtZf.AVAUATIUSHHH@dH%(HD$81Ht$HD$bH|$w7=`G"v1HT$8dH+%(H@[]A\A]A^Ll$ 1HLq|$ N+LHF|$ N+@iHl$LHHHŀH HHl$|$ N+IHD$LHHhH HHHl$|$ N+Ht$LHLt$D$D$ LH |$ HuHHL$ HIHid ISM CH3D$(HIntel RaH3T$ H uHfg Sig. H9D$0}Ht$HT$HW0HHHH9H@Hl$HLhyPI1H5\XZMf.K`1LH5R\=D"HHHxH5sdHH]H5fdSIvfDH7HH+H9"LHLw1HtHHt H9L !L|w1H5[M1I,$K`L1ɺ,H5:[@Lt1ɺ,H5[Y@LH\HHHH9H@HIPLvL !@Ht[HHtSH9tNH@HIPLv@L1ɺH5RZ@H!L|1ɺ,H5Za#@Hq!.@LD1ɺ,H5Y)-L 1ɺAH5YL1ɺIH5YHt[HHtSH9tNH@HIPH5aYLu1HD$(Y^MH!H!JRfAWAAVIS1SUSPENAUISWAPSPACATUHSWAP-SPASHHH8HT$Ht$dH%(HD$(1u=ADDD H;D$EgHL$ HLs;H9l$L9l$L9t$HS2SUSPENH9D$HULSUSPENH9D$HV H9D$tLEAR1HT$(dH+%(H8[]A\A]A^A_f.f|$&CEcH|$HtL'f|$&E2tL9t$J|$&D?|$&D@L}1ɺ.H5_J|$&Dm)aAWAVAUATUSHH $HfdH%(H$1H|$)$HH=_NH=HtpHHHHtMx.tHHHPL ̅1L[YH^HHuHE<H#L5#L8L9HL-#fI]L`L9u dHL9t[HsLLuH]L9u@DHHL9t-HHuLuHEHUHHBHHL9uHILM9tIzf.L9tUH#E1LeAL@LH߉HmL9uEL0r11H5[H$dH+%(uVH[]A\A]A^A_8L 91PH3L{PH5[1$XZAWAVAUATUSHH $HHt$I$dH%(H$1eHD$HA<$ZH$1LHJLH|$ ɁgH|$ H5H$H(D$Ld$0fDH$PL/HE1ۀ|$0 LHT$/uHcH< tHcL 1qHA=vM LWHtAHM1AL q1AWH5u[AYAZEDD$E@HcT0tHcDAHcHu uHT$/HcHcH< tM4A.sA~d2HT2HDP vHL$IcǃL(LL-!1pHDL`HH9rLLA IA}uHD$HPHX HCLd$(e@LkLH[HH`;VLcMH9rLL%AH[H;tH-Y1Lo:HH<$Zf.H|$FHD$H$dH+%(HD$HĘ[]A\A]A^A_LH=Zdu(HT4HDP tHD$Dx \D LH=Y$tCmukA~dud?HT2HDP tOHD$D8f1|0BD$HT=HDP tHD$Dx f.LH=NYu#HT6HDP tHD$DxLH=YaHT4HDP HD$DxQ1ɺ1L%mH5W1HL$HA$H$HH9u?1MH-WLmDHH<$85L{v1ɺHPHvPLL$0H1Y^LH=X_uHT4HDP LH=W.uUHT8HDP LH=Wu#$HT5HDP tHD$DxLH=WHT6HDP HD$DxHcH V!IcH[THL$T$1MH-6VLwlLHbH<$9q|8Lt1ɺPPH uPLL$0{Ld$(L3k1H5UH<$ 8D]1LtPHtH5wUPLL$01XZHD$Dx8L:t1ɺ=PHHtPLL$0HD$DxTHD$LMcLd$(BL$f8$HH *IH/ASHDAPLQH5TPLL$@1H LiH5zTff.AVAUATUSHH $HLG8dH%(H$1G\HHD$t6EAH$dH+%(HİD[]A\A]A^EAAHA L$AAH !HTLA 1yxtHt$LwAąt C\AEZLt$1ɺLLi|$tj 1LC\ HHtH9u3L l!L,H5R1E1%LHf.HHt8H9t3LHLpi1H5RfDL !HHt(H9t#LHLh^fL !rfATUSHH $HH n!H SLG8EA dH%(H$1AAAH$A 1HAHFwxBHHAt|H$dH+%(HĠD[]A\fDHHt8H9t3LHLPh1ɺ1H5XQE1fL !E18q!I1PHLoPH5P1+XZ8ff.@AT1UHSHdH%(H$1HHtuf$UuALd$@1}tutnHL9ufDHH$dH+%(uGH[]A\ÐL\n1ɺH5PA1D1@H(AVAUATUSHH $HH $H`dH%(H$X 1IH~8HH@ % щD$ L$FbuED$AHu:HE8AHH$X dH+%(H` D[]A\A]A^L$PL%Y!DL$1DD$ LLHMftHl$PLHaHHDP2HLLIHd%1t~H5"LHHCLt$H¾@LHHL$HT$ L1H5XRAăVD$T$ HH H H%H HH_8kM1PHlLlPH5M1XZo@1At5)HAHH H HH H5f.H;AfMLd1ɺGH5HM1E1y@HEHtH9uBL {!L,d1ɺCHHLad1ɺOIDLHf.H1H5LMAVLOdc1E1Y^@H."85$PMHIHH5XLHDH^E1APL SP1vH )X8t=M1PH!YE1PLjH5K1'_AXMLL11WH5KE1nAWAVAUATUSHH $HLD$LF8H $dH%(H$1=!LD$DAHIHAD;GD9L$H UL=g!LH0LL 1AspY^!Lt$ LLH5lLaIHL@LHdHT$H4$L1ÃLnH$dH+%(EH[]A\A]A^A_8$MIH5HjHDHH OAPH5ALQP1H II1LJH5A1,f.1IALHJLnILJ11۹VH59A1ɿMrL*aH5A1TL,@k8$MIHH3HDHH g~APH5@LzQP1H *HT$LD$DAA*fDI$HtL9u:L !AVw1Ls`UH5@dXZDLH=ML_11mH5?1'tfAWAVAUATUHSHHH|$HdH%(H$1F8%D(u FbHT$ HAąLl$ H|$I؉HL4fH={")D$0)D$@)D$P)D$`)D$p)$)$)$lHl$AHD$HHD$HD$L-"LxL|$(L;|$unfDM?L|$(L;|$UAGMOI_fLGLMRLADLL5HHtHxtHD$HHH;D$LHHx1SL^H5D]XZAH$dH+%(HD[]A\A]A^A_fL8HD$HL #!L$^1ɺDH5RD@=1&"E1vLc1ɺ1H5DMfHD$@`@uHt$H|$TMHD$@` uHt$H|$HT$0LD$(A"iHT$(BLbHZfLGLLAH= "DLHHHxGL !NHHHt_HxH5D$HHtH5E=H{H5EH1uPE1ALab1ɺ1H5BDl*f.H(AdH%(HD$F8%;G t ;t;Gt;Gt;Gt ;Gt;GtE1HD$dH+%(u;DH(@HT$H|$t΋D$H|$E1%;A@AWAVIAUIATIUSHH8dH%(HD$(1HD$ HD$HD$rHHžHH HHL$HT$ HH5 ?HL$H|$L|$ MtwMHL$tLLHL$MHHT$H5bDkH|$u H|$VAEL|$ HmMHQLD{ILC1ɺ1H5A,MtzA$AHHD$(dH+%(H8D[]A\A]A^A_H|$HSCHHDS1MWLrZ1H5yAXZADILZ1E1zH5;Av`ILC1ɺf.ILB11H5@E1) @Ht 1H|$AEAEL|$ H=cBfAWAVAUATUHSHH8dH%(HD$(H~HD$HD$ HgIǾH LJLbAą^Ll$Ld$ LLLH5^<gH|$[Ht$ H LLLH5Au H|$LLH5ALwE11LLH5ALD$D$u H|$LLH5ALkE1uLt$MLLH5LAu H|$IL)|$D$HH@ H5)AH H@ PD$ILW1ɺAP8 H5>UP1H F=!I11AL_@H5a>h LmHD$(dH+%(H8D[]A\A]A^A_Hl$E1H}H|$ 11HHA`fILV1E1H5=t=!IL}?11H5=h L裺1fDIL,?1E1H5S=LfHǃ@ 1]fDM0L@ H5M?HID$LH@ fDH|$ 18 @HD$ ooH H 0@$4@H|$ 112IDf.H|$ 1 D$D!D$uDAWAVAUATUSHH $HxdH%(H$h1>HD$M=F!L ?!uUL)Z1ɺ(1H5;E1 H$hdH+%(HxD[]A\A]A^A_DIH\$`HJ8H<$IHHHLL$ALHL$LL$HIpHl$ L@HZH LH5bH1-AƃL(\8蕾SI1PHYLYPH5:1XZ1ɺ%E1LXH5:ξfLX1ɺ+1H5i:蟾f.H1H5C:IULSK1E1dY^DE18蹽I1PHLXFPH591_AXLD$5LD$8H$t>`I1ɺ4PHLXPH591ýAYAZE1HT$HLL !tHL$LLH٭LAtFLHIHH$8tļI1ɺ@PHLWP_L1W1ɺ<1H58ff.@AU411ATUHHdH%(H$1ILHH t|}@1LDڶE1䃼$xAċE@ED~1EDt)H$dH+%(HİD]A\A]fH舩fDAL9V11WH5-:f.;8tHUHH9L !H uH5A9HEL !H9tLJHZE1PH9L+PH591Q苻H fHEHtH9uzL !1LIH5c5GLCU11cH579&LJH tA9:H $?LHfL !H HtA9HD蹽fAVAUATUSHH $HH !AIIHA AHվdH%(H$1A@AA H~81L[`LIHEL4HPLH.uAytۀx.uAy.u AytdHK1SL58L@8L軹AYAZLO1MLL81ɺ`L臹1H$dH+%(H[]A\A]A^fDAymf1LHj+HtZLL5h7载uiHL71IS1ɺ^L_AXbIٹ7LH55螷[1]DAWAVAUL-5ATUSHH=26HHt$H5dH%(H$16HHf.HIHIHuMgA<$/uM7A>/uLHHt$L舴HD$H9D$8uHAw1ɺL5L?L1H54蔶IwH{rXHZHIHP@H萯H$dH+%(Hĸ[]A\A]A^A_fLسHD$H9D$h @@+8dMH IHoH54A9HEHH SAPL>QP1襵H HD$H9D$8\@1LO1ɺ~H53g1Kff.AWfAVIAUI1ATMUSHH(H $H|$ >dH%(H$1)D$HHx`L|$ǺD$ L蘰|$ HHc1LLH5LD,}TH-3LHHH$LHJ~:H<$AMtMH-h3LHʳHALLH~H5MLD8TI1PHLNLPH521跳_AXIL21ɺNfILQ21ɺF1H5]2l1H$dH+%(}H([]A\A]A^A_ÐILH1ɺTDI1ɺ`LHH51H$f.I1ɺoL2H51βA$UI1ɺZL1H51薲H$9f.I1ɺuLHH5J1^A$H{1IATLH1ɿH5 1XZA$fH1H50ILt$LHf1AVAY^AWAVAUATUSHH $H8dH%(H$(1HH=0IJH?IL$ fDLxIHA.tIoHɮH uE1۹LHLغHULL M0LL$1LD$,HH|$0D$(H|$IHLLAZA[HT$Ht$L $a9ML $tLL蕳L $HL $IHAoGT$L $@ oMH0D$ tHH H H%H IC$ |$ AL$LF11t$M麻AVH5.H;_AXL$HCILICLL[ȶIHP@L@MHoLDHE1H9tHAH9uH11AVL.H51.EXZH$(dH+%(H8[]A\A]A^A_DI{A1ҹLL$該L$H|$ AƃfHt$1ҹL$IdL$HAƃ@f.軰81H5b-L -PHPLI1SY^21ff.ATUSHH $HL%y-HLdH%(H$1HHIHOL%,1ɿ1IL8-L语Hu#H$dH+%(}H[]A\諯8t߬I1PH"LPL H1FXZfHML 1SH5 ,1Hlf.AUATUSHH $HL-G,HeLdH%(H$1HIHIHML-+I11L,LzHﺀ1DžwAH$dH+%(HD[]A\A]ÐA$t5HML1SH5*E1H또軨SLBE1AUAH5*1讫_AX]fD˭H1LIL,+E1P1qY^!f.苭8ĪI1PH'LPLE1+XZff.@AWAVAUATUSHH $H>H-*fLf8H|$LIHH$H$ML$H3dH%(H$1D$<D$8)$HHLKDEE AH*1DD L$ALL$l$(YKAÅ>H $H1HcD$1H)H)L!KD\$A1A,H(HD$HHH9HHLt$@1DD$,HlLD\$ JD\$ LcD$,x-HHqH9hH@HML@1PD$8'PD$,PHt$81#H 1L苨AƅPu)ŅHcLDyHHHt H9L Ҳ!R1ɿ1AUHt$(L@5萨AYDAZ褢@DAt^HI AWL%H5,'19XZ1H$dH+%(H[]A\A]A^A_@AWL>UA 1H5&٧]1A\fHt$H HH9LHHHH9LH=;!D\$ L>H1ɺt$D$8PD$,PH3&HHD$81=D\$@H E1DhfL 9!D$(L=H5%PD$PfH !@H !,@H%E1HD$f.ۨD AHL$H9HH9wLHAT1L8>AUHt$(-MA[1[Ic1LLH%H)L^GD |#8\M1ɺAPHL@PHt$(1_AX@Ht H9tHXH!tHL<AD$0H5X$PD$$PS1^H DHt[H9tVHXHL5=ATA-AUSHt$8fLHUL !@H !L !M@}8M1ɺ8PHLl?PfL$@1H$LHT$8HHHt$H9t9HX'HLo;ATAbt$SL 9H5at$lI<$AYAZLT$ID$M"IBLMT$HT$@L"H fAofAoWH) )S菜H L$H1SLwLL L$0H$1LHHIHLLD$<D$8XZHT$(Ht$,/H$Ht$ tHLYHIHfofocT$,X `0D$( tHH H H%H IB$ FIzA1ҹLLT$膡LT$H $AƂf1ҹHLT$IELT$HAƂ@Lv71ɺ@H5H1E1RH$!dH+%(Hĸ!D[]A\A]A^A_fDI$E1I9t@HAI9uHL611t$H5A՜_AXH|$訠n8$1ɺH5PHx7LT7PLL$(1腜Y^,fDLt61ɺ1H5HWI<$HI9tHGHCH訙HHI9uH|$AąCE18y1L6PH6H5PLL$(1ڛXZL51ɺH5豛UAUL351SLL$H5q耛A[[!Lt51ɺ1H5HWH ۗ$H58H=8Sff.ATUSHH $HL%HLdH%(H$1HHIH<L%1ɿ1ILL蟚Hזu#H$dH+%(}H[]A\蛜8tϙI1PHLPL416XZfHML1SH51Hlf.AWfAVAUATUSHhdH%(H$X1HO`@HDŽ$(D$T)$@)$0H9u1H$XdH+%(Hh[]A\A]A^A_H y!HHL$ Ht H@HD$ H|$ 11赘D$i|$Ht$T {讗H|$XLcLyH\$X1Lt$pH{HH\$0HHHǃH)HLH\$xHD$pD$DŽ$0HDŽ$$D$TDŽ$$DŽ$Ƅ$賖HD$0L$@oHhH@xH$(H$PHD$HHL) $)$@fD8HH9uH$(L$0HD$(8WHL9uH|$`L輑$L11ɺ1H5蓗HD$8HD$GLt11ɺ1H5WHD$8HD$0HD$@H|$8螔H|$0蔔H|$芔|$1x48m1ɺ L1PHH5PLL$01ΖZY6LL$ L011H5蚖DHt$`1H~HHt$8HHHHdžH)HLHt$xHD$pD$DŽ$0HDŽ$$HH$DŽ$Ƅ$Xu {PH|$hLՏL/1ɺ1H5謕HD$ffD×H1ɺt$(D1L/H5g[]HD$8HD$0HD$ H\$h1H{HH\$HHHǃH)HLH\$xHD$pD$DŽ$0DŽ$$HH$D$TDŽ$$Ƅ$$Hl$@fDHc $HD$Hp@?H\$(fA)$HA)E<j<4<HD$D$1o\)$@H$1 fDHuuI9uHT$HLfDHH9#8tH|$@L艓L$ $$=$wD$1<tF1҉D$t@f.E1)$H$DŽ$uuidf$)$)$)$)$)$)$)$@AHc1A)GL=HLhIcHA9~qAGt AGu'AHc1A)HHhIc荌A9~8IIuHD$@HƄ$HH@HL$@HHtCH9t>H@HH5v M1PL-1U1^_af.H9!HD$D$ 1HDH$(HD$D$HTHD H$0H$8@HD$(HI98tHt$(H|$@迒f.Ht$(H裒fDLHb胓H1ɺt$(D1L+H5X 'AZA[HD$8HD$7H1ɺt$(D1L+H5 ېAXAYL*1ɺH5 賐HD$m萓ATIUH-2S1LH聓t]HuLH=bAEt)1MSLO+H5r .1[]A\HcHf2H[]A\Dff.@HUH5VHӒtnH5HAEtRH5H褒AEt6H5H舒AEtH5Hl]1DATUSHGauHoHHKPHGv ǂG1LBI1HHL,0xPHSPHGDGL[]A\fHHH9H@pHhHa@HCPHE1L)LU1H5 aXZff.fATUSGHv LJG1LBtH]LZ7/xGDGL[]A\AL#1E1H5讍ff.AWIAVAUATUSHHdH%(H$1HHD$PHD$HHD$@H(1ҾL$Q@LD$HLhI} ]AƅH-11ɺ1Lo(HڌD\$E|HAuHL b1Lh H1蠌IEPAY1AZHLLK 1tH1MLO 1ɺTHIwH DE H@HPXHCPH8 H1IL 1HIw1Ht8tH@HP`HCPH8J 1ɺHIL 1誋LM1ɺH1A臋fL$H{ @LG\Aƅ f!HL$`HE1E1j1HLjj謵H T$`HC`L-w H{ D$LDH-&L 1ɺH1ϊ1ҾLOD$HCPLY&1HHsH1Lh耊A^XHCPLB 1HL1UM1ɺL. H15H1ML 1ɺHIwHt DEHHCPH8aLMGIMLLD$=LD$LhLLY4IHtLLH#IHL" H1AT1mD^_Ek11L@%HLE14HHL$1HzfDL.1ɺ1Hz,fDt$AtAHAt4HEt(1L1ɺJH5rHpIL1H(1rHD$@H@xu71ɺ*HIL1rHD$@LH@DHEt8LAt+L1ɺ$1H5ZLT$9rLT$M1H1L~,rHD$@AHA$IH@MHpjEHp AZL<A[I11.HqHD$@H811HIL LT$LHH1mqLT$1HLIH@LHH1H=n!HtHxkHHHL5. kH]HiH_D$ f.H(hAąL|$81H5)HHD$0LHD$8HD$@HD$HHD$PHD$XHD$`cL|$8D$tH5LfjD$tH5LfL1HT$0H5HFc.$LL$8BH4AUL+1L$cXZHD$ gAąL$ AAD+ tGAHH3&HNE1ɺAH1PL1H5xbXZH[4@1LH5Hlb1HT$0H5HNb$LL$8HGAUL3fDHL$`HT$@HH5{atg$LL$8H=AUL`L1ɺY1LafDH6HD$HH|$01 gH|$HIHT$P1H5HVaHT$X1HH5@aHM1t$PLDL1t$Hct$pt$pt$X(aLL$hD\$DH0Et!LH5LL$dLL$D$ $u&HL$0LL1H=#LL$8H51IEH5[]A\A]A^SfDAUATUDO HLoEuGMeIT$At$LaL QIEHPLPH]A\A]Pf.L1H5LSf.AWAVAUIATIUHSHH^HHHTH9L5]!HSH~(LUM;$$5LMPM<HHxM9LLaHI9HCLLHHADžMAD$dH-Y"M,$M9uMmM9MuLOH;HLHFbuLcE1H5 RLpHH~(HT HsLLHHH[]A\A]A^A_L5[!HIT$8HE1L%H5-A A%A к\P1RQAYAZHD[]A\A]A^A_@AT$dH-"L H1AVH5LPY^r*HGHH"H9H"H9HACL5Z!HL >X@HA1AVL\}H5;P_AXfDHWbML1E1eH5OMk1LH5AOqff.@SHHt$HH?HHT$Ht$H]HL$H9tJHC@HtgHHt_H9tZLJ1LH5-H9t9LJQnLSLP1nHXZL R!*L tR!ft DUSHH aw"bdDEtQAHp I<IL1H5GH[]fHHH9LHL1ɺ/1H5GfDH[]@HH5eAHHtH5\HFJtH5NHFHtHuYHH9LJL1UH5FKd1a@L P!%@HH5-~ HHHtFH9tALJQWLPH51FXZL P!a@L P!ff.@AUATAUHSHHHdH%(HD$1bdHH$yu+HD$dH+%(HD[]A\A]fHHtHH9tCLHL- L!1!LEKdCbt H<$HuE1L O!HHH9tDHPHtH;z8tHH9ul"HHH9HrH$L A_  HtH8HH9LOHLn1VLQ1R+DD%u"H E$HlvmdevicH9`!tDLw1ɺ/1LDWu"oH5N!;L N!qf=A`!esu=:`!3Gt DATUSHHHz8bd%Dd$E 9tBE9t;;U Cbu^A~EHK8 % 1Au)%9EtMHntL=![]A\fHluC8%HXtHz HHHHHt H9 L 9M!Q%LLPH5[1BXZKd1[]A\fD[ZfDHJHL`H5L=HC8%;E t/LH5uKd@1[D=AHHtH9u;L H!L6릐LHf.L iH!L@LH%ADIHAt fDKff.AVE1E11AUIIATUH1SHH dH%(HD$1HD$PHD$PjjjjjjQH@IHHMtHL@uVH1IUL H5Z=XZHD$dH+%(H L[]A\A]A^@AFLE1PiH1AUIH5}L<Y^HL>M1UH5?<_AX\?ff.@HAHHHf.ATIUHLSHYHHS_HtHH` []A\DHL[H]A\6fDt=ATUSHHv@Ht#HIr?HHxxvpE|t[]A\øf.HC@HtHHt H9L E!L1ɺ1H5;A$@HC@HtHHt H9L E!L1ɺ1H5>;A$AHC@Ht HHtH9uZL 3E!1LH5w:1LJ(LJhLJf.HHw 7HATL%n1 ULLSDOHE[:CH{4@Ht"SH1H<3Hkc[]A\1LL溃:1ATSHHGP;Ww/HSA CHSCHD[A\D#Aąt CL1ɺ1H5p9ff.fAVIAUIATIUHSHHdH%(HD$16A1EHc](H|$Hھ 2HHuD^9H}LL6Mt7U(ЅXIHu 6~HuL9Hu 6HT$dH+%(uH[]A\A]A^fD1H|$`W;ATIкUHH(udH%(HD$1I)H}o$HAHHD$5x EP;Uv7HgAąt@AHD$dH+%(uxH(D]A\EHU Aąt0AL1ɺ1H57DL1ɺ1H5Xg7xM:ff.fUH-f"H2u rf"][986LIWH5161H0H1$f"]fg"DATHFADHxDet DA\AL11ɺbH5|6DA\fDATSH>tAHD[A\HFPH~ HooNAąuHCPHLH5xLsH15XZAVHHAUATULE1SHLIC LkHLPAXAYIHu Ht}t [L]A\A]A^ÐImHH8IŋC )HHEH$H9HLHRL511LL5HEY^HH9LH11LL4MIMME{!2@HL 5>!RAƅfDHEHH9LHL1ɺ1L3k@HL =!11RL5LhL3L =!X1Z1LLb3MfL i=!f0ff.@HHHHHP@ LMAPPHff.AWAVAHAUATUSH(LjdH%(HD$1HG@D$H$HH9HIIuIDHH9HPH9r@uAT$DIHL$LHH~E<H}(IU(HIu AM0E4HUHƒI}MPAD$ H EHu@ELNRL PH51&HC`EL$ HsIMMEHxpIUAH$ZYlH,$H{0Lk0LH'Mu;Hu1I9t,HHHL9uHBHRH H HHL'L9t$HGID$L "LM$$L9uLL I I !H<H{0L`LpHS8LL(Lk HPHS8HH{ HC8HaMu&L9t!H@HHI9uHBH HL'I9t#fDHGID$L !LM$$I9uL I V H~H{ L`H@CHS(L(LkL|$pE1HPHS(HLcHC(H$M9H$LIHL9L>fLH)D$pHCHPH$C t DŽ$HpH8L-u1ɺQ$H-LH#L11) H5c#L_11HF#D $H$xdH+%(#HĈD[]A\A]A^A_fDomou)l$@)t$PL -!@TLH5+"L11 H5-"L1ɺH51r"E1(f.omou)l$@)t$PH$H}pDc|HtH5ĿADEtDH}@Ht$C|CxAL H54!L11 H56!L1ɺfLk8Lk0?Lk(Lk 1ɺ$LMH5>!D $$L.11H5!D $#ff.AWAVA(AUATAUSHH=XH8HD$(HL|$( LTHHEL8fE H@H=A@D`VIHHE11HuH@AHts8tLnH-1H L?L1ɺ1HH|$(E1H8L[]A\A]A^A_DHLaHD$ H,H}D0HEHHmAOH LcLKAH)$)D$uTIrL1H5M%1H$(dH+%(H0[]A\A]A^@Ll$ IHLx/HTH$HHtHII)IwILHLFHBD4 H$HLL]H,$D$ DI}L BfAVAUATUHH $HfdH%(H$1L$IHH$IHLH D$HD$!xe$Au-H$dH+%(uhHD]A\A]A^Ht$ LCxHHLLt1ɺ1H5E1T=ff.fAWIAVAAUAATEUHSHH(HtHxzI(fH@I?藼HHt_fH@I(}AuHD[]A\A]A^A_HHCHtKDsDkD#f.L011ILJ(H5E1N돃9E1LH5)g@AVAUAATIUHSH0HtHxfH0fH@H}肻HHtZfH@AH0A<$u[D]A\A]A^LHCHtKD+D[]A\A]A^1E1HDž0L"H5>땃E1L5H5m@AUIATIUSHHdH%(HD$81HGHpH$HD$Ht$ HD$HHD$(HGD$ P`HHHHH@H9HALE1E1LHIHtTHLI9t fHSLHQHI9uHD$8dH+%(uuHHL[]A\A]L$1ɺI1H5HEHE1H@Ph@C1E1LH5m{ff.@AWIAVAUATUSH8L$dH%(HD$(1rHHIHIH9u!`OAąpHH9tAH{LH#G`tۋL$ML1ɺ1H5 IIH91fDHPHHHH9utdHM1E1Q)LH5% XZL9HD$(dH+%(H8D[]A\A]A^A_ÐIIhHt$D$HD$ HD$HGP`L HH LnI~蠷HMIIHD$L9uO!ImIFELHAdžHxHGPEAąMmI9ImHE`@atHu@HHH@|uI~(HfH@ @ImIHhIHL$HPIHHIL̥1ɺ"1H5S +f.H-3L1aHy Lu1ɺ1HE1Y @HE@HtoHHtgH9tbLJH-L(1fH DLaH51E1 ]@L !LĤ1ɺ1H5KE1 (LAąL$AąAIEH@@HHHH9LJL1H5 IdžLH51E1 bLݣ1ɺ1H5d ! :-!t8HHtH5![u]H]7;wfAUATUHSHH(H$L$L$t@)$)$)$)$)$)$)$)$dH%(HD$h1C4uvD$ Ld$ If$LHLH$PD$0HHD$HD$pHD$StHT$hdH+%(H([]A\A]@Hx{fH*Y 1H yf/vYƒf/v\uH 2Ld$ @HL$A1E[HfHH H*XpHHwH ff.AUATIUHSHHHL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1If$LLHH$D$0HHD$HD$ HD$StHT$dH+%(uH[]A\A]AVAUATUHHT$Ht4G4IIHͅu;ILH WHL1AątgHA]DA\A]A^fHLH5PM+H|$!HHtIt$H}HDHuELD$|1L1ɺH5пHD]A\A]A^ATUHSHHHT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1IfH$1LHHD$HD$ H$D$0HD$StHT$dH+%(u H[]A\fDH1HH5)UHAWAVL}I1AUIATSHHdH%(HE1LHE`HH52LH1mH5>L1Aą H5wL1kAąLAU AąN;1@uh\tHDt<"uHDuHcHHD2HH%H)HH9tHH$H9uH)H@HT$HH!fHȃ\t!H@8HH;@@@"u\HAfDLD1ɺ[1H5'HEdH+%(HeD[A\A]A^A_]fAL11ZH5ͼf.L̖1ɺ]1H5f.HH9tHH$H9uHHL$HL$HHDH5L1AąLAU AągH,"H5)LPHAPL~LHH=L14AXZELIHt :LHUH5 LH1AąAL1ɺ\1H5x[fL|1ɺ`1H5P_3f.HLDH5aL1_AąCL 1ɺf1H5L1ɺg1H5κL̔1ɺa1H5L1ɺb1H5z]off.@AWAVAUATUHH $HIIIdH%(H$1HLLH5L1;AąttLL貾AąLH5VL1AąAH$dH+%(HD]A\A]A^A_L1ɺr1H5`oDALa11qH55DfL<1ɺu1H5Xf.L 1ɺv1H5(DAVAUATUSHH $HLv`dH%(H$1IHHHLtLH5pH1Aą%S(H5H1Aą>HCHHH(HǼH1H5ɼAą:ALHAą2H H; HHt :yHH)H5rH1AąHHH5WH1AąLm1ɺ1H5AP'fDLD1ɺ1H5'H$dH+%(HD[]A\A]A^DAL11H5ŶfHAąL1ɺ1H5pHeH1H&AąH5QH1AąAH5;H1bAąwCPhHCXHt HPH5(H1*AądH5H1AąAfL1ɺ1H5sf.HCHiH@H5A\HHt8u-HH;?2H533II5 f.L 1ɺ1H5f.L܎1ɺ1H5f.L1ɺ1H5cf.L|1ɺ1H5P_3f.H5H1oAąkL01ɺ1H5fDL1ɺ1H5سfL܍1ɺ1H5f.HU AąCP1҃H5hH1Aą0LD1ɺ1H5'L1ɺ1H5L1ɺ1H5̲LҌ1ɺ1H51HHHT5vѸʸÐAWAVAUATUSHH $HH $H(dH%(H$ 1IH5uIUAG(IH\$9OAG(ML9Hl$L5;I\$ HHHL$LAW $1LL AG(1HLfo ѻH5XfAnG(f89fA~G(HC@H_HHSH9JHRHH$H$H=Hu%6fDHȃ\t2HHH@0t<"u\HA1HH5L聴LAW uIUHC@twHtrHP0HtiBft_HfwVLBHH HtBML$t91H5LjL$1LH5LJHLHH;H1HiLHwH1H5ULAHLHH1*HHtHAG(PAW(H1LHaM$$L9d$:AG(PAW(1HL*AH @L$L1ɺ*f.LlH5j~AG(,1H5LIH1H LH$L-1ɺ4$L1ɺH51D $H$ dH+%(H( D[]A\A]A^A_É$LŇ1ɺ L1ɺ1H5E1뛉$L1ɺn$Lv1ɺX$L`1ɺBL1H5-E1-$L1ɺ$L1ɺ$L1ɺ'$L܆1ɺ,$LƆ1ɺ/$L1ɺ.$L1ɺ8|$L1ɺ"f$Ln1ɺ#PLálH5)=AG()H$L1ɺ<$L1ɺ3AWAVAUATUSHH $HXHn`dH%(H$H1IHW sHSHH5rL1AŅSAG(fo ޵H{ L$@LfAnG(f89fA~G(4AŅiLH5-L1eAŅZHLAŅKHH;OHHH HtH5L1AŅCtk  } 1҃ H5L1AŅPL\1ɺ1H50?)DAL111H5H$HdH+%( HXD[]A\A]A^A_L܃1ɺ1H5DL1ɺ1H5DHCPHHt:u-HHM?DH5VV0HH5DL41ɺ1H5fHCXHt HPH5 L1"AŅSxtGH5L1AŅu/L1ɺ1H5fS|xCH5L1AŅu+L_1ɺ1H53B)DHH1HL$H9tfDHH9uH5=L1,AŅLAW AŅHL%H9l$kHD$@H\$(L5`! HD$ fHD$(D$@E1HD$8H@P\$ HD$HEL``HD$ HD$0AEIH@IHH@tItHHHt$81H|$0HmEuL1ɺFH-1HL1ɺ1HE1L̀1ɺ1H5f.LȬAŅL1ɺ1H5]lSH5L1AŅLG1ɺ1H5*L!1ɺ1H5L1ɺ1H5ϥHHHTCT$ 1H5>LAG(1Lfo H5ЫfAnG(f89fA~G(U AHD$M$HLH1LAW M(t*HD$HLH1HHEHL$ H5iLHP(1HH;SHEH@ H@HtLHЅAG(PAW(|L%S1LL HmH9l$AG(PAW(mLL1kAŅADH-L~1ɺKHfALH5L(AŅHH5L1AŅL}1ɺ1H5zpL}1ɺHeH-QLf}1ɺLHOTH=H5FL1AŅL#}1ɺ1H5L|1ɺ1H5ѢH-L|1ɺSHL|1ɺ1H5zH-nL|1ɺNHlqL菨H-7LL|1ɺVH5:L,|1ɺ1H5LnlH5ԡAG(UL?lH5AG(dH-L{1ɺPHH-eLz{1ɺZHchH->LS{1ɺ]H<A1\L,{1ɺ1H5,"AWAVAUATUH(SHHxHt$HT$dH%(HD$h1HLI@H@H@ HEHHD$L91Lt$8Ld$@M?HL;|$LmIGI}LLHD$8ILLHuL%Lz1ɺLLy1ɺL1E1LeMt"IT$At$LpLHEHD$hdH+%(6 HxD[]A\A]A^A_f.DE0EHD$L%)HLH1sAŅHE(fo HHt$fnE(f89f~E(0AŅHU AŅ4Ht$HwAŅHU AŅHD$LL;I1H5SHE(HL$9O‰E(HI9tqDH{ttHsHgAHI9uHD$HI9t/fDH{WtuHsH'nHI9u׋E(PU(L-ð1HLqL%Lw1ɺ)LLw1ɺDHD$HT$HH8AŅL|w1ɺ1H5P_f.LLw1ɺ1H5 /_f.Lw1ɺ1H5/f.Lv1ɺ1H5f.Lv1ɺ1H5L%z1ɺ1HEL~vLn~HU AŅHL$L- HHD$(H;1H5ɢHRjE(HL$9O‰E(HH9L$(Hl$IHD$0IGE1H@LhpHXpHD$ LI9)HE8uH@HxHMtLt$0HmH9uMI~H|$0_IHHD$8Hl$0IE0uIHHLHAąYLL$AąSHEHHHxlHD$HHL$E1HH9JHEL$HGbAV Dd$ T$AgH$ LH$ HMfAWLH51AAYAZD9t$dHLE1ATHHLsA[Z LLR8MLP[AWkf.LH-d!9L5l1ɺ1HH$0dH+%(|H0D[]A\A]A^A_L( 8;$MH IHkHEHH &GAPLQPH51AtH D9t$1ML$H5a>H|$1HH9u-ADHT$HH9Ht$1HH9uD$HL$HD$(9L$v1HT$ID$HiLHD$ HBHhH9pE1L$ L|$@L5LT$pHD$ MLT$MH;$11MLH5a9LqLT$tJSLT$8t91MPHEH5PLj1Y^LT$l$D$9D$HEHhH9D$LE1HLLpxLL@8M1PHL jPH5t1O_AX|AL1H5A@DpA+Hi8]MH$IHHHDHAPL9SP1H c@8$HMIHTH HEHaAPLQPLf.D$]LHI.11%1H-,LH|$<AąH8HMH$IHQHAPL5HDSE1P1H mt@ATUSHHH(DEHxHD EAąu8L,f1ɺ|1H5f.HH(Hxu8C(HL1H-XPLH1HZYHpHx[HHHHH(HHpD@AąHK`AD[]A\DHK`1A1LvH5 D[]A\@t1E1LLH5m@Ld1ɺ1HafDLd1ɺ1HE16ff.ATUHH u  ~$AE`t)HD]A\"AE`uHHtH5gtHaA9HD]A\ff.ATUSHH $HHdH%(H$1H0HHHHG`LI1HLjHH}L[!Q! IH@(9E(.!AD$`RLE`u,HHH5ifHu$Lb1ɺH5,DH$dH+%(H[]A\Du1L1ɺxH5ڈ6HEfHEH1ɺLH5H0LH1LVfD1HNLa1ɺH5FfI$HtH5(eb1LvLda1ɺH5IR@j!KDHHI3$I3$H HHI3$I3$H L !Gf.AWAVAUATUSHH $HH $H(HZLkdH%(H$ 1HL/HL)IH=LxLt$1LLLMt HHEL$HT$ LLHGVAą|$ H5W[IH>H 01AUL=DLL3LHs_LAXHyAą^|$ Ut8HʼnHsLAąHs MCL1LV(HsLY^2A.f.L|1%H5dH$ dH+%(H( D[]A\A]A^A_ù1E1LZ|H5BD$LDLl^1ɺA1LSE1oA.Lt$fD\$ f1ML:|3L Lt,H^8^ML$IH}HHDH5APL:SP1H DLKL-l}L%ILH LA9:IEHAPLQP1DH L}LKL<A9MDHPH]PATL1H @ 8DEMLPL1sXZL%y|H8HL=ML$ILARHEH ЉAP*QLP1=|$,H P}$,LIDAQMPH\PSAWIAVAUATUSHHHjL@dH%(H$1D$|HEHuHD$HtHHt H9H HD$HHH9u[HH9LHHH;q@uRDIxHL$|HIH IHD$ H!AGEo D$@AGD$THID$ L5{LyH|$ LHT8RPC(Wt$(LP1M|$ H0IHH-I9/AD$<ID$(It$0HHD$0H Ht$8HT$9HD$(AHD$8HD$0DO\C(LM9LT$HHLM{LU LzLm(t$0t$Ht$0t$PP1H(C(Lj LAULzAWLT$hARLT$pP1詿H0LT$HH|$(L;T$M9LT$L LpzKDLT$G|LPC(gAUAARP15D\$`H ESAL\$0HD$LzE) LARDLN<*JD8DT$0PH)кPC(P1;L\$PH DT$(M9H}Ht$It$ jC( AWLl$(LLL{AUP1mH}H LHL$ L HE!9XXu!Hy!g!D$TE0AH$dH+%( HD[]A\A]A^A_fDH@HD$Gf.HD$(AHD$8HD$HD$0IM9MBL9|$0LS(HLxt$@ID$ H-PAUt$(RJL1:H0HCE1HX@HcH;膺HHCfC0HL$HLBK0,LHvL ^fC4H[HDŽ$)$H$H@)$H$!$)$u $ƿH$HH$LHN$$DhH$T$@HD$ HMH|$ D$@Eo I?AGHH{HHD$HsHT$H;耉HT$HCHHzeH{HHt$ DϦ豅D$TAGg@PC(LEtAULt$LP1>H HI9HD$(HPHT$L+|$K(LIHItH)HLRLFttLARLT$XP1Q 贺M|$ LT$hH II9NH LhC(LsARPL1`M|$ H ALL\$hHLL)LsHHL$` HT$PRLL)RAUARL$P1C(Lm(L L$H(LLsLU t$0t$Ht$0t$PP1訹H(C(Lt$P LAULst$pL$ARL$P1]H0LT$`L\$hH|$(HD$0Ht$XS(LH9Ht$H9I9HD$Ht$HLM)HO/L6tHLHHD$@HHHH|$ L\$8HPJDVAL ASP1ARLT$XWRm莸D$H@ELT$(<LT$XLLtD)L|$HL\$@LHD$8IωL$`LQPH)HL$8 PC(P1HL$HL\$`H LT$XJ)L9M9LICL9C(HLtASAWARt$(LPkH\L1XM9L9|$0L;T$H$ִLL1}H5x;L)HHD$(HHT$HLrLASL\$8ARC(AWt$(LP1ٶL\$XH0HD$HLME1HD$0LP1ɺ1H5x菶TLP1ɺa1H5wi.HLochPQ H}Ht$LT$(It$ ;AWLT$0LC( LARLd$(LsLT$ ATP1H}H LHL$ HT$葻;MsHC( LAWLd$@LLrATP1舵HL$@LLL+l$hH}H L(LL$LrL=L|$HM9LIB8ASD$hLqLL\$@PC(AWARLT$Ht$(LP1L|$xLT$XLM9IBH0L\$8LLm1H5v蓴XLL$L1Lli.LlH50tD*f.AW1IH5{AVIAUATUSHH7_AF(9OAF(AOLt@1L-mIL$@ILtV 9wAF(PAV(yH5uL1貳AąA@HBHpHlLc…~AGLL'H5{L9IMDJD H1AAąhAOLPDI#ALpPS1H5rE1òXZHD[]A\A]A^A_IGHr@Fd:IH JD H@dLGHPHL9HNHH5FzMD1kAą*L,L1ɺ1H5rIf.LL9JHVHH5yMD1AąLK1ɺ1H5q謱ALK11kH5mq|HVHLH5ey9H CID1{Aą:LIF`IV@H5PnH@H1oIHtiL1IHt\IF@HHHH9HBPMLu1AWH1MMAZA[DIF`IV@H5mH@HnIHL1IHIF@HHH H9HBPMLt1AWH1{AXAYMIF@HHHH9HZIF`HH@DL$HxjPAHIF`H@D$DLHx$AHIHt2DHPY^ISL~vUH@LJ(LHHq @Ha @L Q BMIHL9LHH1ARH5L%rY^HD$ HD$ HT$ H M<IH0L9'LHH11RLqH56}XZHL$ HL1HHyIF@HHHH9HBPL|$(M11ɺHAWLqA]MXMHHD$ HD$ HHD$ HD$ fL @L ٩ _@Hɩ n@H @H N@L L {L RGI7ff.GGvDSHH8Ht6H;[MIff.fgUHHXHtH}pAH]8AWAVAUATIUHSHH8LvhdH%(HD$(1~ D$ oF oN0)$)L$L9utQE1ID LLIHtH}D L褃HAtmADHs@HHoHfHH`HPhI9H¨Hp LAąI LLE1HtH@HtLhI LeH{hI9tMtAD$Ht HGH@PhLchHHu\tbAHHLHHD$(dH+%(mH8D[]A\A]A^A_f.AuƋAtH+1L)HHH Hoo^)$)\$*fHC@HtHHt H9L 1E1LegH5]H#HELH8HHsH}E L@HI(HtHHtwH9trLHH 1QLpH5Z9ś_1AXL5H5+]1E1螛yfLJL HEH$DLHxjIHS@Y^HtHH Ht@H9t;LIHE1PLNp1H5{\XZ@L  L41ɺ1H5?\跚L41ɺ芝f.AWHAVAAUATUSHHL~hDL$(dH%(H$1Ҁ~ D$PeoN oV0)L$0)T$@dHI LLHt$0 MH Ht$HD$HI H HD$HHD$ HH H$2Ht>o+osHT$`1H{hA Ƅ$)l$`)t$pjA…?AÅusH dEH|$H5ZL;,$HC@HHHH9HBHA PL'p|fM틓E ȅH 4dHHHcH HDLEL;,$H$L9HL)I9fL$$M)LHC@HtHHt H9L D$H 1WLnH5YQ1AT3D\$ H AMBL9H{@LD$I9IF1HIFD$*HC`HD$LppHChH8mBIHfH@@8@@ @0HChH85BH fH@0t$(L@@ IVIGIWHS@AG HLhL`H@H@0@ ~o;H{hAHT$` LƄ$)|$`o{)|$pνD$soof)\$0)d$@HH(HC@Ht HHtH9ujHà QALlPH5X1zXE1ZH$dH+%(,HĘD[]A\A]A^A_fHBf.H NapHt$1ɺ LD\$ Ar{D\$ H BaHtH@HtLhH 9aLhHD$HIH -a @Ht$ LD$, {D\$,Ht H@HH|$L,$H `t L+l$H `H5VL;,$ IBH9rIcH1HHH)HHEL|$J<&MH1LD$ II HMtMJL9J<&L9MI)EmLt$K6L9I)1J<&HIHt MI)J<&I9AH H|$HLIE2Hi $@HC@HHHH9HBD$HAPLi1H5rUAYAZD$hDH5OU@L$$M)H|$1LAH1Ht$HIH$LH99H)LL9@II L9vSMI)EdLIfO 'I)JL9SM1MHt$H#J<&EILhH ^HHHLI[LJWHC@HHHH9LJAVH5S1AU LOibYE1^LIDHY @HH5SMPLh1 Ht$_AXH4$L`ML :@H57SLBi1H4$蘑H4$L+1ɺ 1zE1fH5RLh1H4$HL谎H4$IMH|$E1eH8fAdH%(HD$(1D$ )$)D$w>oH~hH oV1) $)T$虙HT$(dH+%(ugH8@HF`HH(HF@Ht HHtH9u:H QE L#hP1H5QRX1Z@HB-ff.fAWIAVAUATUHSHHxLfhdH%(HD$h1~ D$0oF oN0)D$)L$ ILl$LALJ L"uHt~HPHtu@ Ao'1AAooIh LrHT$@D$ D$`)d$@)l$PDDL$ MLI HAAHt$HHtHH5,u3HD$hdH+%(HxD[]A\A]A^A_f. LLI$tHtH@Ht H@H HI)A@IG@Ht_HHtWH9tRLJ 1E1LfH5OGBfoo^)T$)\$ JL 9 fAWAVAUIH=oYATUSHH׋HHHH~8IHfH(H@@@(@8D3LhLhH@(@DpLhLhID$0ID$("8fHH@ID$@AI<$H7IH1fH@@@@ @0H?LsIGI$H$MIH5qXHtHHtHTHDH9H<$h7HHLH$H<$HPHHT$?7HHT$HHMFHEMLLD$؉H<$HXH6HHlHt$H迒HI^H}HH蓉H<$LpL6HLHH|HHMI|$IoAG ID$8ID$ M/IGID$ L8M|$ 3ftLkH[ID$8HAHL[]A\A]A^A_@L5LLd1VL9I<$E1m5L)%11 LfDL\d1H5ZH5L$1ɺ 1H5CLE1踊=H(H<$HpK5L$1ɺ7HHteHD$I1H UH#H|$-fH<$4HHHEL*$1ɺ@L5K1L H<$H1HL1LbG܉HLHHXHhH9u4f.HH9HChHs LH訓u1Ln# H5&ULQ#11tH5J4L$#1ɺ1H5&fL5wJ1ɺ^1L"L܈HEL"1ɺ2DL5JMiLUaLx:1fL\"1ɺ/1H5I?Uf.HpM1SL*aH5I XZfILf`11)H5ZIׇfHEL!1ɺ<pATf1H'SUSHH@dH%(HD$8HH1)D$H)$)D$ HD$C,H H@ Ht8tT61E1L SL`H5RHD$8dH+%( H@D[]A\fDHxH5RfAuH11H$H)D$)$HD$)D$ +HH@ Ht"uHxuAlf.L RL`16H5 RU2L QL_E16H5Q$6L RL_H5QՈDAWfAVAUI1ATIUHSHhH$H<$1Ht$ LL$L$HT$L$dH%(HD$X1)D$0HT$8LLD$)D$ )D$@E*LD$HtHx tD$AHD$XdH+%(HhD[]A\A]A^A_fHXHuDH[Htt$MLMSLHH|$HD$AXZEuL1ɺ1H5`PD $訄D $`M1LPH5%PqE1*T@AVf1AUAHxATUHSHH@dH%(HD$81HI)D$LH|$1)$)D$ (HHH HDHfAt~11H L)D$)$H\$)D$ (Ht$HH HtDHrAąAHD$8dH+%(H@D[]A\A]A^DLO1H5N4f1E1LbOH5N L{O1H5N܂V…fAWAVIAUATIUHSHH5GOH(H;dH%(HD$1HT$D$ f5tzLl$LLxLL-HHtLLHHI $H;HT$ H5H3D$ HEHD$dH+%(u)H([]A\A]A^A_fDL-;ALl$߄ff.@AW(HAVAUIATMUSHXdH%(HD$H1L$S,HrfLHH@ @',HH;HxHHHǀH1H)HHkMvM|LHq<LML|$11fLL)D$ )D$Lt$()D$0%LMHLH5 BL3,LH5L3bLH5WMLp3I|$hID$hHID$pHCID$pHI\$pHT$HdH+%(fHX[]A\A]A^A_fDHC1L"1ɺ>H5K1LY1ɺHH5K@HLL2LY1ɺLH5NKf.LD$LLD$|LHPHH$*HRH$Ht$HHEHLD$LLD$|LHPHH$)HH$Ht$H葅HEPVL|$Lc|LLpL)HtOLLHQHEX01LFKCH5@J~1,DHEXLX1ZH5JT~HEPLX1UH5I~uHEHLX1PH5I}#ʀ{DAWHAVAUATIUSLHhdH%(HD$X1L$C(HfɾLH#(HHgHxHHHǀH1H)HHUL'IH$fH@L}MEEIGpI_PLIGxIGpLD$azLHPHH$~'HH$Ht$HDIGHM}MsHELHx 7AHEEHPPH5tLooHT$X4/tMLl$HELH$yLHPHHT$&HHT$LH螂HH$HHHLl$ LA11fLL)D$0)D$ L|$8)D$@ Ht,LAHT$LL-HEHT$HPXL[Bf11LL)D$0)D$ L|$8)D$@Q Ht,L(BHT$LL-HEHT$HP`HInHIHAIFHL0L:HELV1H5FzHLE1f9HD$XdH+%(tHhD[]A\A]A^A_ù1E1L*VH5-FyzHLHH1LDUH5E>zXZqLT1H5E z3L1ɺ1IGHH5EyfLL$LT&H5]Ey@LL$LT.H5-Eyy@H$1ɺ!L\H5DH@H1Cyj)|v@AWAVAUIATUHSHH5EHXdH%(HD$HHGL|$H;LLp+`Ld$LSvHPHLHT$o#HHT$LH6HHE8HuDH[HH{ uLLLD$uLL`L #LD$HHLLH~H[H|$ HEHy3AąFfoD$ foL$0Hu0HߺEMAąLH5h,H*t>LD$LLD$FuLL`Lg"HDHt$LH.~HE@LH5lDHh*t7L|$LtLL`L"HLLH}HEHHUPH5(DH(AąjI}L BLSLD11UAj%H uMLC1ɺ9H5Bv,@LM1LRH5dBvHD$HdH+%(MHXD[]A\A]A^A_f.L%]0Ld$f.HELT1ɺH5A1E14vLM21LKRH5A vUD1E1LJRH5Au$@LM$1LQH5\AuHE8L1ɺ ;HEHLy1ɺ/ HE@L^1ɺ+:xf.AWIϾ/AVMAUMATUSHH$LD$HH@dH%(H$1HD$HHHHL$(HD$TsMHhHHDM9u`M6M9LI^HHCHxHwAąuL(HD$11Lt$PfLL)D$`)D$PHD$h)D$p1LHtH|$HT$HL'4HD$f11H/AL)D$`)D$P)D$pHD$hH AfHHH|$HL{IHfI^AHD$H8-HD$8Ht$8H|$aHL@MMMYAMAHCLHh|IxpI@pII@xIFI@xL0MpxHAH$dH+%(HĘD[]A\A]A^A_@HD$11L)D$`)D$PHD$h)D$pHHh HELt$HM,fHLE)HmHJELMH|$LLL$LL$H@LhM3IHuLHHfLhIgHGt$(LhNPXHD$ LH5q=1qY^HGt$(L-OPHD$ LH5)=1xq_AXMLLL0<@H/Gt$(E1QPLOH5<HD$ L1qXZLLD$HTLD$fL@HSIHBhIIIIIIFIL0MpH/HHD$0oHPHHD$HDT$0HT$0HI9uf.HI9kLJHt$0HT$ MALL$IxHLD$sLD$LL$HT$ uA@Ht$0LMWfHEt$(LNPqHD$ LHEt$(LcLP`HD$ LHHMEt$0LLPHD$(LL$XH5:1@oH L9M1QH5:< oHDt$(LLPeHD$ L HyHDt$0LLPHD$(LL$XPLL1QH5;n5l`qAVAUIATUHSHWDLsLkHL`LIHtLLHtILLHvJAątGH[Htn;t1E1LLH59m[D]A\A]A^fD1L1ɺH5[9m[D]A\A]A^A[]DA\A]A^fDAWHAVAUMATIUSHH4$(L$dH%(HD$x1HcfɾLHH@ HHH,HxHHHǀH1H)HH]M>LGjI}xHLH|-MvM`LH'ADžMLLD$iLLxLHwHt$LHrHLHCpAo[xAoADžHD$@L=811fLHHD$)T$P)T$@Lt$X)T$`HtLHLADžL|$8H5,LLvLH5\L\DLH5)8LBHH5q6LADžHH58LADžHT$(H5E6LHD$0HD$(2HT$0H58LHD$(HH|$0LHt$11HLfHLHH)D$P)D$@Lt$X)D$`MHt$HP Ht:tLLADžAHLǃHǃH$HC`/*ADžAHLAA/1DHEL1ɺH5e51E1iHD$xdH+%(WHĈD[]A\A]A^A_L|1ɺL!C1H55Lif.1E1L5H54ih@LG1H54h;HCpL1ɺDHT$0HHC@HHHH9LJ1E1LnHH54ehLqG1H53jUHT$ Ht$(`H f1Ht$@1H)D$P)D$@H\$X)D$`Ht%HP Ht:H tLuPjL LLSLjUHT$ Ht$(H jL LLSLjUHT$ Ht$(H  jL LLSLjUHT$ Ht$(jH UjL LLSLCjUHT$ Ht$(5H NE, H<$t H4$H\2LmxIMIUAuLL4KHExLD$8LLD$KLHPHHT$:HHT$Ht$HSHyH5HD$ bLL3H5%MDHHyHD$xdH+%( HĈL[]A\A]A^A_LD$(LLD$VJLHPHHT$rHHT$Ht$H7SH]LLX(H5#oLJf.1E1L(H59LhLL 3H5 LL1ɺ1H5KHExL961'H5hKH|$8EPH1ɺLL$HL 3H5lKEP_AXcHEhL510H51K {LL,2H5KLL.2H5JHDžHDžLL2H5;JbHML09H5SJAYAZ*LL2H5!JLL2H5IH}H5LLIM9IWHHH9u6HHH9t$L;suHHtH_tAIWM?M9uiLL@2H5?I11L2H5aIL1L2H5HLL 2H5tHLL2H5FHmLL0H5dH?HLa0LL$HL2HXZ L,2o1HDžH5GJfHLVM2 001H9FATUSHn HLe ( H} Ht*HL9t"HGHCHEHHI9uH}0Le(Le Le0Ht+HL9t#HGHCHDHHL9uLe8Le0[]A\AWfIAVAUATUSH(HT$HT$pH|$(dH%(H$1HF)D$Pfo:Ƅ$HD$ AD$`HHD$@)D$@Lo oSHD$8)L$p)$AQIPQKA[]HIHC I|$ Ml$ ID$pHt&H/L9tfHGHEH(CHHmL9uMl$(LMl$ I|$0ID$0HD$Ht)Hl$L7H9tHGIFL0pCLM6H9uHD$Hk(L{(L5SID$8ID$0HtSf I_AH I|$ HhHXb IT$(L(HPIT$(HID$(IoIHuIOIoH1Ll$8Mt$E1L<$ALLl$HD$%DAuHD$8HD$@<HMHtKID$`HLEE1LLAHHxpSAYAZAuHD$8HMH$@<HuDMDL<$EAELuAD$xEHmAD$|Ht^$Ll$f I^r@Hx I|$0HhHX" IT$8L(HPIT$8HID$8InIHu$MHt$HCHHt H9$L %N L-p1 LH$LNLt$4C1 HHH|$ LHH$LD$4H$H$DŽ$$E1$H|$Ht$HHDT$Ht H9>L OM 1 MLLC1 HHHt$H|$ LHH$H$D$4DŽ$DT$$$D!ЃH$dH+%(H([]A\A]A^A_H|$$E1L-H$H$Lt$4fHt$HJHH>H95H@H PL-`Lw,1LA_AXH|$(HLEHt$HHHH9H@Hh1LPD$1L-lAXZf.fDHt$HHHvH9mLH1 Ls H5A[LHLHHJ H|$(HL<$IIGHt$HBH$H/HH#H9LH1L%+1ɺ*LQ@D$4D$4AG@AG<u AƄ$I|$@ID$@AIID$HAIGID$HL8M|$Hf1L1ɺH5K?1(L I @Ht$HHt H9L I L1L*1ɺAv?Ht$HHt H9L yI B1L[1LHt$HHt H9L H tL11LfL>Ht$HFHHBHD$4F@F<xu AƄ$I|$@ID$@2Ht$HID$HHFID$HH0$It$H>fDEO E{HD$E11LHFLHLHDLHHt$HfHHZH9QH@H1L6PD$1L(C=Y^E1$HD$Ht$HH@HBH$OHHHH9~LH1L(1ɺ[L<D$4Ht$D$4F@F<AƄ$AƄ$AƄ$t1 MLL F DT$L X<HD$HH Ht$H$HH|$ LH$D$4DŽ$ DT$FL F 1ɺs1L<(L;jL E L->1 LL$ H$;HD$H Lt$4H$HLHH|$ LH$H$D$4DŽ$aL bE 1ɺA1L&L%;H9E H-E rHHHH9LH1L%1ɺ-L:D$4sHtlHHtdH9t_LH1L&1ɺ^L:D$4AƄ$IL D zL }D rL qD L eD H 6$H5H=D5LUL:uL-H5V9<7AUxATUHSH(dH%(HD$1@=IHHhMl$8fo^-H'zID$HID$(HdSAD$8fID$0AEAD$`ͩ-5HwID$pH .yHH xHH H57fL 1ɺI H5t6^@L1ɺO 1H5O649L]4 H5 6LE14l% 1L#H5k6E!4AWIAVIAUIATMUHSHHt H::g!u#H/uHg!H g!g!H$LοHH$HHH,E1HtHET$x9dM{I$HL9LHH D$pLgL"LPD$hP1t$hX5HL$`LjHjAW$P$D$L$H$HH0LEHe!L%e!HoHPIvI$HLH~PIHHxI$HH$H$PD$XD$hI_8AG4HtHUHt HBD$xMtAEHL[]A\A]A^A_fL$XT$hE1ʉH9PAMHL!1ɺH54_L > [@MtAEMtvI$HtmL9thLHL! 1H53H{E1+ID$IHMtAEL y= H?Ht$IHfLL$HEDI$HtL9u*L #= L 1ɺ1Lֿ2ALHf.L1ɺ1H52 f.L1ɺ1H5}E1|2HEL 1H5BD2ff.@AUIATIUHSH#c!Hc!H,Hb!LHLIuLHPIHHHH9t[DHSLLHH9uI$H9t2E1fHPHHHAH9uEu"LHL[]A\A]L1ɺ1H51DHpHb!Ha!a!HCHHE1z1L1ɺH50HL[]A\A]ÐSf HG賝tYHLK L#H !B!H1HHHHHHHHH)HH)A0AL9u˸[@Fq!AATHH5Gq!tsHHR f.HH9H<IuE1EuDA\1L*eH5/DA\fD1 Hp!H1H "0fDHyH@uCfDADA\@AWAVIAUATUHSH?#tcL-`"AE1 EeIDIcLEHHa5IH B"-LpL9uH[]A\A]A^A_HHH1L=2HuADAW@L=AVAUATUSHdH%(H$HLVM2 001L$HHFFH_ H,LHCpHHE HChoEoMHS Hs HChLM(H9t"fDHJIIIHJHIIH9uHSHsIIAIAH9t(HJH;uHyHIIIyIIHH9uAAS|H{0IIIAQHS0IAH9t @HrHHqHrHHqH9uHIQE1HAHuIy ELE(M1H}0@)A)HcAHHH~(Lf0HL Ht$H 11HD$H$IHD$0HL$ HL$HL$8HL$(EDDL]0I H-~D$lLD$`LCI LD$pAL\$XL;Hl$HE*Ma LL 6H LT$xH- ALL$PI fDLePH}HLH Ht$E1HcHHHq(HI0II L,$L-H H Ll$Ht$H5H $H pHt$ I H L-jLd$L%jH|$0H=?H|$8Ld$(ELE1D$lHD$`HD$XL\$pL\$HEH-1E1E1Hl$xHl$PLKpLL$@HtLMt I9L 4 Q1 t$Vt$8t$(VLt$Ht$pt$PWAU$W$$$APAS$APL$$ ATARURAR$($ AV%*H|$lH$dH+%(H[]A\A]A^A_DH 1HD$HL$ HL$WMIL-11HD$0HD$LH$Ll$8Ll$Ll$ Ll$(1ɺlLLME)Ƅ$EHChHt HHtH9u.L 33 1LL(1LJ+Ht7HE1H<-tA.McABHuA tJuV1Ht1LH5s`(1HfH5D1LH5/(1HDATUH(HIHtH(HHt HL]A\Ð1ɺE1LH5'@L1H5'fATL%X!UH-X!SH]L9t)HEH}HCHHP(HH$HL9uHQX![]HPX!A\H?X!ff.AT(UHH*IHtHhHELHPHL]A\Ã1LH5u&ff.AWAVAUATUSHdH%(H$1HHL-(Ga[SXHHE1L|$H9L<$fDHhC`0ĀA@L56DH1o%ADž(u AĀ~HS8H1LPL)AU A%A кP1%H HHZ5H`HH9t H9HS8HLL2A A%A кP1%AY1AZH$dH+%(mHĸ[]A\A]A^A_@A@L5>fDH4$D$HC8x H9D$8!L %I鿄L) 1R$P1w$YD^A@L5LDKTHH9tLHQL;1RL$_1AXHHtPH9tKLHL-L1L#c`a@L - y@L - 1|Hc E1K`L4$EH D{THHl$LIDI̅H E1@AHA9tc8uLD0IHH9t HtLHL +- H1L1AV9LAWt$"D{XH H= M$L{(HHJ MHxHHǀHH)HHH~ ډ~ @HH9t HtLHL V, 1LL`"1LIHl$1LLt2!DuCT1#8.!4I1PHqLPLY1!XZ|$L1LH5pIHl$_!Vf.AVAUATUSHHVdH%(H$1HHx8LNHLH HH=xI1H@LLHLL$HHLABELONEH$HD$ PAąHt$ϦL$HSD$H"HEHt H90QL * RL5+1ɺ1LLK Y^EaLcHI I$7)LLH%\R| A9EXuL=| H6| $| +f.L̹1ɺ1H5|H$dH+%(HD[]A\A]A^DHL1E1jH5S_AXfDLHQRDHHEHt H9&L /) LL1E181E1LH5@HEHt H9L ( L_L1E1tQL ( 11RL5L{L;X1ZLc1I I$#'1LL#V@LHLH@ fATUSHH0dH%(HD$(1J tHD$(dH+%(upH0[]A\DHLd$HL$HLl$HD$.HHL$ LLD$ D$ HsHtD$ ) AWAVAUATUSHH(dH%(H$1H\HHt H9L & L511ɺ{L-LC`̐C`HD$E1Hl$HD$1@HMHI HLH HLABELONEH9D$uAL9|$tvIIuH$dH+%(D$H([]A\A]A^A_HM!L I9uM$$HL!I9tI|$LHHtHHt H9L % H11AWLL~ X1ZLH*]H|$HHHGfHHt H9wL H% HL L1AW_AXf.CHHt H9}L $ 1L1ɺLsXH=U HkYC`̐C`fHD$HHH9LH~L1L3fDLHKLHkHHtH9uSL $ HL1AWL Y^D$LHLHfL # A@L # 11ɺ{L5<L Le%`LH;ff.AWAVAUATUSH$ dH%(HD$1H=@T t)HT$dH+%(H[]A\A]A^A_fD9O؉HI!HI!;Y!8IHHIu IE IEH4IEHɜIEHIExz X'HnHPHHWHHPHPHP HXH8HHHHJHH9uHPIE(Y!AE0IEA1ɺ}LH5%g1L L 1ɺ1H5Gz`H!0VHrH=֒HH IH8H=5HHxH=ÒHxHPHH(HH HLH=KX!AL%;X!LH HHHD9LcLh (DFHLxDpLpHH@XH@@LpLpHE`HEXHEhHEpHEhHExHHExHHHKHHLDH@HH@H@ HHDžHDžHDžL$$MLHHE0HsHP Le(LHHt0`LHEHHjHJHHEPL2HHBHHUPH@H9uq UHq HHt=HHH-pP H*@ aLLAULIT$At$LLaHY1Aٹ'LH5HO 1vU!L1ɺn1H5cwf6HU!HLL1ɺP1H5c5GL1ɺ_1H5c!HDžLAUH`1L!H51IE(L1ɺH5cLH $H5#H=4XHpff.@AWAVAUATUSHL&L9IIHDI\$I1LHHPIc`HC0H9ufHH9tH;XuH@LHL(HHt諡fAGM$$M9nH[]A\A]A^A_f.D11e1eAWAVAUATUSHH $HHt$AAT$AMLˉL$AAdH%(H$=- %D$ u(5RM u(ADl$ tKD$ Kf!tغH5Lr u@!D$ ; t$tt F] u5<] H=DT!oHCLL$@ML$HD$PLD$@-\ EAƅH \ HHL$(L>HL$(H=\ HLIpH;5x\ ZHteIL;b\ sXHtHAHX\  LM\ HJJ) t$@0* IL\ EL=[ M_L LP։T$( T$(LLm HHAHx6LR!ME1D!6Dt$ Eu E1ۃ vR!Hc.HXR!Dq[ H=rR!H ЋHR!Hy.L5RR!L CR!L4R!HHƒDl$ H5(EHjASH$PWLAVLT$XޑH0LT$(ABH 3d!HD\$0H=LT$(JLT$(D\$0 u HoZ IHLdQ!MD!E1ۄHyQ!HHt$T$1ɉL$Ћt$ H$dH+%(7HĘ[]A\A]A^A_@DY  ELP!ME EES Y /D$`- 9i D $D|$`Lt$`(D D ELYK!B@AL{K!&fDLLLPHH=C L  HPDD$,1HL$ _AXD$ HLD$0HD$8H5T HL$(LD$0HHT$8H8HS ksLHL o#LEHCd$@HD$PD$ H=\!IHWH\!H8I9H$H0I|5H|0HxLHH)H)HLpR LI!L$HLD$$HlLPLL$ 1<XZDH HL$H !I!1HL~L?I!Hpo3HCL HD$Pt$@|o+HCL iHD$Pl$@H' L0H HH L0H H8r$ɉ0At tAt ftLH=LL$ LL$ H Q H=Q 'SHLL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1HZ!HtxAAADHZ!HtfH_Z!H$IHD$HD$ $(D$0HD$H*Z!HD$dH+%(u&H[ÐHHyHHff.@HH dH%(HD$81uHD$8dH+%(HHDHL$HE1E1j1jj.H tD$tD$ Hc|$HHH H H%H =Ht@atpXH=8? HD$.H|$Baf.USHdH%(H$1HD$H;6HHHHH pHt~HH &HHHtax8}8Gt#HE8H;z tHHt$HtH|$uf1H$dH+%(u:HĨ[]ÐHT$  q t|$LVM-uff.AWAVAUATUSHHHT$HHX IH1f;u H{lH[HuDmtqIcHHt\I^ HtKE1L5q H[Ht3;uEIcHK1E)HLIcA9~ H[AHuHD$H(H[]A\A]A^A_ff.fAVIAUATUSHdH%(H$1IAx\LHI@`L0MA/@HL/IHI9sL)1AAHH9uLfIHt^HtTH]H9u8H$dH+%(u{HĐL[]A\A]A^FfDHH9tHLuMeH$dH+%(u+HĐ[]A\A]A^DLIHf]ff.fSH5Mt&xC!tjC!u) [ÐOC!u) [HLL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1H$I$(HD$HD$ HD$D$0'HD$dH+%(uHJf.AWAVAUATUSHXL-g: H|$8Ht$(HT$0dH%(HD$H1M/HD$8IDpXEIMHD$(1H|$0H HHL$ IHD$(H1H|8HHH|$HH$HI9s?fLDLII9uIMHD$(1H H1IHD$HHH$L9<$HD$@Ll$Hl$0HD$Dt$JfDHT$ Lt$@LH)H9HGI^IH1ILL)ML9<$LD$t$1LH|$uHD$8HHH;D$8LHD$0ZLH5oP1t$0HD$H@`AljD$XA ZAt.H\$8H=8 E1sXH1< AHD$HdH+%(HXD[]A\A]A^A_@@`Alj$A AH\$8HdtiDsXL-%8 L  @HtHHt H9L  L1E1L5H5iEHD$8HHt H;D$8tLHL  D$0H5)LSP1t$0IY^LHv$@ATUSHH $HfdH%(H$1HH|$H)$HHEa1HHuHtHLABELONEH9$HLVM2 001H9$Htfo$ Afo$0H$dH+%(HD[]A\HAąu)L1ɺ1H5fD1HHHtEaubLƔ1ɺ1H5vE1PAH@Ea6uXH=5 H@9uXH=5 H!9:f.AVAUATUSH0D# dH%(HD$(1EH=85 H?HIIHtG`t ĀPuXH4 HLHLt$H$HHD$H9HD$_AĄ|H=4 xAĄ]AHD$(dH+%(lH0D[]A\A]A^De`ADe`A A^HuXFHEH#H9LHAULcS1H5uXX;5U H=3 ZuU HT T EaE1fHHt H9L  1L1ɺpH5$WuXH=}3 xH7E`̀E`NHAHEHt H9L ' AULlSfDL  @H6OfDHtcHHt[H9tVLHj1E1LH5PfDLHLHXL q HEHt?H9t:LHAUH51S|LTY^L  fUHSHHdH%(HD$1HHt$D$$DL$$AAt.==t/HL1ɺP@=t4=tiH1ɺPH5L1'Y^CXH-fR XR VR HD$dH+%(ukH[]=tHL1ɺP1H5XZDL1ɺH5Yzf.ATUSH1IHu%U@H1HHHPEaLH8HHuID$Hth I<$LH-80 E8HH}(TH}0KLIT$At$L股L*HE HHH=P []HP P A\H/ H83"1ɿ1LH5C?H'BL+1ɺH5Cff.AVAAUIATUHSHH@dH%(HD$81Ht G`C}XItHuXEH|$LHDt$H. HD$HHD$HHD$ HD$HD$(H=~. 9AĄ.O 9EXu#uO HnO \O @HD$8dH+%(HH@D[]A\A]A^@H. H|$LHHD$(HD$H!HD$HHD$ kNHEHH9LH@ĀHHt H9L 11LH5 >uXH=d- _H0}XdDDe`ADe`A ABHS2HEHH9LHAUH51SLY^L AULS1H5?ruXX;5M H=, ZuM HM M De`A AXHE1/HEHt'H9t"LHAULcS`DL LHhL ff.@& uH=+ tf.HHt?HHt7H9t2LH1LH521HL Aff.@ATASHHHdH%(H$1HtE1DAu&H$dH+%(u=HĨD[A\DH11SLWH5_zXZaUH5\H=-HtZHH-)$u(H1L"1ɺ#]@L1ɺ1H1L1ɺH51]@ATH5H=lHtIHAuDA\f.1L1ɺH5YoDA\Le1ɺ1H52E1EATH5+SH HHHt]HAuHD[A\D#H1SDL1H5XZDH[A\H5E1QDL1S1^_ff.SH$ Hu[fDH 1SD1LsH52XZ[ff.AUH5 IATL% ULSHdH%(HD$1IH1H&HH$HIMHIAHF1BHu6HAhu\HD$dH+%(HD[]A\A]fH1ɺ.ATD1H5"L1Y^DSH11ATD1LH5XZnH-1L-D#HH1LAŅ,WD L1ATH1E1AXAYlff.AUATAUSHxND EAuJH 1HAŅ`uTD-yHD[]A\A]1L1ɺCH5E1HD[]A\A]fDDAątH1ɺUSDL@H1ɺISDLF1H5DE1WXZDH[]A\A]=HbuN=|#uiHL1ɺk1H59H1ɿLDh1H5|=tfDL1ɺb1H5AWAWLAVH5AUIATUSHXdH%(H$H1H$Ld$pH$HD$`H$H$H$H$Ld$xLd$pHD$HD$hHD$`k#~AƅLAƅ A<i 1IH f.LL+IHHtH$LxH$HHPHH$AGatAwXH=# L&Ĺ1ɺ1H5|H$HdH+%(^HXD[]A\A]A^A_ALy11H5)\f.IFHth I>LL15H5ܵAL$M>I9@Hl$HLMLd$fDHIIH9HMgI1LLHuIIGHBHH$UHD$IH$IGH$L0A$L$tI$H{L9rLH= LS?11H5۴M$ LLpHHttfIA$AF AFIHH9f.HLd$Hl$L1GH5\AL$I9t(f.IIV1LHPM6I9uL$I9t#DIIV1LHPM6I9uH$D$THD$(H$H$AHD$X@^ H$L=uHLHD$0eD$D DIAL=]Ht$0L0EAt*H1LF1AWH5-HA_X0D 1LGH5t Lt D$DD$DHL HD$D$HD$hHD$`HD$p1L9tf.HL9uPE11LIL,H6!HH;l!DT$EH|$`L|$L7H;|$t@HGIFL0LM6L9uT$LE11LtH$L7H9t$fHGIFL0`LM6H9uH|$pHL9t#HGHCH0HHL9uH$HH9t DHGHCHHHH9uA<SIH5_H\5H5HEHD$ HHD$8H{H9H$Ll$HD$0fƄ$HD$0)$)$oJT)oRd)PHjHBHD$LuH9H$I9H!MH5LLL$aL$HEhHT$H@8H%;I$HL9 H@MMH H5~LDHL1P1AW$H|$(H 1ҹL~ILL;t$ILehI$HkHISjIID$pH$HzMMtH5/LHuHEhHL$H@8H%;jI$HHILl$T$DA^APt$DL?fDH D }L^H5HLHH)HҺLE11Le11MH5@xDT$E At`H$E1H9tfDHAH9u1L31ɺH5E11HIL'HL!IUD$DD$pL @D$ \I$HL9H@MH5MLLDH1ɺPL1AWH5{$OH IL;t$xDHT$8H |HH9HD$8fDHt$(LsqI$HL9LHL1ɺ1H5Z{1I$HtL9tzLHH11AULH5{AWS|H HAd$`glH|$1LHHPHt$01aHefDL IL 93@H)rIH5b|I hL1ɺ 1H5A:L1H5PL1ɺ^1H5G]D$Dh1L1ɺH5/HXH9L(1ɺ1H5Lu1ɺXH5wH11AWLH5XZ 11LvH5h~iu 0xL^D$DYL1H5iL1ɺlH5 LrD$DHt$(HT$TL4D$DLpD$TD$D'L11H5dH$L7H;|$(tHGIFL0LM6H;|$(uIPL:D$D5HVH9D ~ E1FHD$HD$ Hl$0H\$8Ht$LIIHII9tL=HtLxHl$`H\$H9u@HmH9tH}L{uHttAFb HIƨHLHL$H@HL$HD$ SHD$Hl$0H\$8H@Hth L|$I?pLhL|$`HD$I9tL$Hl$0LLd$MIH+DHNHFI3OI3GH HmH9tt<-tL1L]LIHfƄ$I)$)$oA)AocA)gHPI9t7fDHBhHHI3HI3GH /HI9uHEHuATLASHIH VH0I ȁA1PA Ѻ?H5{1H D$Ld$Hl$0Lt$ kL$VL1ɺ1H530HEQ1AVLHIH AWH0I APA H51H D$HEAWLH5HIH H0I ȁA1PA 1x_AXD$HEHuATLASHIH HI 0V A1A P7|LB1ɺH5L1ɺK1H5L1ɺH5H$L7H;|$(tHGIFL0LM6H;|$(uL>HD$(H9$ug1ɺH5<1LIL?D$D:H $H5rH=r#Ht$(HT$XL1HD$XHD$H$H0HD$ Ht$H9Hl$8ILl$0Ll$(IVHHH9H$LxL9uHmL9t}H}LkuHthH|$Ht<-ttH=u?IIFHAHH|$pHD$xHt$ M&IFHD$xH0Ht$xHt$Ht$ HIH9t HD$$Ll$0Hl$8H$Ht$H HHE1H9tqHH9uHD$pE1L9t HAL9uQL11RH5WhHt$8H|$H|$ A[A^D$x1%ATL%11ULHLH)t=1ҾHvYHt]Xt,H]A\@1ɺLLlHLLl1]A\vfD1ɺLL]lU1ɺLL=l5RAWAVAUATUSHH $HH $H8dH%(H$( 1HH5iAHHHl$ AľL5.!1IHLHroEAAAALq1H5yVLRk1ɺ<1H5E12H$( dH+%(H8 D[]A\A]A^A_fDHl$ 1IؾL%Z!HHLr1HML1S7H5]A\E1gfDARAA L$ DH!L-!DEL9u@HL9L{HL-u|$ ML-'L11Ƀ"L P1AV{D7ZYmAfHS#eA~DAWAA L$  vIHuHIEIH/|$ LAEM}1Ƀ" P1AVL5CL"AXAYH1DZ!E 1ID$H$ H-HRHߺLO^_L$ Ht$HZ)A4t$H L$ HL()HILLP1AA[[fHMLR1S2H5A]A^L$ HDL(11t@H=!H!IEH!IEL(L-!@11跔I}LLg11LiL$ LH(t$H߉RY(LL'g11H5- Lg1ɺ1H5ff.@!H!S@!!HtwЅt !tkL1H5c[d! p B!tg#DUHЃEeu;~xu5~u/@H5PFt@]fDst3uu^~nuX~uRHH5^F]D~huǀ~u@uHH5ٿ]#FI1{LH5)1]D1L1ɺgH5]AU11IATUHAąuD]A\A]LHUqAątA]DA\A]11H5HuAWAVIAUATUSHHHL'L9 H&L9 %HL=AL9 D@ŅLfDLD9t,PH58AAUL1Y^LDHHH;!pH;!SH;!6HH[]A\A]A^A_1L"H54H1[]A\A]A^A_AL=D+Ņ,8eHMLrPH,PHP1H5H 1H[]A\A]A^A_@8A?MHjIHHDHH BcAPH5LQP1EH D;Z8A?MIHH&HDHH APH5?LmQP1H  8%A?MIHHHDHH nAPH5ѻLQP1fH DL=E1!fH!@Hi!@HI!?8xA?HMIHH bHDRAPLaQPff.AWAVI1AUIATL%5ULSHdH%(H$1IljL$HÅrjHc1LLH5 u,)LHtHxLH5*1t*1L 1ɺLľH561H$dH+%(H[]A\A]A^A_8 M1ɺPHL@`PH5ѹ1oX1ZfL-8H1ɿMPH LPL_1!L7;;xM1ɺPHL_LPkfD 8D1MPHH5 PLk_1Y^Vff.AWAVAUATUSHHLwPHwXI>蝟1IHChHHIHIDL<@HI H9HHphL9sIHDL$HxjrHHD$A[X4HHHD$IDL$Hxj:rLIXZ1L\$"ASLT$ARLaL`ILDL$Hx$qHIIDL$Hx$qHHD$Y^3AWHT$LɻIL~1LR&_1AXM9rH[]A\A]A^A_HCPHHshHDL$HxjpHIXZ2HHIIDL$HxjpY^AWATIL%1L.L_MAXL21LHCh1I>HID$DLHjD҃HpLHIHDL$Hx$oLLI41H$ AYAZ1H[]A\A]A^A_L^LHLLM9MAARLIHRH| HH9to8uHPI0HJIPH31H3QH u'IpIPH3qH3QH uADIP@HtHI@HtHI8H9J8tHH9uMM9XfDH1LY1ɺH5˿1H@AWHAVAUATUHSHLL>HD$LfI9NAFL1ۅu)A9^LIH @HHʃ:uII9t%HRHz1H9xHDL9uu(LH $iIHfH@ H $@IHDH@IEH@@HHHH9HRHEP LH5LR1uH|I?ZYIGM}IEIGL(MoA9^L@M6L;t$H[]A\A]A^A_fDH9e@1L0H5H1[]A\A]A^A_H d$H5r[H=[ܸff.UH5v{HܸAEt[H5HAEt?H5)H褸AEt#1LV1ɺH561]fATUH-SH詺HtKuG2L%;!MtHLH=BW[]OA\ u 6[]A\DHiL ǾL%!8tHMt-LH1[]A\HL @ATLL%HtHL%/tL5HH?1H 4LLHbM$I$I9I^11HL6Ee uhIFHxXH$dH+%(iHĘL[]A\A]A^A_DLDN1ɺH5,1E1$fIHMH1HѭLCU1LHL![1ɺE1LMH5C@IHRXHPX+@LM1ɺSD1ɺE1LuMH5df1ɺE1LMMH5<>fHE1#L!IH51@HHH9u 1fDS1Hf.HH9uv1[@HHtHPHR`H0sH2rHH;Zt1ff.@ATH5;UHHdH%(HD$1&3D$HtiH@ H@XHt\1HT$HЅtLD$L%īM 1L{H5ͪʱ0L1ɺ1H5L%h蘱HD$dH+%(uIHL]A\DL%;{@1E1LʷH5DA*f.AWAVAUATIUHSHHXHdH%(HD$H1HGXHD$HEH@HH@0HAH M[L=LhHELH@PHxU[H<LLHHPLXHMRIHvRIHHLIEHXI$MedIH HL:AMt I~1ɺ1H5˝ȤL=1ɺ1ALL薤ALL1nxfA1ɺ1LH5<9@E1WL=1ɺ1ALCL`L=1ɺ1H5ӜУAL.1 H5衣L=A 1LLo#KI|$Iݫff.AUATUHG`HH-H4HHH9HRB@H,HHE`HEPH8mAąHu`,1E1E1j1HjAXZE+HEPHL(HLID]A\A]HH9uH4sIfHLתI1E1H5D]A\A]DHHH9HHzHHLܪIH51象D]A\A]HHLIKH LIH5N1I@Hj(AH1ɺUIH5L1Y^GctHHH9t1HH9ut1DHH|$"Ht=HPHR`t-H2r&HH|$H;xuHf.1HfHHH9t:fHPHt HJHtHhHt ActH9tHH9u1@fAWLAVE1AUATIUHSHHdH%(H$1ILHHH=rL9IDHD$@胝HD$8HHLLI9IDE11L$|$Hu\HD$PH|$8HHHPHSHPH@HSHC_IH$dH+%(HĘ[]A\A]A^A_ÐHHVLPDL$X1H5躞XZH|$8H1f.L,GH5_~1]HLLIH5)1AHLQIH51 Lff.@HHH9t7fHPHtHJHtHRXHt AbtH9tHH9u1fH5^I AHATHHHHJHut@H w6VL$LVPM1H50Q1W*H LA\øH@vHH9H%HDIDHIIH f.ATUHSH|H5ȖH譟uEB[]A\D#ABt^H5BHt;AJu {t/1L ^H5FD1[EJ]A\f{}@1GduHHH9JLtHH IHPHt HHHH9wHA@ uHH9u1ff.GdtfHHH91HLtDHH IHPH| HHHH9HA@ u=HH9u1ÐH1L51ɺH51H@HHAWHAVAUATUSHL.dH%(HD$1I9AMLIԅHE1E11ېIH@HHpHHH9BH@@ tHHH$AL4$A;]Lr1EM4$HT$dH+%(u!H[]A\A]A^A_E1AWAVAUATIUSHHhT$ L$ DD$$dH%(HD$X1aDIHDT$ IGIEDKLED$(E1L|$H$DDD$ H@HEH4$HDED1DH H9FHLM|LCIH1LHLHRL ZH jZLHDLDH1ULD$ Hys:9ZYHt$LLs(H$AD9hLWL|$@H$HHD8AAcH\E1SpH߉T$,-D$(HCHHHD$T$,If.1DHpH w8L1fH5%L|$HCH@HHCH@`H!H"(HPHBH@@HHHt{H9tvHAHD$H$DzH|$PPT$,T$,IHlUpHT$,|,H}HD$(H$H|$HD|誓T$,IjfDH1HD$f.1 L9H5ܕL15H5Ҏ踕L|~H5L|$艕@L1oH5vL|$WQfL1yH5FL|$'!LS1`H5L|$ߗff.@AVAUIATIUSH@HndH%(HD$81D$ HD$Ht EdMIFH@ Ht0Hxpt)=f H-u I|$)2fH-(NHL>HtTڃruHUL@HIHHTHTHL)H)ڃr1L 9M 89rHT$8dH+%(zH@[]A\A]A^tMtLfL@HZ*t.HEPHHHHHx|ID$HHCLHI9fIF@tAF1 t)H-@fDMLLIt$HFPH8|HL$HE1E1jjj-H QD$EIFHT$Ht$ LH@ Ppf|$ u!|$T H-=H-ff.HATHiUSGHHHcH>HWPHBHHRH9HHfH*fHWP-HJ 1HHR(HH9gHNfH*HfH*IfDHP<G2Hk@HHHH9LEJT1I@hHDHHHHH9H1HH9HfH*HfH*fDHWPB8HJ HHR1H~fDOHOPHQHt]HI1HtRH9HpfH*HfH*^Y,=D[]A\HG@H@@GpᐅHGPHPHH+HHbfHOPQuH1t 1H9qHQHo1HdH9t/HfH*6fD&fDHЃfHH H*XfGxHfHH H*XfHȃfHH H*X{fHJHHR1Hf.I@PHHDL$Hxj<HsPIHEH6H@PHDL$Hx$q<H}HXZsAT1H5ȆSIL1蜍Y^HJHHR1Hf.HJ0H~HR 1Hjf.HȃfHH H*XfHЃfHH H*XffDHfHH H*XfHЃfHH H*XfHfHH H*X{ff.ATUHSHH0dH%(HD$(1Ld$Ht$HD$ LD$ HD$:t1LH*HL%Lt18LHE@Ht HHtH9umH D$ HMQLLKH LH}EHDº:P1舋D$ZYHT$(dH+%(u.H0[]A\fHJf.L%Ya/ff.@ATE1UHHJ!u2HE`uu H"s-DH`IHt@L`HL]A\fH!rH.rH/rH&rH'rL$1ɺ1H5臊DHW`HʄH%rH„@t f.u t Hߋ@H'A1EtHHÐHHH9AUATUH HH9t8@1 tH9HAHpt&Ht}H]A\A]a@E1]LA\A]@HF@HtgHHt_H9tZLjHLHL`L4IHtLLH؏]A\IA]LHHhs@L-A@bt9HHH9HH@&HHhg1Lz1H5ρ赈E1ff.fHHH9tYHtTHPB t HBfu-HW`H%rE1H-rL@HL@hLÐL LDE1LfAUATIUSHHFPH8HH Cd HkPHEHhJHI;H{HH/Il-LHHL2IH1HHCHCPLKHHHLHL1Hh(xrHL[]A\A]@L1IHtHL[]A\A]f.LfDT$ۉATT"ff.fAWAVAUIATUHSHmuxHFPL%ZxHH`LHLNAąBH:LIH5x1crAƃA HtjteL=Ax1ɿIL1LyHLpEAHD[]A\A]A^A_DL=w1LIL1~H}LHYAąuL1ɺ1Lu~L%"HEPHHDADHEPHH7G~*HeHLHM HLILI1}HL=vq1LIL)x1}HL&L1ɺ1LE1n}zE1ATIUH SHG`H*H-sHHH9II$Ht HH%A$H"rH!sLu]ID$` uSI$I$H9t>H$M$AAHrHNHA`EtH$rH29HH9uL[]A\ÐM$M9THI9uHH9uDA$%HJXHA`LuI$I$H9uf.HH9kHCHxtLkLIvIH5t1{HCL`AWAVAUL-htATUHSHH8Ht$dH%(HD$(1HHD$HH9¸HEHD$HD$ H$@H4$HtLd$ Mt$AIH5}M~(I<$Mvh$M]lAHK U}HE11PL'1LhzXZEa}HD$Hǀ`YXHEPH8DY EtF uDEMu (y!WI HMLJtLI1zyHD$D`EE1DHML=LH1P1!yA\A^ HLE1PL1ɺ1x^_EaH1ɺLIL1xVf{fDLz12H5v|x1ɺAL]H5LqNxHD$(dH+%(uH8D[]A\A]A^A_I<$AQ"HL1ɺIH5p1wL1LAĺwotxHD$Aǀ`HD$FHD$Hǀ`>VAąL_1ɺ1LFwH|$uAątEHEPH8D Q Et> uDE<2L1ɺ1H5ovwyAWAVAUATUHSHhLdH%(HD$X1HI9ƸLDHG`H0H2HGPmL I@e AL~HEPHm`,HH89H)Hu`,Ht$ HnHEPHL 7tHL茍Le1ɺyH5nu_HE1E1jH1HjLLl$8AUH D$  LHH5EntLMuAŅILxLG1LH,WAŅaI@I0H5HD$I8HD$I MHD$IGPH8II9}IFH/LqAŅ_E11H1LpAŅPEpAGpHEhIo`2IGhI0HtDHD$I HD$I@HD$I8HIl$`4AFT IH11LLaAŅH1LRAŅuPL 1ɺ1H5ls[L1ɺ<IH5l1sLAŅtxHpsAŅA4D6LZIH51l1E1)sHD$XdH+%(!HhD[]A\A]A^A_L 1ɺ1H5krDH[L?IxILL`AŅLHTAŅ|LtrAŅLe 1ɺU1H5KkHrHHH9H{LHEPHL ipHL辉H5ju#L 1ɺtHt$qHt$L 1ɺu1E1qfDL 1ɺQ1H5jqYfL| 1ɺ}1H5bj_q1f.LL 1ɺH5E 1q@L$ 1ɺ1H5 jqfL 1ɺS1H5ipf.L 1ɺ1H5ipf.L 1ɺ1H5ipQf.1ɺE1L] H5LiNp fL< 1ɺ1H5"ipL 1ɺ1H5horff.@HG`H0sH2szH$r;HHH9xLBXLfDHHH9LBXMuLMuʩtJHHH9`xHL@Lf.HHH9:xLBXMj[Z@E1LÐH%X fDHATUSHHdH%(HD$HG`HDH HHH9HH}cHHHEH}@*HAąWHK`H DMLEaHH!D1H"1@tLI;\t,tLI;\tD@HHH9uE9H$E1<DA4H9BLKHLzH5f1E1|mHD$dH+%(HD[]A\@LOHL}믐H<$DE1nHAfDHLOHsH1E1L|H5flXZkL1ɺ1H5el>LKHLzoff.AUATUHSH1HLoHt-H]PLHAątOHA[D]A\A]AL911ɺQH56elHD[]A\A]fD1L1ɺTH5ekHD[]A\A]fAWAVAUATIUHSHH8HHH $IHH@HHH)HH $H@HHI$HtED(Et=H3HHFH$HHH0FDHID$`HX OD$HHDHHu E$EtLH $H'L3L)H&(H$H%zE$EiID$`HHuLeID$`u H $H/L)H HL$H.L5ĄLHLEtHCLHEL1ɺL%61LiL1ɺv1Li:fH $L;L1K HXLHEtHƒLHD;LC1ɺL%V61L#iL11gLiL-aLHLD HLHD ID$`D$ĀLLHUDID$`L1ɺa1H55ohH3H&D$D$H8[]A\A]A^A_fHLHCHLHCD$ID$`f. L+H5gH1LwUH54gD$AfDH $H"L3L)H! HLHCI$I$H9opLhIE }@&HHfID$`fD L H5fH$LvZH53H1ff.Lx`M}L5M9| L|$L5fDM?M9\ IwL iuL|$HH\$LIHI9|HsLhuH\$H0LH}A8 MD$`D$I0Ht$LHMAL1ɺfH)LHAtHLHALL1ɺcDL41ɺDHLH@tHKLH@L1ɺ`L%11LdL11qLdBf.HLH>@ D$ID$`@HLH@tBHLH?t,HLH?tD$ID$`@L1ɺe#DLID$`H08tHt$H=Hu?LU]MD$`I4LI-'fLLHHAH$AAL(AoLo_EtHHLH>HaLH>~H$D$MD$`L(H`I_I(sCH1LH>L<$HCHI7p>D$M/E$L3EIM}Hn}M9H\$LIHI9HsLXeuH\$Hp}LH=ID$`t H$7A$ ID$`H7H$HHH0=1L<$HHI7{=HH;w M'HW H I$H k{HHHHL`D$HBI$f.H{LHHH IVL0LHHPIVHHtIF4H$D$MD$`L(U@IGPH1LhH5J%LAwH1X_AX|@MuHrIM9uSM6M9DIvLZuH=sLHr30A$:H,sLHI3 L1ɺfDH\$LHsLH3t2HsLH2tHsLH2fL1ɺ7L%/$1LVL11LVrL1ɺ)H5VL1ɺ2L1ɺTDL1ɺDH3HnpH2!LR1ɺH5`#7VfLLH1t'MuHpM9cLH1L1ɺ @H3HoH~1L1ɺH5"U:fLLHB1L1ɺHpLH1GLR1ɺoD$H3H^oH0D$H3HPoH0L1ɺH5!Td@LLHj0DHt$HLoHD0OID$`fL%!Lu1ɺL^TfL|$HrHL/tHrLH/uL1ɺ.1L)H5SL11H5 S[1L)H5ڤSL11H5 SH7pLH/L`1ɺ"L|$HmHL.tHqLH.vL1ɺ/L1ɺDtlM}HmM9H\$LI HI9HsLUuH\$HmLHM.A;I|$`H$I$I$H9HHxXlMuL=mM9u<fM6M9'IvLUuHmLH-xL1ɺ~HnLH-D$L%L1ɺLQH\$LL1ɺLz1ɺ2L|$HlHL-tHmLH,L21ɺIH nLH,)L1ɺ%L1ɺ H\$LLH,L1ɺvL%L1ɺLPHmLH,,Lp1ɺ(L]1ɺH5kBPL91ɺPHCmLH+0L 1ɺ+LLH+HMHmLHm+XIEH.mLH#+Lg1ɺ;HYjLH*L21ɺyAHlLH*-IE@ HlLH*L1ɺIeHlLHU*L1ɺ28HlLH(*Ll1ɺ5 L%zLR1ɺ.L;NHlLH)Kff.AVL5L,^ AUATUHH0dH%(HD$ 1HFPHT$H|$LvH1LMXZHIL?t;LH11H跶AHD$dH+%(u6H(D]A\A]A^DAL1L1LOfAVIAUATUSK1ҾLA"1ҾLD,"AD tED9tzCtX ډ Љ ‰ Љ ‰!AAAAL=]1ɺ^1H5KD ؅u[]A\A]A^ÐE11A1ɺdL]H5K[]A\A]A^fD+11L=\CH5]/KrfAUATIUHSHHHH9u/HH9t H9Xu@H[]A\A]fDHC1ɺwL-Lr\LHHC At$HLP1JXID$P ZHx.HtYf@I$@HXt_I$H(HPI$HI$H[]A\A]fD1{LL[J1 G@AUHATUHSHHH9tH9ktVHH9uiDe H}HYSATI1L[H5IXZ1H[]A\A]ËCvCH[]A\A]fDm H}IAT1ɺAUI1H5HL-[IHCHHBHY^H[]A\A]AWAVAUATUSHHLwPHdH%(HD$81HM>H9QHCH@LhMHH@HD$HHLsAąHu`Ht$HHǃhZ*AąH|$%HAąjLBIu`4L脫LL0tLA")L1ɺ1H5AGE1fHo`,HL/AądL 5v t quO !qH5HrfHT$HL)D$)D$ ,Ld$EHnELH^Aą#Hu`,D蓷LBYIH5@1E1FHD$8dH+%(HHD[]A\A]A^A_L1ɺ1H5U@oFD3gfDLT1ɺ1H5@7FyfHضL YIH5?1FC@裶LzXI f.{LXIfL1ɺ1H5u?Ef.HL-R?!LXLI1NEHCLH\AąoHصL?LI1EGHL->衵HELPL_X1DXHZCLHt\AąHQLf?LI1~DfL-E>Le1ɺoLNDHLWLI1#DH{BLH[AąDH譴L>LI1CH}LqWIH5=1CFff.AWAVAUATUSHHHoPHdH%(HD$81HEH$HH9LHCI@LhMHLhM~HLADžIv`LLHǃh$ADžAH+ADžLAHD$HLHz<I1ɺVHILmW1yBH<$L-ADžLW1ɺ^1H޿EBHt$H<$fHT$)D$)D$ $ADžL|$EHADžL蠲1ɺtHILtW1AH<$LADžLa1H޺{ILW1AL?H<$H=YIM`L1H޿ILW1EAH<$LXsLٱ1ɺHIL <1 ALAADžLIt$`4L_H')tHAeLWH1E1@DH5n;褅ADžkL!LMT)IH52:1J@7LRIH591E1@HD$8dH+%(HHD[]A\A]A^A_LT1/H59?fL9T1CH59?f.LS17H5R9l?V LQIf!LQIfLȯHEHPf1LRE1>XZfDYH1LS>HLYSE1MH5q8>ufD1HLw1oc>H|$ LQHIa16> kH1LS>wH1LS=H1LT=L/TH޿=jLS~H޿}=c@AWH@AVAUATU1SHHhH|$0dH%(H$X1H$PHHD$(1HHH|$P@H|$ HHBPHD$HHHD$@HtH+Lt$0LID$8LHHL$H9FHHQH#BH|$0HHH7HDL%66H1ɺSILS1LaLePILl1LD$Q8DL$L<1LD$'!8DL$kMMHL}PL=7H|$01-L1LO7E1D$8QH|$01e=v:fDH$HHH9@HH@HP`H0ruH%r@uuff.V9WrfDHHNH9ff.H 1H9H9~tDFF;BHLL9tAfALt)H1HRH׃:u HRR9ALwH L9uȸfATAUHHKtHD]A\@H0uHE`H&rHxHE1AfHHHW E1Hv1Hz j1jjLcH(ff.@AWEAVIAUIATEUSHHFD9F I~H;;HHAVIF9v/)HHTHHHHfHHH9uEMUPIIMI} IEPI}HP HH0\iI}H5t IEHPHH0LLMH H|HH@0IE@8H]THEGD1L[L H5zL4H1[]A\A]A^A_HHH{HH@@HtHHt H9H $>I>LHTLT$IDR0 L SVL[H5ATUWQPHSAWLD13LT$HH@Mt I}L/IAnH[]A\A]A^A_@HNGHISIEH)E1HH@0@8$ H-6LZH3H1L1ɺU 2H1[]A\A]A^A_DH@0H-LbZ@8* H12ATASHHHQH@@t"DHHBH8t1AHD[A\HQHtAHD[A\fHQHtHsD9fvD9fvHSH{EE1ɋJ MAąuL1ɺt 1H51uAWAVAUATUSHHDaH<$@EuOIH$ztA@IIΉD$ T$ Dt1HHIFH8t H$AD9`wf.E1hHHH,$H]H9u-ɐHI E11j1jjv^H uHH9tIELCH0MuI9uD$ uAHD[]A\A]A^A_ÐAM H<$EE1LLAąuL1ɺ 1H50ff.fUHHHWtFpVH99HEHFH@u!FP1F$E8NTHFXH]@Gau2FPF$EL1E8NTHFXH]fHt$Ht$FPF$tfAWH1AVAUATUSHL?Ht$I9LDtIHD$L(L9t|AGL1E1uAbf.ILtMtIuLt EuZAA9_Lv#H@HuILtMmL;l$uH[]A\A]A^A_fIEH@@HtXHHtPH9tKHZL芟H{SILV1H5.ZY1H[]A\A]A^A_H8fH AWAVAUATUSHdH%(HD$HG`H@H4DHEL6LfL+L}HLHHL)AŅuL;_t]HM`AWL#V1H5E1-XZHD$dH+%(HD[]A\A]A^A_DL+HI +M|HEPLHx(IH$HI1LH%Lx^L֌~H]PHT$LHAŅEa@LHZAŅA)@LL1tH5,H1AVLMHyH5LGU,^_ADLMHE1LLH5~P,LT1pH5R$,TL$L LHLTAV>ɹLDL1ɺJ1H5+.AWAVAUATUSHH $HfL~PM7|$HLT$1M̉L$DD$dH%(H$1)D$ )D$0)D$@)D$P)D$`fHD$ MtA$Ht8uZH›L1TI1H5*1H$dH+%(H[]A\A]A^A_Ë JTHJAHD$(= 5~HJHD DAT$tHJHD DAD$tHJHD DA|$LMHIhMtpHAHEHD H$1HFJ\ Ht$ LLTA-H=%OH| HJEH$1H|$H|$xIAD$Hl$pJ| HfHH1x9Hl NHLRI!1LRH5"(1+AUATUHSHHdH%(HD$1t1; LRGc S蝆5HE`H"rH!ssHEdHHL {}LDHLRPH5\1E1)(ZYHD$dH+%(IHD[]A\A]DLLM9x1IL$HQ@A|$L(DAD$(;AqHEPHH9Z=:QLS H511V'*LiQH5\1E1)'@L;H&MH'HH 8H蠊(LM9)0LIPE1亱H5{&OfDH'H$sI$H@p9ChI$@Aąl1L.RH5+&DID$@BHnAą/H~L=FIH51%{fHHIT$HHB HHHLIHSLO@LH>Hx (LEdgM9H% DH訕LPIH51E1$fLJ(HHXLgOIfLIP;f.LqOf.HA D$H@XHt[HMP1HT$H9ЅtGD$t@HE`DLpOH詔LOILqO&DATUHdH%(HD$1HHG`H@@uatHtwH'}LPIH51E1M#HD$dH+%(HD]A\fDӓxLOIDHHAąHE` uw@AvksLjOI?fL1OE1nH5{")fDHxttHE`tHHXdHLPIHLgOIH蘒LOIH51!o@H`LOIH51!7o$ff.@AWAVAUATUSL$HH $L9uHHT$IH$`A1p HHdH%(H$a1H$ 1p HHD$HLJ $aID$PL-DHD$@hLI L$a$atS$aHL9 I)W=8JL$a1HPL-1LNLN XZ$`Aext2C$`Aext3Z$`Aext4$`Axfs$`AbtrfHAE1HD$(DALѹ11?H5H$adH+%(HaD[]A\A]A^A_$dAYf$a11I$aLL/NBA^A_f$`Aex~$`AbtrfAHE1HD$(L$a蠏IL$aIHHp?APL?HDƒ=xH1P1AZA[H$aHreiserfsH9$`A$`AbtrftNL1LNNLJ1ɺb1LE1.uff$dAsu=GLLM11fDEH$aL>H9$at!Ly>rLHv>ALGL\$ HH}H $jLD $H}H$aHD$($LDH ^_LT$IL=FLLARL\$(11ASAXAYE HD$H5>Lp$LEPHreiserfsH9$`A$`Abtrf ILeML1l IL$aIH"H<HDƒ=EH1H$xARAPL$KP1H Y$dAzDLܵ1ɺC1H5A@$bAttH4<AAHD$(DHH} E1$jLDYLI^IR1H5N gE' $`Abtrf ILKL1fD$dARD$hA/L1LI7D1$dAsSS=!DLLbK11AHD$Hu$a $aD$aH5{?LAD$aHL$HQ4t4HMLL1RZL[]oDHH5:HT$HT$ucE|A@)A  $a-E1D=!CjLL:L11A@HH5ϙHT$$HT$u3DE1EycML1LJHH5$:HT$HT$HL$DE1Q uAAA@t/=`BdLLJ11$a h $aHD$DXEu Es $af%f=$aMD=AEM@ % $a=ALL911AD$hAL1LF/D@$aLff$dAsZ@L$aL$aM9H|$H5V8H$ADžOD=@EgL1ɺxL1A#L̰1ɺID$PHHtl>#tgH"DE EtQ *@uc=5@ ID$PHt P,tHx@P,ID$PHHLt$@f1H$aHL)D$@BID$PL$ML$HH1L׾LT$HL1HhLT$Hk HF HD$PH7H$aAHD$XH7HD$`H7H\$hHD$pLT$xtH6L$AH$$at'APH }7AHcHLPIcH$pAHLPƒ@tAH5Z7IcHtPyAH5M7IcHtP tAH >7IcHLPD$aAH0HD$H55DD$Hx4DD$ AH 6IcHLPAMcJDPEL$L$aHH}$LT$ LLjDH LT$(L4$==Iٺ]ARL(LGPL11H HHT$H5d 1 ff.fATIfLHtL`LuLA\DLE1yL>IH51LA\HHH91E1#fD u'xLv&DHH9t"HPHPHRuуuHAH9u޸tE1Et>A9tDffI*H*^Y,t=Døf.f.AWAVAUATUSH(HFPT$ Lt$hLxD$pL$DD$,@LL$H|HILhiIH-HxHHHHǀ`H1H)hHL$HKH1HIHC2D$ I]MeAE D$AE$D$AE(HD$IE0D$`AE8D$pAELD$xAEP$$A$AET$A$AH$IIIIIExIIExIIIMt*MLIN`LL6nHCĀtIl$`1t IL$`H(L[]A\A]A^A_HL貰HIH1HIDŽ$HC T$p$DŽ$C$fL|1ɺ1H5_)f.1E1Lj;H5W)@IDžLLL1ɺ#H51E11ɺ?E1L͞H5fIDžLL:L1ɺ)f.HWGLB u+BDAWML&AVAAUL-fATIUHSLHHGLHHQ1rH*SG P1 H 9]L~M |$`H[HI!M|$`rEHL`DpLH襸Aąt~AHD[]A\A]A^A_fDHL`Eur@뱐H}E1$t.ALPELL9P1LXZL<1ɺB1L#ffDL%L1E178ATD$vUASHGHLH@PHxwHtRL1HuHCLuHkL[]A\H@HHH H@H{sL 9PIH5p1@1ff.HGPwpHHGhHtsSH7f.HhHt3SpPPP$H@PpHShHPhHtHH{uǸ[L1ɺH51[øAVAUATUHHHGPL(Ax GcHLAą}HLL5dEduAHD]A\A]A^HuAąuHqL8IH51HL5qqLL#I1HLsdHE10qLLd#I1]HD]A\A]A^fDpL7E1I1H5BHD]A\A]A^f.ATHtuHHttHxA\)wph AątADA\D1L1ɺFH5DA\f1E1>L6H5YDA\AWAVAUATUSH8H_`HH|$H\$ Ht$T$H\$D$,D$(H9xHD$ H\$HHt}H@H LX6H5LHHsH1HA]A^HxhtHx辺HH`0H@hHD$H``HǀHD$l$E1LtL;|$ifIHLEA9o$IGhHt|IWHL5 H5LJHpH1I_hA[A\HHxhtHxHH`0H@hHc`HǃIHt IHt itDT$EIGH@ IHxIG@fL17IMH@@MML%uFALږ11*H5H8D[]A\A]A^A_IGH@H%8MML谘TIHO Eg$t^IH@HtN@pD9tFAG$Il1ɿL4IJH501IEg$HOfIIGHBHAwL t 1AWDE1AE;wLDL uH-La1ɺHJLF1ɺU1HE1*hD)1҉D5ÅkAG$D)AG$uAGP)AGPD)ML;|$tHD$|$(ppt D$D$,D$H|$+t$uAą`HD$HHtH;D$tt$()P$L$Ht$HFPH9hHt$VpHxHGH@H@HHtHt$AąUMtAH HD$ tQHD$HxPLhMtNAL11,H5%1ɺ%ALϏH5ffL".IH51f.AUH52ATUHSHHGP_pH8IvHIŅuIHLHH!E`۸EÉdAąt]AHD[]A\A]fup1HAąuL1ɺ1H5f1L1ɺH5HD[]A\A]ÐL1ɺ1H5E1lPATAUHHHHH9ǸHDEpEdt,9tHHG@u$H}P…t1ADD9eptHDH]A\H@uHRuHUtL@HQtHTdL@,IH51}H1]A\HH#E`uaff.AWAVAUATUSHhdH%(HD$X1H,@HHHLxHAՃIG`H&Hx~H.rwHWB@H"ND9kPO@tcII9uSLIoPAƅL1ɺ1H5eDLAƅAHD$XdH+%(HhD[]A\A]A^A_fDIGIW t8LHH@`1Ҿ8Hx踶HL|(IG IwHSPPH@H@PA9AWHx1D)譲IGI?HH9tSHtNuEDLl1ɺxDLT1ɺ1H5e7fD9kPHA(DI?HW@H2HG`H5H@H_HIGH5HP@H@`H@H3HIWIw EHAGD)FPHIuEMIHB@HHHH9{HBPL5F1ATLLe)DL$AXAYDL$ E!IWHHz@Ht)G`DLHH H L1ɺ1LL1ɺuH51E1|3HF@AOHHH{H9rLJH11QH5:L(^_fDL 1ɺCH5|@D)LDIG AG(2DDLd$@L膿~L1ɺH5f.H@@AOHt{HHtsH9tnLJH1QL'H5:)AZA[1ML$'1ɺH5HL|(L L @HHH9t$ t$ HHxt$ vAƅIG`t$ DIHSIAH9HDHB uwDBA1ҩ u HHyDDE1AąHHtQH8HhHIGPAwpDH8D)up9rE9gpEwDL6AƅAL1ɺ1H5j!HLt$ Dd(\H{Ds I\ATL%X1AUt$IL%1VLAV H HL AƅHIG`HEEEH}DCLHH\OIWHMg HM PH}LL jZYI IwHLHaRLH1ɺ1L/HAƅvL1ɺ1H5$L1ɺ1H51ɺE1LH5ҷ`Lx$H5f.AWAAVHAUATUHHH@HHЋt'.A]DA\A]A^A_HBWP1LhDpAąUP1DHAąDEHDH@HLL$ЋUPA$辬ID$HrH-1ɺ1LHE1yLu11H\/UP1DHAąL11ɺ1H5BLjDr1ɋWPAątgUP1DHAąE1DLDH`AąL1ɺ1H5µgL1ɺ1H5g:fL\1ɺ1H5m?f.L,1ɺ1H5=f.L1ɺ1H5 f.AWAAVEAUIATIUSHhHT$0DD$ dH%(H$X1HH9HD$HDHFPH5*H8UhHD$HHCsL|$(HPHH {HD$,HHHD$PH$HFH|X@HHt8HLL9t%Ht LFA@ tHD$,H@fHHHH9uID$41HD$8Ll$ EMH$L$ID$`tĀt@EDHLDDPD$LLD$ UEZYH|$ HH9D$L$ HCH@t ECLH9a|$,Ll$ >6HH@HrLD 1fDHyhHHzhHypzpQpP$PPI9HHHH9 H,HHIHuLaH5a1E1.Z@D$01LEDt$(H$VDD$L*^_uT1ɺAL~H5H$XdH+%(HhD[]A\A]A^A_fDAD$aA ADŽ$E|$(*DDgpEIHHHTmHsLE1LdLDAt$`LD$ LCAZA[<L&ID$PHT$8I$HxD$4fDLxtAD$4S$|$0S$ISPt$0LAupQAąSt$4AD% ImPIm`*EMHHҽL1ɺJ1H57 KL1t"HH@HHxs9kLwDd$4Iu`*fD1ɺE1L|H5ϯHCH@H Ll$ MHLMKHAĺAuHH5TA]A^y1t$(CPL֝L|1ɺ41H50+CLL|$@L|$HH4@HCL|$@HH@PHx肌IHKLtJHH II4HPLH H|$@HHL8HL$HHHHHHD$HHH9u̾LxH}LFLE1H5X*SL!{1ɺH1H52E1*MALQLIH51Ll$ MHLMKHAĺAuHH5AXAYLxuSVL-LLOH}LL?z11ZL&OHitH譺t L-&뱃X1L-LLyLLy1ɺ1H5߬gfHWBtWLt H:t fHRHH9tHHtHJAt̋BLfAWAVAUATUSHH(HRH$pH|$Ht$pHD$(H$DD$ HD$HdH%(H$1HHH|$(p.H|$AEHHOHIHIXHtHхHSHH$xH|$D$|$8H|$pHtp|$H|$H/0L$ t EDDD$ EvAADDCD$A A9w D$Dt EAD D$4T$4H=}L$PHH`HT$@HT$@L$PH*HHljL$XHT$PHD$@ELL$@HI,HT$P1H5D$L$XI/LL$@EwAG $`MOAG4$xAG)HCu"%)S))9ʹBAO$1H?Ρ|$ D E$h|$@T$AG@HCE(E9t'L5L1iLL$ t$DHiL$ t$D$hHALDD$8DH$`31Eo,AG0AWDCuAG$D$\$ \$t~\$|$1ɺL55LALP1SA]A^AH|$P$xSy'@,'Eo(E*Eo0\$ \$uEg0EtmHDL5L$Aw4H}jAXAYLOEO0P1ɺD$@LP17AZA[D$t$@|$4؅EA_t$\$4IG`SHITpH@HHH9uHD$H;HIGXIGPHt#HHx E1E1j111jjH 1Ҿ<HsAG<$AG1H|$ptHD$p@pEO$D9r AO(<'AO$vA)1D~#HD$xAG($AG$HD$pHtHHH9øHEHD$xIoH裄HD$HH&H\$(HH@L3L9=$IL|$H"HH!HM6L9t$(WHIVHH!HuuHR@H(HEL`H9u!f.ID$ L`H9I$H;P@uM~ MII9unf.HI9XKSLL蓣u1ɺ|LL%LrL|$LLr1ɺ1LHD$LL<L1|Ht$HHL51ɺM 1L[rLKI肂L>r1ɺ D$4=LH5/1E1H$dH+%($H(L[]A\A]A^A_HD$HE1H-LHH@H@LH(s(1^L_H1lkL "L5s1L@LuHHHL LNDIDN$HI9uȅ D$B4 9t$a H\${yAN ANʉT$D$41Av$AŅt*H$QHHFHLA9DGHH9uANDD$t AVHuI~vHD$ HM~`EDl$(E1MD$H\$ EAnHI$F At$LHAF0HHl$ HUuEA;D$ HJ@H HH H9 HRLT$8HLw P1VRHt$`|DL$T)uH LLT$8LIRHHLLHx`E^DDL$4HUHPhEHUH*Hhh EVHDEuA+F0CI$At$HsHJ@HSH HH H9 HRHPL 1VRHt$`DL$TNsH LI}L+IEDL$4HCHI]AH ID9L$ AFAV D9u|$E~0)lj|$D$DȉHH$L AFDDDD$8$\$B89sJ)H$H$H$HHH|HHtHI$H9HH9uH]H9l$(H$D$hHD$ sL$tFD$X$qH$HHTHH9KH9uHkH]H9l$(uHD$$T$B48$9D9|$\(D$$D9DL$8D|$\E$D|$\\$fAFHHLH0H9HHz0HVL>H:tjjjXH0AUAЃLENЃmHL$ 1HLJAEJD$41AEDAV AVD9AF0HL$ HLPHD$Ht$@ L]1ɿAUD\$hA~$sEI$A1EDD$4Jc|$t$9D$EtH|$G9D$$L$|$EN@D4E99DD$8ERD$ LE PHt$P1_AXD|$\\$D$8$H 1SDL$ LHt$PnZYD$8$EMLt$@1ɺI L=\L-L)\1ɺ 1LL \1ɺ L1H$VA@wPEf0L=>AD$Ht$@1L HD$EtD$L D{Ht$@1Lj >HD$@ƉD$@H$1Htx$x EF$D$l1AHD$PHH9WB$B 9;E~DAEEnHEA~0)+|$l9F|$4|$4HBHD$PH|$W|$X|$XJEF@D ADA~0LE1HH$ AHA9t9yrE1E(D;L$D$AFEFDDl$(EtAFHEF$En8ED$D$DŽ$$ƒBB࿉$ EEDHt$@1)Ll A覻H$H$H hý$$hHt$@L11KQD$0$[A~ AFD$$$DŽ$ AF<ƒ$9L$lx$k$Dd$\D$EfA~ D$lHD$HH0LVDŽ$D$u$$L$D$L$L$D$ Dd$8l$8D$$\$9l$H$HH*H\$9\$ DRHHMIVPE1Hz jDjH0jL$(H uH$I^H(H\$PHHHHH|$(H9tGLkML$M9uTM$$M9tDIt$L2uHH;\$(uD$ 9D$tH$Ho*D$ H|$PLL蛔uMLt$@H- 1H1TLR軸1L1LR 螸LR11 L聸OH- 1ɺA1LhRHMLt$@PsL$L$bDd$8;D$ vD$ HH$H$tbELD1HH$A^09XsHD9tHxuAF(4D9D)ƋD$)Љt$ȉ$D9$.wL%T1ɺ1LL|$LLpQhAG|AFT11zHMLt$HLP1LXLQZ1ɺ| DŽ$bDŽ$aaD$OH< 1QL5كLL衶XZOMLt$@1LyLrLnP1ɺ 1LU#E11HMLt$@LYL H $H5SH=SQG=16MH$:DLH9t$H1Hz BHWH9|$HugIGXMgPI_HD$HNDŽ$H|$xt $&L5tL1f L0H5Hw@HCHS0LEM LH(HHAE$ HC0C8UP1ŴA[HA_HVsMmL;l$L|$DAG4Eo,1ҾAAG4HAG0EyAG@A_0AGD\$AG4Eo(1ҾJAG4HAG0yAG@uAG(\$AG0 \$ t9ED$ Eg$H1Ҿ?D D$@x$h|$EAELC>L|$ L1ɺ LHC0L^ML|$C8JL|$ L1\Lc1ɺ6 1H57 Lm1H5Բ`L|$ L1H|$pHlHtHGH$HDL flLDHL~ PL51LRH$赯XZD)AGH\$p1Aw$HlHtHSH$L kPHRL LD넋$MAGL5~1V LL許L1LX 舱8Lb LL|$`H OH5 H=W1ҋD$$hAw$L$8A41HHDHHHHH!1HH HDHIH EH1WL5}L LA螰XZL5}L1HLLL$kH|$ZL%4fDAWAVE1AUATUHHSHHH9LEt-AHIE1HH9uu I8t<1E1LH5|软HD[]A\A]A^A_HCPH5}DL$ H80I9FDL$ tLDDL$ HIEtAD9E~LLCƉD$ NAąEt.IAOH IHBHL fDHHH j`H9uD;|$ r!`I}AIokD9|$ tAIUI1DLdAąuLH1ɺ1H5{蜮HK`ALH1ɺ1H5{E1`HEE1 PL1H5Z{,XZhL!H1ɺ1H52{Bff.@AWAVEAUAպATIUHSH H$`L$(1DD$D$XLXHD$ $h$pD$dH%(H$1wHLN(H5zfID$ZY H‹MpH E1Ʉt H}PjDLSD$ HPt$0AWAVDD$8H01ɺHLFHKpID$H‰t$(H t HƁHHt$0tĄL$L$@t AAL$L$@}p|$hD$hT$(HE1HH)‹D$(PDD$Y^AŅ> AD$R|$GHt$1HH|HL|IH5!y1T$hHݫt!H}P tH}PcLE1ɺf.H5x1E1芫^DHg,E1Ʉ1DL$E D]pES @L^HHMHLDL$1HL1ɺ1H5q诤zf.HEPDHDL$(DHHrDL$(AHH4HH9$DEL1MH5:q LMHLH5q1E1@HEPHD$HHD$EdLHH|$H5`qI9ƸLD$HD$ H3AVLHHRH HL$H\$(H\$0Dl$8Hl$0Ld$@yfHD$Ll$pLLLl$xHxLl$pUZjAD$tE1E11ɺLPD)AUPHt$@H ]HH;\$IHDHHH9^LM.HH@HUHxh11H HL$1H HEID$hA1HHA9ML$HL11H58L <1ɺ1H5of.HLIH5j1象L;1ɺVfDH7IL M`HD$XHHD$8f.HL1LI L޿11@L$;1ɺ1H5 L;1ɺ@MN(L(H5ʠDHMH1EHLAUtHMPLg HHi1DLILX:1ɺH5fmH\$`8'HL$IH51K@L91ɺ H5ٟ#@L91ɺ1H5f诟L HHLTL:LL\$xL\$tIPL\$豇L\$L޹H1LL\$/L\$L&91ɺK@L޿1L\$L\$Hf.H\$`Ld$@Dl$lHhHL$HHD$PHHHAHHEpH#fL81ɺ{1H5kH\$`ziDLl81ɺ~H5zkH\$`L;苆H}PxHEPHm`,HH8j11E1jE11HZYHEPHHu`,LLD$)H|$H|LbTHL\$PHt$LI,1}H|$0H\$(L IH5>1:.H|$0H\$( LIH51H\$(Dl$8Hl$0Ld$@L61ɺp1H5iH\$`軜nHEPHL$pE11HH8HAŅEbu|$p& LG1ɺ IH5i1RHM` L761ɺ1H5dL61ɺ[1H5"iH LcIH5h1LH\$(^ LzIH51臛{ML$HLyH5]H\$(VJLM51ɺH5/2&H}PuL\$aL51ɺ1H5hH\$`L41ɺ1H5gH\$`tg L[IH5g1萚[6 &LIvH LILL1L\$6L\$zH LʾL LI&1L\$HEPHu`,HL BHL藱L\$HL\$h Ht$L IC1蕙L\$vIPtL\$A&fDAWAVAUATIUHSH(LoPD^HT$I]EuD_tuhAD\$HLL=H$DH{Et$pjGDLHD$AYHREAZLDl }H L LLEH1HT$RAWL=ePL1uH }D\$EhET$pD9aAEDL$H{E9L\$DHDT$HDžjFL\$ H{AHDLI$$MFLHXZPDT$L=QI0ARL1U1AVSkH AH(D[]A\A]A^A_HLjHEYL^HAVLS=I+LM11_AAX됐I$I$D)H9DLUHLUTMXVASLt$(PDEPH t>ET$pC@At$pL+uh uމD$Lt01ɺ!D$LX01ɺ(L1?DL$DAWAVAUATUSHHHHD~IͅtHAąHHt CdLHHD$L9iILHDtAą`ILHDTAąfILHD4AąlILHDAąrIhLHDAąxILHDAą~AVL1ۅuuDA9^LvgH@IHЃ8uHxLHDAąuL.1ɺ1H5a菔HD[]A\A]A^A_DIFH@t M6L;t$fA]HxXGcOLHDAą6L.1ɺ1H5aVDL-1ɺ1H5`迓+f.AFLD1 A9^L3H@IHЃ8uHxHtLHD6AąuL[-1ɺ1H5l`>L5-1ɺ1H5F`L-1ɺ1H5 `^L,1ɺ1H5_̒8L,1ɺ1H5_覒L,1ɺ1H5_耒Lw,1ɺ1H5_ZDAWE1AVAUIATUHSHHLvPH|$dH%(HD$81HFHHD$(HD$ HHt DE1EAH@ H#E`uH(AąHT$LL>AąumHE`@@MEHLmHH@LhHAHD$8dH+%(HHD[]A\A]A^A_DL$H!KAL [AUH5J^L ɺLD1E1^_@LMH1LH5]АXLMH1LH5]蠐(LxtL$kLx*1ɺ1H5][fDHHPHHH9H@H@ H@XHtHMP1HT$H9Ѕt D$THLIH5\1JDL0L`HD$LHxK:HLLHHL$ 1HH`HD$(9AąHt$(H AąHHtEduuHhXH1HmAąL(1ɺ01H5\hL(1ɺ&1H5[跎?fL(1ɺ*1H5[菎f. 1E1LH5[HD$(P6fDAVL1ɺAUL-G[ATUHSFtHDvhLgPP1AVDNpLDKpAXAZAHDHcH>f[]A\A]A^fChA$slHƒH(\(HPcHHHHShA$Ep9ǃQslChA$HƒHPcHEH(\(HHHShǃDǃH55H?VELL8RPHH1P1njH []A\A]A^DSh{lstH5HRFpdHI$H9 QShKtslDKpAADAuHHt Ed"1LLҋ1L1L請[1]A\A]A^H(\(HHHShǃShH5fGA=ǃH5tHy5ShslKtA$AHƒHPcHEH(\(HHHShfDI$A$HChDHLD$HzjD(9LE=6H$L11ZYslSh_#DA$ʉAHƒHPcHEH(\(HHHShDEpHƒHPcHEH(\(HHHShAH@XPpChHЃ{ltHcH(\(HHHHShf.EpAHƒHPcHEH(\(HHHSh@H(\(slHЃHBcHEHHHHSh@DAWAVAUATUSL$HH $L9uHxE1H|$HHHdH%(H$hHFPHL$0DŽ$DŽ$HD$(HH5H9IDHD$@D$HB$HHD$82H$ D$`LH|$ HHCXHt6H9Ht$(H9SHPL5$UHHHU`ADžuHxHHl@HD$H0HH%JKtX\tSLsxM^H'HH9D$0dHLhHD$LD8H'=H}o oSHo[ oc0Iok@H)$ osPo{`)$0oCpo)$@ooH$Ht$ )$P)$`)$p)$)$)$)$)$UHCxHl$HCxH$ǃ$E1H|$NHD$LubADž|$D$HMAM9EL?bADžH$HL聪ADž {h|$Ft1ɀ|$HLLD$P@ƃ@t$HމD$H\ADžAD$d uEl|$PaH|$D$Ht$ H|$H$趩ADžK$L1ɺHt$ H|$[ADžL$`t/$$H|$Mt$PHD$IDHH|HHT$P菄HT$Pb\DEthID$`H7=DE1;D$PRH|$DH|LKSDL$PAEuHD$EL1ɺH5P1E1較@l HH9D$0}HD$HLhCtLHMt LKIH|$ILz_ADžL$1ɺ1H55PRfBDERHyHIOKHD$IfDH'sHYyoo[Hoc ok0Ios@o{P)$ oC`oSp)$0oo)$@Ho)$PHt$ )$`H$)$p)$)$)$)$)$cQH{x HCxE1ǃH$Hl$oL|$(HIDL$Hxj0HsXIIDL$Hx$/L4$=L5PNIi1L1LAHCXAYAZHqL1LրL1ɺ,1LE1趀fDH$hdH+%(-HxD[]A\A]A^A_@HD$(H@L5MHDL$Hxj.A[L[IcL1:HH9D$0ˉo#okos o{0oC@L)$ HocP)$0ook`)$@LospHt$ )$P)$`ooH$Lt$)$p)$)$)$)$)$NHCxHCxH$ǃ$M)IID$`H%D$PL$tH|$8H5ρ {$% LT$HAH|$8H5舁D{E[H|$Il$`,LADžH|$It$`,qt_ ͧuD=קED$0S$MDM1|$D$D$HD$HH|$Mf.S$@LE1=HL]t$@I1dH5J^}[]@DD$PEH|$=nt\ ʦu5զLm{H|$HHLL^1ɺ&IH5I1|D$0"H|$8H5םD[EID$PHt$H$HML$HHDŽ$LHh1L$1H$HL菴$D$d Hcrypto_LH9$1fH$")$"H$HHny$H5H=itHH$"HD$XH$HD$@H(H\$hH8wHHt_H{LT~uH{?/uH8/uHt$@xxH$(H9$uHsH|$X1ҹ~Hk'HH\$h$t$"t6L1ɺH5API1t$`LzAYAZH|$X |HHt$XH$BHHH|$XH$BHȹHH$Rf"HH9\H u݉Ƅ"\PƄ "0HƄ "4Ƅ"0H}y$D$d#{$\f.H-H|$8H|DL$H`H|$HL8XL1ɺADžDDD$0ELwH|$H,LL5~F1ɺLIL15yHt H$L1ɺh6L)tH5 F1E1x$@L1ɺ1H5Exf.{$D$0D$HH-H|$8Hn{uCHt$HZHHH9DP(E M6HHt$ H|$L1ɺANjD$P D$0H5 ED$ E[ D$EtqHD$(HL5DHH91LqVADž H|$D$4HL1AWIL%1^w^_ML$t{$tH|$8H8zdHHLDt$P1D t$0AL  DE D$`L1ɺy ID$`H%T$0 T$PHH DT$EMtL+ ADLl1ɺ@LXPD=IE0H|$LADžH|$=<t* u5D$P視LJf.L1ɺDHH9D$0fLpH5I~(rxAFHH#E`HD$@L XHtH@LH(=L5CBGLX1L1u@C$:Hl$fDDŽ$ID$PEy Il$P~fDŽ$)$H})$H$E1E11HLjjjH $HEHL5cAshDHLHx$j"D$LH-L DH$L"ELD11s]11A_LL*sH{3fH-ΙH|$8Hv SI{$ AD$c  ID$PHt$H$bHML$HH|$@LHD$H1HhaHt$@H|$11IH HD$LH5 Ho=H HD$LH5HK=H Ht$HHD$HD[hDAt$p$D\$`D)HxLjID A[1ɺIXD$XIL5^?LH P1APLL$PLrHt$XAT$pCh^_AG`)‰LHHH H !}LL$@LLPq1ɺLL 1q\$0E1 \$P+DSE DL$HEHLL8IH5a>11q|@DEHICt9HD$IMIIH9zDH(EH|$_fHH9T$0 HDLiCtELHt$ LL|$?D$HH$HH$LL HH9D$0zHo+oso{ oC0LLjH)$ oSpok@)$0LosPo)$@Ht$ o{`)$PooH$L|$)$`)$p)$)$)$)$)$>L$HCx$LǃL fL 1ɺ1H5-<nJf.1ɺE1LH5;nfL1ɺ1H5;nf.HH9T$0KxE1fDHD$(HH9M$I$I9xHt$(ChAJTHH1HIIL9xh8L5);11LMLT$LMmo#ok LT$os0)$ oco{@M)$@ok`)$0ocPH)$PHt$ ospL)$`o)$po)$oH$)$)$)$)$L1ɺH5/LZLuIH5/1bLHl$XA[!$bH11$8LL$PLLڈ+bAZA[f$bex A$X L$YLIHH~HDAP=L҂1PLL$P1aAXAYEH|$8H5du3L{4H5Lzdr $X $X{ $XL=ف߈$Xƒd$ @  M $YV H|$8H5dcs $X{HL LD$YLDʄHIH zHz uH d@HfHTHDPH= 1AWHt$PZYIH51LE1AE1 f.HH21HL= #&OfDAUATIUHSHHV`H$r3 uuwtI|$uD1H[]A\A]HHH9UHxXuHHHH9UtfHEPL(L HHtHLDj|HE`HL-i#1LIL,1 KAT$ t EaH赻1ɺ#LIL1JH舻L1ɺ#IH51J1I|$u&AL$IAD$ L-rAWfvLAVIAUIATIUSH8HHL$dH%(HD$(1)$L9t;Hl$$HCHLHxH1Dufo $fnD$$f8=) $HL9uIIL9tAHl$$fHCHLH@HxH1Dufo$fnD$$f8=)$HL9ufoL1Lf$Ht$f~ LHHD$(dH+%(uH8L[]A\A]A^A_1LUHSHH HfHhuHUHZhH HSuDHHHHHHHHHH[]@HzpHJpHHJxHHHJxHHBxH[]HHH9iRHY`HVH[]HELvH5HLHH1HH1[]EfDAT( IHHxHHHǀ H1H)(HI$ID$|I$I$I$I$I$I$I$I$I$I$I$I$I$I$LA\L1H52GfAWAVAUIATLUSHHGPH4$HxL0T$ 1L9HDh IHIG11ID$ D$LMIaLM$LE1HHLUPjjjۚH0HCU$U HЅtCL)AL$p9H|$AL$p<$U )щM${I$I9tfDC 9rC$9rRHI9uHML$H1RLHE1H5EXZHL[]A\A]A^A_DLLM$A@Lt5IpHVv9AP IpID$P(T$Hx HHfH@ H@T$@HEI?HEIGL}HEIGH(Io tAP Ip,)AP Ip1ɺUE1L}H5nDt$ E M$fD<1E1LH5O!D}L13H5&CTH |@$H5H=>@SHt[DHCPHK`@HqLKHL H51}CXZ[fSHu[DHCPHc`H{LKHL H5S1CXZ[fAWLAVAUAATIUHSHHLvPL$LdH%(H$1L9HD%L1ɺDEDEHU`H!H" H&"H'H. H/HH$H$@nHEPL$HH|$HHT$AHT$D$HD$H4PH%rH-H4Ht K( H<$$H$HHHHH9ǸHD1|H\$ LHL9uM?I9IGHxGft@u݉D$IGHx茱MLIHt$1@DT$HH L$H%Hl$ HD$LHHHuHL)11ɺ H5e?@HD$AXAYH@PHHu=@hHt$H8L<GL1ɺ H5ke?L1ɺH5 1?E1H$dH+%(HD[]A\A]A^A_fDH LϙI@H5u 1E?E1HL7IfHȯLOIfH訯L'IfH舯LgIgH`LwI?H8LIHI9|HHH$H H<$1HDH$#HD$D$VHHE`t H$H4H-s H;8 HHHaD8EUH@H1ɺzL ]LpHHt$(1=AXHAYx=D$ : H<$oL%LH$Ht @d  H<$ LmPIH= HD$H@d 0 HD$|$HUHLHH-|$H HEHEL=1b1LLP1R" L|$8HhH|$ HD$XH|$ H|$ AEHt$DL:HU`SL1ɺ 1H5tY3LMH1LH5Z3HU`H )H~HxɼD$Ly1ɺtHt$1^3DT$HDT$$LNIHL *SH@H@HH~PHt$(L@12^E1_=D$L11H52DT$HEHL HHD$HUHLHH$ <LrAS1R H5W1U2AYAZH HWHuHHU LABHԢLIHH L9HH@HD$HYHD$ 1LH5KWLHHP1uH1HD$H@PHXZH1Ht$1H*LfLa1ɺ 1H5VD1jHLjIH5X11H<$A诡Ht$=ZIL1Ƀ10?DHgLjIH5W10"HH.LHHtiHE`VH|$ VH|$ AHxp D$L 1ɺeDT$跠LIHD$蔠LݍZI2LMH11Lb H59U/HEPHHtm/tdH (HLuILk1ɺ 1H5TN/tLD$L)IHD$HU`D$OL1ɺ H5T.蓟LڂBItI~H HHtI~IxX 3L1ɺLEHH Ly1ɺ:H5^.E1Ht$g1L6.E1L=SLMH11ɿ( LL|$(Lj.HEPHH.H&NHL p1ɺ+ LL-HNIVLƌ1RH5S 1s-_AX 1LՉH5RI-oHt$LI1-E1jHt$L 1ɺq,E1EL1ɺ 1H5iR,H|$D$kLyI@L1ɺ H5R,L|1ɺ H5Qa,AWL=Q1RL 1LL|$80,HD$H@PHXZHtf4,t]Ht$HQLL7u@1ɺ LL+HD$LW LHHQ1uHKHD$QHJLӈj IH51u+Ll1ɺ H5PQ+wff.AWAVIAUAATAUHSHXdH%(HD$H1uHHtL~`I$vEEAFcIDLADžL(HHTBLH-1ɺHILI1]*AL$DHIHpADž'EL/wtSL~DDLHADžxAHD$HdH+%(*HXD[]A\A]A^A_@LuAIF`H%@H-II9upIIH93H'HH AIH9~3HHx'HH@IF`H(sqEulINPHHH9tUHfHH9t8HPHH#Z`tLcH=TH1IFHHH1LH,$HD$AąL 1ɺ 1LfDAWIAVAUATUHSHHHT$(Ll$@H|HL$HNHLタdH%(H$1Ⱥ Hs`HKPLH>IH2HZwH5LHHCPH1ɺ!ML}H#HHD$01YH^H5?VϙspLHqLHM$HD$L9u$@M6L;t$IVH}LuHt$ L}E1$![H$dH+%(@HL[]A\A]A^A_@HEHD$ HML$HsH1Ht$0LFm1A!_HAXL蓊+HH5輘HHAL$pHE11jHjjjjQjjjLL$xHP1ɺN!HLHE111LHlHHKHEHHKPHEHH(AD$pHCpHHChHAH@@au/H-LmYLD1Lm#^_L 1ɺ#1LE1fLJ(Lm#L%1LDLJ(Ln#H51xE1ANxHH9LJ(LNo%$fA~p"A~tHEHDL$Hxj荳 LNmIXZ#fHL$HH H@H $u  M~`MLHT$bHLhT$MAEa@D$$MI^XHHD$IH@H%'  MWNAEd -"HD$HLt$@a@H|$L#HD$@pA; 9L$LlMNXL-(11L:o LHM~XMPLHHHXH HCPHHF!9H|$ HuH HAvXLL5o LAYAZ*f1LcX1ɺ;$H5AyIHXhfAHEN|DWED }WEAFDIH@@u EEHD$u[Z!Lt1ɺ1H5='LH|$E1LLM H~ffDH H=* HD$It HD$ I@tAA6tH|$tHD$@dIIH $H9 H@@@u1LL肴tIo`+Ef(EtIo`,IHP IG`H-M2H$'HD$Ht @dAIIH9! HH93AV4H|$Lt$$AFDIH9$ HRB@uPLLƒ蜳t:AFDAN11LPAPEEF ?A\ZIH@H* sH|$t AGe lEEhLH|$HIGPH8sD T.EtA: (urD(E:"AM!AuIg`H|$H|$ANxLWpkA^H."H#"AV4Ht$H|$h~xH|$oLov&I1LS1ɺ9$H5EIHX1LS1ɺ7$H5 IHXLS1ɺ=$1H5fII9>L#LteDD$4L [H.AT#H5`EL"&LDȿ1"Y^HD$IH@]H*XDIIAvxAAH9ǸMMHDPL%L1ɺ>%Lw1LS1ɺ&LATHD$u<EAA IGPHHtL?tCH|$DH^LDu(Ll1ɺ&LILfP1IWHH}HIO M  HD$ H5RHxt/Lt#HtHL@L1E1&M`M MtIWHH|$IO HoL1ɺ% @H1ɺ H\$L-} L]eLD$7PD$?PD$@PDL$D1D\$DH ET$($ H$HL$L Љڈ$ ЈfLhuAF4cZAEd  L:L1ɺ%H|$@HL$AFxH9AhKHD$H@ DMN`L-.11L L%fI^`HHAHLxMIGPHHbzH|$HLaYHL*OAv`L' <@La1ɺ$1H5IFfH)D$$E1RH$IIH9HyX RAN|AE1H}[HAF|AFMjILOh1ɺ$H55LH(1H $1L$(pHD$ HL E1PHD$ LbPD$@PDL$D1H Ap%LE1HL}aE1P+$H5\1,[]=IH4IH9$HCH@MII9ID$I|$@HHH9 1HHH9BH9uDJA E1D $LLH5]_D $DEI$HHD$Ht @d11LHHt$HdHE11LL1ɺg%E1L̏H51fDH6H9u@L%L]1#Lq^Luh1ɺ%1H5yK^1ɺ$E1L3H5M$7HLlaLAW LfIIA@LH9ǸHD11d1ɺ5%E1LH5DIIH9YHWHB H%kE^H|$HD$$L}b@cH|$艈AVxAH> H|$H5%rHD$H2H $IFOLL1ɺ&%La$L`IH51E1LNE^D$$EuWAEd tIH92H H|$Lg I1H9HDF IHPH Lvb1H5Y1ɺk%E1LH5L%11Lc%LIGPHHobH|$HLǾALc%Lat xpH$HL$L Љڈ$ ЈKMN`1L1L$Z M~`HL諙H:HXH-HCPHHH|$ H H˽LKHLE1LZ ^qH)ILJ HD$MGHLLD$HPHD$HH$Hx踘 HH$Ht$H~IFhHD$A1ۉG@AGDHHAF4H|$LymsL^Lja%IL%t1LA@H*jAH}H5кmHD$HH $AF( L1LXLH(H1LYM$AQH5_AXL8]Y$LYIL]LC>jIH5@1@=AH*H,H|$LIG`b Iw`,H|$5Ht$Lc6HH HL1AAAvxL9MMHD? 1HIVL%Lb1ɺ&L\HI9HLLhu LHB%L H|$ LB1ɺ&1LIGPH8U_=t% _u^5jLH|$HUL5[LbLI&1bMILI-AGe@LH|$H#LZL`b&Ia@L1ɺ %1H5LJ@1ɺ%1H5϶HL?LS" LI1ɺ$E1LdH5~UhHILX$H5OL%C1ɿ1LL?%IL#oAF4H|$LS_LcYL\%IE@HMLUS$CQLLYR$$HXIHD$HHH9HGHP HHHvAT%L[1PMNP1H5XZ1ɺ$E1LρH5LL02HHL%1ɺs&1LL}LW$AV4H|$LQgKLWL=G&IL%L1LH,H|$LIG`]L%L]9&LWAL <H1<L=T&LDhIEPLH8HD$8]wHT$8LU4HD$8HPH8L:艐 IH9HLI9VSLqTAWI+H5 1AYAZL1ɺu$fL{HLTLhHD$LHxo HHtLLH9HINhH@(L'P1AEH PAUd]HSHB Ht[HHtSHH{HIDHj(Hj(QHh(Lb(Hj(?UIH&'PLH1H5u&XAEZSLb(Lb(IHP HtHHtH Hh(H{L%&ATLIH4%LfGP1fEPUZYdDETHSHB HtyHHtqHDIH{=HL)GIH#%AULATP1EH PUdCDLj(f.IfDHSHB HtHHtHDc@I DLj(H{=HL{FIAUHFATH5#P14H E[]A\A]A^AUATIUHSHH]8SH}HG`H=r }HHUHB HHH HH}HDmHXLJH1ɺPLCH5:1_AX_L ML 8տI$HtdL9t_LJH1ɿPH-M:1LBH*YL^1ɺHLZL f.AWL=HAVAAUE1ATIU1SHh._}Cըtv:fDAtfH1AATLBLE1AXXZLɼH9s4OAHHPq:t:DDfDHD[]A\A]A^A_fDHLAATLA1E1̾Y^oDAWIAVE1AUL-*ATUSH8HdH%(HD$(1HD$$H$H9|2fDAAGbaHC@ AGf HHT H H#P`UIW`H0@fH{HH9t2HR L HPBIGPsTH8YUH{HCGgHUHP HeHHYHH{I.HL@IH9ATLP1AV%D$DPT$DH d-HH{HCGgHP Hi,HH],HH{Hl-HL?IH@UPAV@D`E0HIW`HT1H-aDHHCEDLE7HPtvHP HtHHt HHHh(H{,HLI?IH7UPL1AV׻D$DPT$DH dHCHXtvHP HtHHt HHHh(H{9,HL>IH7UPL1AVWD$DPT$DH d_HCH{GgHSHju AGfH@H"@bu{HB HHHHHH{x+HL>IH6UPL1AV薺D$DPT$DH dHHHtHH9t [H9txHCHP HHHHHH{*HLh=IHN>UPL1AVD$DPT$DH dHSHjzLcH56L$HT$I|$H.HT$L$H&A1HB Ha"HHU"HLcHH"HP Ht HHnHh(H{)HLn<IH4UzPAV1LD$DPT$DH dd@{LE1uH5pD$$PT$$dI_`H@@HH'sIoHH5H0Hn)H/sI_HH56H H)AtGIIH9;'1HHHL9H9u9'AGaM)T$$f H9-DHHtH@@HSHB HHHHHH{_&HnL8IH0UPL1AV}D$DPT$DH d Ht AGdHI#G`uHH{H#G`H{LuH8!HB HtHHt HHHj(H{%HL8IH2UPAV1L蠴D$DPT$DH dHHHHtHH9t ]H9HCHP HVHHJHHAHt$$H\kLHSHBHHttHB HuHHiHHH{{$HL 7IHa9UPAV1L虳D$DPT$DH dHC@IW`H%%H$svHCHP HtHHt HHHh(H{#HLq6IH9UPL1AVD$DPT$DH dIGPsTH8df HCV @IW`H$BH%HH"Bd Y! HHtHShHt)HJ`H$!H@AGc@{LuH8#HCHP H+ HH HHH{w"HL5IH0U&PAV1L蕱D$DPT$DH d1H$/ x&HCHP HtHHt HHHh(H{!HrLv4IHf,UPL1AVD$DPT$DH d HHHSHB H HH HHH{^!HL3IH+UuPAV{HCHP HtHHtHH{IL`( !HL3IH3ATLP1AV'D$DPT$DH d/L7HCHP H HH HIH{ HL3IH3ATLP1AV蜯D$DPT$DH dHPHCHP HHHHIHCHP HtHHt HIL`(H{HL`2IH*ATLP1AVD$DPT$DH d4Hj(HSHB HtHHt HHHj(H{KHL1IH2UwPAVhDCLEH;k$CLB@2H{XtqHB H0HH$HHH{UIH*LPL'1֭D$4PT$4]HSA\dc H{pJ HB H HH HH HP HtHHt HHHh(H{HL0IH))UPL1AV0D$DPT$DH d8DLHCEHP HHHHHH{HL0IH(UPL1AV訬D$DPT$DH dHCL DEtvHP HtHHt HHHh(H{HL/IH*UPL1AVD$DPT$DH dHCHH9HH{GaHP H8HH,HH{H[HL.IH*UPAV1LyD$DPT$DH dHC@HB HLHH@HHH{HLd.IH"/UPL1AVD$DPT$DH dHSHjHHDEUHtxHP H9HH-HHH{,HL-IHD)UPL1AVJD$DPT$DH dRHCH{htxHP H<HH0HHH{HL=-IH(UPL1AV˩D$DPT$DH dHCH{`HP HHHHHH{*HL,IHa(UPAV1LHD$DPT$DH dPHC@ D`E DdE$ ( , 0 4 8 < @ D H L P THPH)s-AGc ,HHRHuBc@HP0Ht|HP HAHH5HHH{HMLy+IH"(UPL1AVD$DPT$DH dHCHPHt {L DCTEt|HP HHHHHH{@HVL*IH'UPL1AV^D$DPT$DH dfHCHPuHHBH4HP HHHHHH{HL**IH'UaPL1AV踦D$DH @nHJ HH HHH‹CLHh(6Hh({L`(}HB H HH HЋIH{HL5 IH"ATLUP1D$DPT$DHSH dCLBHP Ha HHU HHH{KHL(IH#UPAVHj(HCHP H HH HHH{HL|(IH UPL1AV D$DPT$DH d" HB H HH HHH{sHL(IH UPAVHP HI HH= HHH{!HL'IH"UPL1AV?D$DPT$DH dGH{HCGa[;L`(Hj(-Hj(>Hj(Hh(H{HL'IHE)UPAVHj(H{ZUIHa LPL}1~D$4PT$4AZHSA[dHCxH9Cx{L1E1Dt$L|$AEHD(D`pE9PHB HHHHHHHD(D`pH{HT$HLHT$IHLR8ATP1訢D$DPT$DH dCLAHSA9DHH,IHH (9t|HB HHHHIH{ATLI3H L P1 D$4PT$4Y^dHHSH (HIAdEHAHD(DppCLA92HDt$L|$H.&D$1L$@IJ4!( 7 HB H HH HIH{ATELIH+L P1 D$4PT$4AZHSA[d HjDHB H|HHttHIH{jAT5LIH%LP1荠D$4PT$4A\ZdHHSfDLb(Lb(HR([HP HtHHtHH{HHh(HL`#IHUPAV1LD$DPT$DH dHB HtHHt HHHj(H{YHL"IH'$UPAV1LwD$DPT$DH dHSHjL`(H{HL"IHATLP1AVD$DPT$DH dBHSDt$L|$HjHB HGHH;HHH{dULIHLP1舞D$4PT$4^HS_d{HB HvHHjHH{H]HP HHHHHH{HLU!IH#UPL1AVD$DPT$DH dIW`^HCHP H0HH$HHH{DHL IHUPAVHP HHHHHH{ HL IHxUPL1AVD$DPT$DH dHCvHj(Hj( HL IHUPL1AV諜D$DPT$DH dHSHj(Hh(Hh($Hh(HHB .@uHHu kuHk8Et{HCHP HXHHLHҋk8IH{ HLIHYATLUP1衛D$DPT$DH dmHt$$HlkHv'H{HCGg HWPiHCDcLHPD@HHZADt$1|HB HHHHIH{ ATLIHPL1詚D$4PT$4Y^d;kLqL$@HIL8t}HCHP H HH HIH{ AVLIHLP1D$4PT$4AYAZd HLHxGatHC@e? HSHB5*HHL8HSBeHx/HCHP HHHHIH{ ATL;IH!PvHP H HH HH HP H` HHT HHK IHt(H;<$t"{AHtxLuH8uL9xtH-LIH UPL1AV\D$DPT$DH ddHC)Hh(?Hh(IL]H5D$$PT$$d|IٹLWMOH1LH58譌D$$PLp(Q"HCHP HHHtyHHH{HT$ HT$LIH L5RP1*D$4PT$4_AXd=HSDt$HjLb(HP(HG`HP HHH HHH{oHLIHUFPAV1L荋D$DPT$DH dHCHP HHHHHH{HBLIH UPL1AVD$DPT$DH dHCWHCHP H:HH.HHH{qHLIH U*PAVVL`(6HP HHHHHH{H\L IHl UPL1AV4D$DPT$DH dE1EHT$dH+%(H([]A\A]A^A_DHML$H1VL( LQAU胁E_H AdHSEDfA9j(FfHHH911H9XH@H9utx}LJHAU%At$HL 9fDpHML$H1AULL 讀XE_ZAdEfDHBHML$HLL AQPP1AUaE_H Adjf.1M9M9M9M9h1M9AtM9eXJM9=IMAF9t\D\$HAu L- RAU$ML$HR]VqHP1HD\$8H0ACAdAIMHHH9uQHH9DI9uM6I9[I$I$H9:L-bI$H9BhtGML$HD\$L AQrHx1L~D\$Y^ACAdAHH9HC8HPuHHtHH9tI$H9x`tML$HD\$L AQrHtfD=HQHAE$D\$HAM ML$HLW AQRPQRVoDAU AE$D\$HHLIHAt$HLd йP1Rm}D\$(H ACAdAf Gpt8PLOH31jL|H5V}XAZBHHHT$H5xE1ۃu5ML$HLx11:D\$H5}D\$ML$HL`1<H5Y|AI|$HHT$D\$H5wD\$iML$H1L<D\$H5g|D\$ACAdAqQff.Hz=@tlA'AtA uHfDAt1L!1ɺH5L}{HHfDUSHHtiHHnH_HHHFHH0HHH}hH9tHtCHt HGH@PhH]hH[]x ff.ATUHSHH0HdH%(HD$(1HFIHBHHFD$ HWLoHp@)$oH)L$HRHRXH~Ht!HpHC LH@H@XHx趄HCHmH@H}hH@XHXH9tHtCHt HGH@PhH]hHD$(dH+%(u H0[]A\}ff.AVIAUIATA1UHLSH?HHIIH9uHH9HSH9B@uL\t[1]A\A]A^fDH{\uHL\HHHCA)A+A+[]A\A]A^@Eu[H}1LHHtAHHH9u,@HH9t HJH9A@u[]A\A]A^HAM1LdH5y~xX1Z[]A\A]A^ÐAVIAUATLUSHI9EL1ۅu@9]LH@HHЃ8uH@H@H@@HtUHHtMH9tHHRIvI>1AŅu1L1ɺH59yw[D]A\A]A^fHɁHmL9IA[]DA\A]A^ÐATUHSHHHdH%(H$1AąH1ULhHLH|=XZu/AH$dH+%(HĠD[]A\HH}txIٹ!1LH5xv럍@A,HHcH>fLy1H5\v@IL^1E1H5w.v(fL1H5@uf.AL1H5 uiL1H5u?L1H5luE1L)H5@u&xfDAWAVAUATUHSHHH_HGH9t:f.HCH@0HtHHAąH}HHGH9uLPLPAL5&vM9u*H}1HZVrM?M9I_uHC@HH5HH)H9 LJH1LQL1ɺ*tHEH{@H@HH8HCpY^HpPHC@HtHHt H9L }LL1E1sM?M9"H(\HEH0H "LEL1LLBsHD[]A\A]A^A_L I}@HC@HHHHH9LJH1LQLuE1rXZ2@LJH?[HEH0H!L=;LL<11[rA1ɺLL= 5rLEL 9|!@L-zs11LL qL1LLkq~L 1ɺ1Lqff.AUIATUHSHHdH%(HD$1HHt$~tP$9Er@A A;w\HD$dH+%(HD[]A\A]f.EAL 11H5_rpfHtKHHtCH9t>HRRME1PL1H5rpXZWHzrsfAUATAUSHdH%(HD$Hu"HD$dH+%(HD[]A\A]HHHtH5 ktHHAH9tL-]qf.HH9tHCuHx@H/tHKH$HH9sHI@Ht>H1Ht6H9t1LNRL1PL1E1koXZL yyBrfAW L AVAUIATL%pULHSHLdH%(H$1D$\nHQD$@HLD$DL|$HI9t_Lt$THCD$TD$XHx@Ht-Ht$XL{tD$TtL$@9QHL9uD$DHL$\IIHL$HL$THL$ HL$XHD$0HL$(H9r@HCHH@@H@HH4H9+LJH12LQL mXHCHZHT$Hx@KHCHT$ D$THt$(D$XHx@zt$@t\D$T9tTtPHUuD|$DEHLr1LPDL$PC1mA]A^f.L{IG@HOHHCH9:LrLmHEHM1ɺDLHD$Ll1Ll$lAXLAY(I IHfH@ @IOpHt&HϺHL$H5 8hHL$HMMQLL1#lY^HCHH@@HHHH9LJHL1LQLE1kXZ6L u@L5u@L&PH $IG`H;At|HMp(L]*@HCH@@Ht;HHt3H9t.LJLC1ɺ?1L濄kL )u= ut#IG@HtHx8˂ LLLL$8?hH|$HPHHT$Y HHT$Ht$8HqHLIGpoAOxoAIAH$ALJHxHGPPH}1LHHH|$HHH9HHH94HrH9F@uLl$`@LL:HMAULlfDMLL1HuiOMLL1WMi'L<1ɺT1L#ifDI@HL1HMLdM~LLhf.H|$HfH H9t8HqHHFI3I3GH uHVHFI3WI3GH H H9uȋt ;H|$L](vAHH9M}LHXAH$H@HHXHHfHPHHI9H9uHH;\$0HAHt$0Hd H$dH+%(HĸD[]A\A]A^A_AHCH@@HHHH9LJ7L1L g{fDIGpML1jLfL1ɺ1LE1f 1ɺLLfD$`L pI@L pt@HD$@L9HLE1PDL$PE1LfAZA[D$DHMLjLnP1eH HVHPH1ɺLLe~PMLMH9\hff.AUATUSHHHGH@@`ItfHbH{LhL HLLHkH{H HTAAŅAHD[]A\A]DH L H+I9uHEHI9tHHsLguHHCHBHѐ1yE1LLH5eRdHD[]A\A]@H1ME1LH5e dXZ"DHM1H5LeL<cY^AUIATIH5USӺHHp_tAD$`t4AHD[]A\A]AtBI9X t6AL+1E1H5ydcvALgDAL1H54dE1bHD[]A\A]ALN1E1H5cvb=)AٺL11H5cBb:ff.fATUHSHH6{ LtfCLtNHEh@`tA[]DA\HSHCHu{HCHt~H=vL1E1H5baD[]A\ALi11ɺH5bLaD[]A\@Ht HvH{HCAoDAVfHAUIATUHH(dH%(HD$1)$Ht$HH=HD$$ IHH0tID$`I}hHIDŽ$ADŽ$ HGIDŽ$AD$PADŽ$dP`HHxLDI|$HGH@H@PHt LЅt)HD$dH+%(H(L]A\A]A^fDL5ZaI/LmL_HtK}#tEL-ێtɚ 7CMtAD$,HL0tLE1聋3@1ɺ6LL5-_L5`ILML_;L5b`1ɺ1LL^L52`L*1(L^@I|$@AD$,Z[fD;QaAUHATIU1HSHHHu-HH H)L9HL1[H]A\A]HIDI)$HjLLv =_IAX1H5)_L@1]HH H)L9hHH{$DjL H{H$DI$L H{L$DH$L H5Q^IXZAUU1LE\Y^1H[]A\A]fDAWIAVAUATIUSHHt$T$ dH%(HD$81m IHL24 l$ +l$LAA))D9l$DL0^1҉)9wпI4ًtDDDI4 Ll$щH1 L LYLLH3 JL3H5\`[LLE1 HD$8dH+%(HHL[]A\A]A^A_úH5Lx3 IWIO0L H5k\HHH  PD$IG0PDL$1AG8ZXZgL1H5\0L1H5[qZLEA]AWAVAUAATUHSHLGIHIpH9sH1fDP HH9u1H9tDH H9uI@(Ip(H9t1fDHH9uAEuHD[]A\A]A^A_fDdAUAԹ LA)LH5ZP1RWlYHEH}DH DHGIHHuL~(HN(HILI9A!@HEH HIHP(H9HAG tADDDA# t1LHT$X@HuI?AIOHT$HLNHOH9H~HN MIOHN HH^ AeAfDHXHH9t[AHHFH9tDC tADDDA#t1H?AtHuHHFH9uH1EE1L`H5BYWXZH}L^ f1L1ɺ1H5YE1W;U ff.AWAVAUATUSHHHt$L;H9IHIID$@IMLI9tfIHCH@`HI~HLЅuHD$HHtMH5Ru8HCHMLHBHII9uD$H[]A\A]A^A_fHHCHBHI<$t=ID$L#HCID$L(Ml$=DD$+D$ T f1'SHHC CHHC@HCXHCPHHHHHHHHHHHHHHHHHHHHHHHǃHǃHǃHǃH H[ATUH/SHHHdH%(HD$1SLchHPHHEMueLHL9uHM$$I9t7ID$HHxHWuHD$dH+%(uIHL[]A\fDE1HRHHLH?e tL$$MtIĨDW@SHHH3dH%(HD$1HFH3H uHVHFH3H3H Ht'E1HD$dH+%(HL[LWpMuWHHH9tH^ L^(H HBHH(L@ L1I1L uILFHNL3@0H3H8L u4IH LH 4d HE$IYDHH9uG.Vff.AUATIUHSHHHtHHHtHxAtHD[]A\A]H/LLQHHPHHEI9u ;HI9t0HCHH@HxHUuMtA$AE1AtDAWAVAUATIUHSHHHHt$dH%(HD$81GP>$S@ATt*HHH9tHPHHb`H9u1H5cAątADA\1L1ɺ8H52QODA\ÐATUHSHH0dH%(HD$(1xD$ t`Ht:HLKH`L?D$ H5PP1JOD$EXZHD$(dH+%(vH0[]A\@HGPHxOXID$ZIFH@@`wIhHt @e EE(:HX I@H@H@ HD$hHfH>VI AFaIHt 87 H5_HAt*H5cH AtH5cH@ IH%}IH;\$H-,?=LcL$LMAF,LcM$ MtzID$PH5HH|$L@H|$ H5H|$.@H|$ H5iL@ IH54?HH;\$IHH{L MtlHLATI H1E1HH;\$uA9DHA11ELhH5Z;A\LA]1ɺ H5=1;1ɺ E1LH5<v;H{GfL MdHLNATI ILd$L9:H-< HL9%H{<|uHCHE1L LHH1:뺿(6HT(@H@H@ HD$H|6HI@H@H@ HD$XIHD$H9dH-;EML$H AL1HE1:XZHH;\$HCDL`E9ID$PL9uI$ID$I3I3H u!IT$ID$I3I3H L$@LLd ID$PL|$p@LH> ID$PHHML$HAWLtE1 1AU9H Ml$HL6H|$HLLHWI t?\HML$H1 HE1ALl8AYAZMD$ H|$XL LLD$H tbLD$L$@LLJ 6AMH1At$HL_E1 08_AXMl$HL5ILHD$@HxI9HLHL$YF HL$HH9thI|$hID$pI9D$pML$HHALl HAt$HLM k)uHGHHxHAH1M E1L37Y^@1ɺ HL7LaE1 H5b86HD$@ L1ɺ HL6M1ɺ HL6 1E1MLH57U6yHGL(1ɺ 1H*66HD$P LIH"H4 E1PM1LH5>75XZ1E1MLgH575HL1E1S MH56V5AYIAZHD$h L,0LHH1E1L H5r646PLG1SME1$ H5=64_IAXLE1 H564LE1 H55i4HD$HLW1ɺ H551E174QHCL HD$L1Ld$hILI|$I9,HLHL$RB HL$HH9 LY1HLLHC x HE1L3H56|H5Lw6eLIT$PLLAUPLZs(LڣIT$PHLZLPaL諣IT$PLbLAUP4HGHHH|$XHLHAUIq 1H2HCLd$xA_E1L XO5HL41E1S MH53,2A[I]H+ 1SME1H5g3L1Y^HD$XL1ɺ zHGff.AWHAVAUIATAUSHHH9t!D] A9r M$ A9rEHmH9uHAuHE1E1LH521XZqA9_H}GHLM0DE(HuPPETPPEPPELPE8P(HPIH HIEPHHx DHUuL)ىBA)FPD)E1EPA^$M$M AN tHDHMH@HHIًA)AD;}LrHEHII}PInLpLuRAąu+L1ɺ1H5U/AHD[]A\A]A^A_HBuPELLL$PHx)pLL$IAH:IHDHHHDH@H@@HHHsH9jHBHMMHL QPATAWE PfDE1H-cLH.L1ɺ1HE1.fMPJE1DHRL(*(IHMMHL:DPHHDpHATAWE PH511.H0HG I]HHt_HHtWHISH-|1ATHL&-Y^f1IH7LO(H-(L 1H-H-L H]-H-҄LM1ɺH6-cH-L&1ɺH-<+ DuqATLgpUHSH_pL9tdHCt2Hxu%HL9u[]A\D[]A\f.1f.f1fHHH9t.fHPBtHtt;HH9u1HAH@H@@HtIHH9tHt=HBDHAHHH96HH@H@H@@HuH5ff.fATAFat1Lt*L1ɺ1H5,Q+DA\1E1L1ɺH5,$+DA\ff.H(DWLA9HD^H@HoHP) $HT$E9vKK[EBHljfDoHH IH LJLID9uA)ABLH@Hfo$HT$HPH(fDA1LH5A*1H(f.HLIL9AUATUHSLI9AD$LM$H@I\%LnHNL3hH3HL uAII9tfA:uVIBHpM9tILH~LDHBHHL(H1M1L tH@@HtHN@Ht H@8H9A8tHI9u1[]A\A]M$$L9EAVAUATUSHH $H HDLNHdH%(H$HrRiMH\$HIHD$HhHH$HFPL1 H.YH1ɺSL-ILL1}(YL^11HleIH@aLY11HL-'At$X;5pH=McAAD$aDH$dH+%(<H D[]A\A]A^fDH(AƅgHEPHLLFLuH1'XZ+L|E1IH51Q'L@Hq @K LefDILLE1 &ILFL1E1&)UHAVAUATSHL&dH%(HE1L9ILE1DHAH9uEDHHHBHHHHH)H9tHH$H9u%H)HtHLLL$1ILIL9tIT$M$$HHPI9uIIH90DDLLYu HUdH+%(u He[A\A]A^]Z(f.AVAUATUHSH HdH%(HD$1IHGLGL$LT$HHL9u>DH1HHL9tIH@ tLHpIqLH<$Ht$LHpHD$HHH1HT$HL9uH $HHL9tGf.HqIHpHHHw LHqHO HLHHW LM9uH_L9E1L-%f.H}AHHGH9tLC uHCH@ HtHHЅuͿ1L1ɺG L#H}HHGH9uHEEu7HE1HT$dH+%(H []A\A]A^fHHHHDžH9tHPHH!H9uH}@OHEHHEHHE@E,E,tgHxLxL-$L5fL9t4DLKML=Lj 11"HL9uрe,LLxH N$H5\H=m%ATUHSHHNH}HEHH_HGH9tcL%#f.H}HHGH9t@HCH@(HtHHЅuL31ɺ~ 1L"[]A\ff.AUATI1UHSHHXdH%(HD$HHGHLh9%HHPXHt HRHHxhHH{@^HHH>u%HD$HdH+%(HX[]A\A]fDH1HC@HWHHKH9BLjHEHHH-y"H@DL$Hxjw 1ɺ HI1L,$LH A$HZHYH9HC@HHHH9LJHD$HdH+%(1ɺHL0fDHH4H9+H@H1ɺ PLOH5i!1M$H{@^AXHKHLfH@HHtIMtA@I 1LH5 oHC@D$f.Ht HHtH9unL W)HD$HdH+%(Lџ H5w HX1[]A\A]DH )@L-(@LJf.L (O@I$HHtI$!AILk11 H5Y?!ff.@AVAUATUSLn`IEHh8HIHt5LHLAąHA[D]A\A]A^@LvpMt)H5lLutL5M1E1L1H5[D]A\A]A^1Lj1ɺ7H5O[D]A\A]A^%1E1L"H5$@ATUSHHHE1uuID[]A\ÐGauL1L8H5*At@C`u1A LLH5k}fDL1H5A6HHATUHS>toIHHtRtW&LHt7HX Hu',fuH{?t HtH[Htu[1]A\[]A\fDfH9wAVAUATIUSHHtFI$M$L9t9fDLmI}hH9tHtCHt HGH@PhI]hHmL9uI$PM$PL9t;LmI}hH9tHtCHt HGH@PhI]hHmL9uI|$Ht HGH@PhI\$[]A\A]A^f.ff.@AUATUSHHLg8HML%A͹HL1J<#H)DH?r tMLLDhD H}8LD L MtMd$HL[]A\A]f.H-J1ɺ1HLɳE1H11LHL[]A\A]fDL1ɺ 1H5gjf1E1L H59<@ATUHSHH IHthooKHoS P o[0X0HC@ID$@HCH@8HtHsHtHID$Ht@Md$M$$L[]A\L1AH5fLHE1 AUATUSHHLoG C HCE1HPHHt LIHCHP@HHtLATL PHL LDH5Q1XZH[]A\A]utmAWLD1ɺ AVAUATL%ULHSLHoodH%(H$1LHHD$1Ƅ$)L$`)$)T$p!HHI9fDHPHRHI9uH,$E1AfL}`HI9t4HCHhHA!H}`uMu1IfH,$E;LIM9u/'Hx?HII9HIGHP<tHrHLP+ LX=?L11IGZYHt D8EwL1ɺ1H5Lʯ1ɺ/ 1LL1L LH$dH+%(HD[]A\A]A^A_fDHE O L1L'E`LLM9L1ɐHPHHHL9utHEq L5L M9IxLLLWfDHBHHHL1L1H HOHGH3NH3FH H}1Ҿ9AƅHHH9tIHNHHH9ut@HH9dHPHzyHE H}DdHGHwH9HE1fDJ HAH9uEqHO(HW(A]H9HE1ɐH?AH9uH9VHE1DH?AH9uEE9E9 _E)H9HE1DO H?AAAH9u1H9t HH9uH9t1H H9uAVL1 APLLWARDT$ HEH}Dt$ H HGD$HIwH}HGHWH9L,$HEHfDHmHGH9E uADDA# t;HHT$ AHT$ <HzfD L1LH0AƅL1ɺ 1LH6H9dHL9MM9,M9DL LHL19E1En1fDP HH9uLuAE`uH}@HtnFAƅp DKE H}:D ?EtK B:u{LE(LHM9tGH\$PD$PIvL9;HfDHL9$H;puM6M9uHII9u,{fDIEIUIHBHHL9WHIuH}uL1LAƺ HHHH[]A\A]A^A_HH[]A\A]A^A_fD(IH-L@H@H@ HEpHHD$L9oE1L=DIN LHq  LepAt$IT$L]LHEpHH2HH!qHLٮSI1H5EXZHH[]A\A]A^A_ÐE9,$uL1ɺ1L M6L;t$LepE,$"f1HEprATUHHtPH5uHAt+H5tHtH5tHE1AHD]A\ÐE1HD]A\fAWAVAUATUSHHHH|$(HdH%(H$1HD$`HD$ HD$`HD$hQHHhL`I9ttLl$ fDLuH]M>L9u NfDIǾvHT$`Ht!LpHHT$hL(HPHHD$hIMI9uHmL9uLd$`L;d$ D$7L-{zfM$$L;d$ 4Mt$I~0tA~<uIFH@xHFLH8@XIN1D$TD$0HC9HL$8HHD$H H1HHHHD$H9D$6HL|$XH$HD$Hl$|Lt$@Ld$HfDIT$IL$ ID$(LHHAHA$IvLHL$D$|ID$H$R tA.ID$IT$ HxHHHHIL$ HHPIL$(HHPHHPPH9\$-HHD$L HHD$0D$|HCH$ tLd$XMtAD$0urEt$4ELAD$0t!fDID$LH@ HPAD$0uET$8EumIT$j<DID$LH@ HPAD$0unHAt$E $1Lj-H5K1A[A\H9\$D$6f|$6Lt$@Ld$HHD$(Ht$8HL$T1HxhqUIHNDL$TEWDH8AF8A9H1ɺPH-Lo1Hm_AXH\$(LH{ y|$7yD$7M$$L;d$ |$7eH-AF8HMN01H"E1PL%1Y^H|$`Hl$ HH9t%f.HGHCH0HHH9uH$dH+%(HĘD[]A\A]A^A_fMO(IF0I9uLH\$(LH{ .H-1ɺ1L H,H1ɿPH-1LnHXZL1ɺH-S1H|$7AL1ɺ1H5AIٹLBH5lL1ɺkLt$@L1ɺSH $H5ӖH==AUATIULSHdH%(H$1IH:IHLH L1ɺL"HHXHC HH~H$HzLHHILHLHH) H)ƉHLHAąAH$dH+%(HĘD[]A\A]fDt$tADfDfL̑1ɺH5,1E1yIHHLタ1Ę L1ɺ@Ld1ɺ1H5Gf$ۉADDfDAWAVAUATUSHHHIHDIHLEXIHHtI9tH[]A\A]A^A_fDLL%HL>1DH)J|%H_ t[LLI}8LPQ HCHHBHH[]A\A]A^A_H[]A\A]A^A_@H-1ɺ1L H1L1ɺ.H1 AWAVAUATUSHL>Ht$L9III14ALL1LmALLHLVM?L;|$tLI<$L0HHu1LR1ɺH57H1[]A\A]A^A_fDH[]A\A]A^A_ff.AWIH1AVAUATUSHxMphdH%(HD$h1Ld$Ld$Ld$yH$HJ MnXIIHHH9uH~fH0HHHNH1H|$6 HL$L HHHD$HHT$H HHH9t;HLxAuIhHtHGH@PhH HHIGhH9uH\$IIADžIDžHL9Lt$ILfDHHCHBHIlIL{L3MeHCIhIHAIMI9MtAD$LHtHGH@PhHCMghH\$AAH9t HTLLt$H$HXHH$H9^LIHDHxHH1HH)HIIIIIIIFH@HzM!I$HL9HrLLЅH}LkD$`AoHT$@Hs )L$@AoW)T$PH}BLeIhI9tMtAD$Ht HGH@PhMghH}(舜 HofH@ @HLxHLeL(IhHPHHHII9tMtAD$Ht HGH@PhMgh{xv C|qHH;$H}Lchқ IH.Lߢ1H5mL)1 H5ILʊ1ɺ 1H5(HH;$lIHD$hdH+%(mHxL[]A\A]A^A_1H5LLЅI$Ht L9L ^Lנ1 H5tDHCXHH@fH5IHChIG@HC`IG`HCpAAGHShH IIwpoAoAg^HS Hs H9H1HH9uHK0LC0I9t#H1f.H6I9ulH9t!HHH9uHFH IL9DHH I9uHPH@LH}H IHH IL1ɺ H5IhHtHGH@PhIGhH}L @L%H-1LSA H9IhHtHGH@PhIGhL1ɺ 1H5E1L11 H:IG@HtHHt H9L 1L1ɺ H5 IG@HtHHt H94L L1ɺ 1H5LHChHHHH9LJL=1 H5L1ɺ 1H5P/HChHHHH9HAE1H9tfHAH9uH PLv1H5kXZn@1H5wLLЅfLJLJxL 9@H)Z@ L LH5qfHChHtWHHtOH9tJHBE1H AH9uH PL fLH9H1ɺ E1LTH5EH $H5׈H=A AWAVAUATUSHH(L$dH$`H|$Ht$D$LL$xH$dH%(H$1AHtHL|$MtuH52Liu]1MZLͶH5cH$dH+%(P/Ht$H|$H([]A\A]A^A_,@H|$I9D$dH|$H\$XHUDn$E]HGHD$DBEAHt$XH|$2nHt$$Ƅ$\$dHD$HHDŽ$A L`h1L$t$`LL$Ht$(:XZHt$XfƄ$H$)$HH)$oH$)$oN)L$ )$VHDhD H=HDHމ3 HHt*H@Ht!uHT$XHt$H|$t_$BH zHLPH\$1Ht$(IAXAY1ELtH5EXHUHH9LJAWL-PL1L3YD^ݺ8HUH9LHCLJPHlLPL4[1ɺ61i^_Ht$LUBHt$L4Z1ɺ@ Lt$0Ll$@DIEHHt.HMkPHt$(L 1޿AYAZIE@HHMPHt$(L1m裿_AXHIPLr,HLmY1ɺiH5\RL fL ZDuTMXt$0L$ RL$ t$0HEHtmH9thLHHLr1VH5Q1R;޾H rMHt$1Lz觾ML Ht$LX1ɺ9 Lt$0Ll$@rHt$I1Lz5MHAL{UHt$(1A\A^HM11AHt$(ILlz½A_XHD$@[Ht$LW1ɺH Lt$0Ll$@聽Ht$LsW1ɺb Lt$0Ll$@UL iIL9HNHHH9u KHH9t@HPHzyMHt$1?Ld|׼jfH6I9uHt$LV1ɺ[ Lt$0Ll$@蜼MP_ALyeHt$Lz11NSHt$a1L({.{H1MULxHt$(XZLU1ɺxܻ MHt$1Lv讻(H\$M1Ly0H}1L$yH޿1XMHt$1%Lx%Ht$LU11 JH\$71MLxHͺLx8MH B$H5PXH=aX躵Ht$LT1ɺj Lt$0Ll$@sff.Gat6HHH9aH1:tHBHP`u1Dƀt@HEfDATSHHHYIHtiH@@tHL[A\@H{o*I|$E1H_*HLySI1H5ˇ胹XZH{*LyIH51HlAWAAVAUIHATIUHSLH(DL$;H9tMH)Liy#IH5(1޸E1H(D[]A\A]A^A_fHNtD=ED ED$D$EutL3LL9uM6I9|HEPIVLHx訔u܉D$Lqy16H5dDL$7fLx1ɺ)1H57A @MP1L蝖YHLJ.BL yDEtPT$jE1jHuhHE1^Lx_JHLbH蝵LH L+ Pt> u*HLHD$H9HD$LLpM<$M9u}DIMM9tmIIt$L蝹uI $ID$HAHH}PΞtH}PLeP1ɺ=1H5HE1eHD$HHD$H9RADLxUHEHD$H1HLHD$H9tpHD$LLhM>M9u=fDIMM9t,IIvL螸uIFI6MHFH0IM9uHD$HHD$H9uD$tH_5H}P螝tH}PHt$Lw1yE14Lu1.H53E1LvOH HHD$1跴HLHdD$iLvHt$1vDL$D$LdN11?H5GDL$bH}PtE1Q+D$sLvff.ATUHLMt.HLJHLpHLId$`it HL]A\1ɺE1LMH5с莳ff.ATHE11UHHdH%(HD$1HGPHL$H8t-E1|$AHD$dH+%(uBHD]A\HA#L)vDIH501ϵff.@AWAVLAUATE1UHSHXLHt$$HL$dH%(H$H1HGPM9MDHD$,D$(HD$GaJD$iLuE"H1ɺmP\$1LuH5PA LAXAYHL$M9MDHEgLAIcHl$LIL4@I"@L與u?IAxZHJ|0HG`tĀt@tLItDHZfIAyDHl$t\LuxH5m1#E1H$HdH+%(HXD[]A\A]A^A_@Hl$HD$0E1E1HD$L=~HD$8HD$0HLI^IEPHxV[ HH|$0HXFHT$8HL$AHPHT$8HHHD$8D9$$ELH1ɋUPELHH@HHHXHc`ݼMH 1MIH5G~1MdMtHT$,Ht$(L>qT$,A1LsH5|蘮=GLs11H5|mD$(>H}P訖tH}P Ls1H5g|f.cLRqIH5.|11ɺ$LGH5{趭D $DL}{H5{膭E1^fDLyq,H|$1H K{LlHIIH9XAH\$0H;\$Ll$L|$@L$>tA $HL#*HH;\$INH1HzLLkM H}PLLbHiLHPHEPHH$Hx W H$Ht?MI $HxHHIt HtHLH)H)H4LzLE1ɺ6H5 zݫ$LE1ɺH5y1贫D $IL`Id$`LgLIHtHLH脍HLHH!E`3:tMLH:LE1ɺ1H5JyE1A $҉ALLL MtL MtL HEPH85t (ua 3g>]LLnIQALfLXLl$Ht$L脃tg~LLpnILL'nI$LC1ɺ$LMnH5w1蒩D $i$LC1ɺ$LlC1ɺ$LVC1ɺH Х$H5FH=FH$LC1ɺF$LmO$LB1ɺff.AWAVAUATUSHhLt$ H$HT$DD$$DL$,Ht$8dH%(HD$X1HHD$0I9ԳAD$LIIω$HtD\$$,$LH+bHkvEHD؉+D$ D$(AH1ɺVSILmAUH5Av1UH At D$,AD$LAA[DT$ EpIcLt$,$H@1HA;@DL|AA$H);D$ I$H|HG`tĀt @tHD$LЅtEuH|${Ht$FclHD$ uL'mIH5+u1DT$ zf.ĀtH|$7H|$kA%fD$DLt$Et[$A)9L$(҉L$ !ЄtU@HD$XdH+%(F HhD[]A\A]A^A_f.DD$ $A9T$(E!ЄuAD$LT$(H\$@H\$HH\$@9rf1@I$H|$@JT*HPHT$HH1ɉLHPHT$HHAT$PHD$HQA9l$LL,@I$IJ|(Hg`aIFPHHxP HaLsH5js'E1L k1\H5H5sŤDT$ [D$(AD$Lt$(L$$L$,uLl$@1E1I9uMmI9I}HtHL?3I}辮u1ɺD$ L&>H5ZrDT$ 1ɺD$ L=H5-rDT$ LE1HHtHE`Āt Dl$,EuLl$@I9>MtLL2HHLe2zI|$.L%HVZD\$,ELl$@I9uMmI9I}J uD$ L<1ɺH5+q1DT$ wLE1|L q1ɺIH5p1訢LLHD$ L<1ɺ녋$:$D$ T$(L$T$(@MtL} HtHh IFPH8DAEt. uD EuDD$,Eu-Ll$@I9t#I}Ht111MmI9uMt11L|1Ht11Hc1|$(HD$8HtT$ LH1PDL$0E1H5woLo-^A_IF`dI$LxIg`L%]LLLH|$,tHL$zMn`AHI!Mn`IE1H9D$0LEMH[D$$PLhHH'HԪAFa tIH9D$0bHH0 HH;D$0uF1E1LL.L91ɺH5n1ҟE1jD$ L91ɺ LHHI9ҪD1LfIH5m1pAUL1H,$H݉Ld$ML|$iI$HRL<J|>Hg`R[I$H|$@JT>IUHT$HImIUHT$HL*Ll$HA9\$LvbIFPHHx|I IHvL81ɺĀ@D$ L81ɺHLd$L|$H,$H1H$}D$ LD81ɺAAFa tIH9D$0|$, Ll$@I9LL,1|D$ L71ɺ$IF`SĀJ@ALI|$HH3 E1ɹHHIFPMH82iI$HHM`YLH'RD$ L771ɺ?4AFa CH9D$03DL-U?襚 D$ L61ɺD$ L61ɺ(D$ L61ɺ+D$ L61ɺD$ L61ɺ~HD$  LbIYD$ LE61ɺBD$ 1L_jH5XjDT$ HD$ Lb:I Lb0IH5i1贛E1Lff.AWAVAAUEATIUHSH8H|$dH%(HD$(1Gat,HD$$D$ L|$D)HD$IIH9@LHELL9؍pD$ GE1Pt$A.AXZEtDL$$Av9wLIHt)uAG@D$ L|$fL41ɺf1H5hDL$ 芚DL$ HD$(dH+%(uH8D[]A\A]A^A_Nff.IGa uWHHH9tAQLt2HHRHTfD8u L@A@a uHH9uH H9uE1LAWAVEAUATA1UHSHXL$LD$dH%(HD$HHGPL8RL31ɺH.H5gLI`Ll31ɺIHH}PMpHHH9L$H9HHDL\$IEMHA$)HAt$jjG AZA[IL_1H5f1袘UpH}PL\$AUE1Ej1AVt$(RLj4H0IHBEa PLLM9I$8IO`I_`E1H9@AD$ D9wAT$$D9M$$M9uHHLu`AUIo1H5d谗XZHVLE_IH5e1E1|DL$EL^11ɺH5e1E1>HD$HdH+%(oHXD[]A\A]A^A_1E1Lz_H51eI A fDqAT$P9r,H AH9YLM9HHL$dHL$dAT$PDH@`I_`H\$0HD$H9HHl$1HD$ HD$HL$ HH9t@E 9w U$9wPHmH9uHl$HHL^SIH5c1ޕ^_ H|$W;UPHE@ut$H HHoDuLAwHD蚒EGE1E\$(Ll$AE;gDHHLpHxC&H@IHHЋUP*XHCHuL%.b1ɺ1L.LHl$L.11L˔HsLb\If.\$(HD$]PHHD$H;D$07Hl$HEPHM`HxHGH@H@HHt HЅKAZH|$4blHl$HHL[jIHL[\IH5`1ɓHE1iLZIH5a1蒓OL[1cH5`iHEPH a HH8iyHkHI9HH@LpHHD$L蔐LhHEPLHx= IH|LLHvL^LAD1HD$HMPHp` HD$@H^DD$Ht$@HTHEPH5>`H8iHD$ HH|$IG`E1HHD$H|$(H9H\$0EHl$HD$HHD$(H9tfU D9w M$4 D9w5HmH9uHl$HHLZATIHA E1jjjjjQjjjH$H|$p蘉HPHHAOE1Hl$8Ll$DAE;wDEHHHRHLpHxHH,ЋSPEBTHEHuL%F^1ɺLL+Hl$L*11L2Hl$8HD$@HH HHHSHHUPHPpHD$AHHD$H;D$0IHl$HEPHM`HxHGH@H@HH HЅLF*1ɺH5T]+xfDHHLWjIw6L)1ɺH5]ڏ'H}LXIH5\1規L)1ɺH5\Hl$}Lt)1ɺ1H5\WLN)1ɺH5\\3L*)1ɺ1H5;\Hl$8L(1ɺH5 \L(1ɺH5[ 覑q L(1ɺ1H5[Hl$苎fDAWAVIHAUATUHdH%(HD$1HH9IIA1f.HH9u|L$ED$IT$`H1H%ID$`HĀt LALLHcAŅA+@ 1E1LH5[yHD$dH+%(HD]A\A]A^A_@HL$E11LLAŅID$`|$H$*LH=VH17 H0IHDT$`EuDjDLESDL$HHXZYI~u H[]A\A]A^A_ÐIGPLLHDnD9DFHPDL$hL$pAXAYHHD$LHEjDLSDL$^_L\$LL$rL$tI{PL$ZL$L41H5@^rI~ H1[]A\A]A^A_@L< 1ɺX1H5g@rH1[]A\A]A^A_fDIML9}LLIK`L$f.H<$H&L 1ɺuH5?q`fD1LE]H5?tq1=DI{PKL$I{PmDL< 1ɺi1H5g?qf.AWHAVAUATUSHLH|$H $L9t:LHMIl$L9t6M M?L9t(IwHsuAHD[]A\A]A^A_M$$L9$$u@MmL9,$tHD$IUHH@PHHxLAąuLD1H5w>/pff.fAUATIUHSHHHGPL(]nHL貇HuK1LmDIH5 >1oMt4A$HA[D]A\A]ÐoAąt$HtHA[D]A\A]D1Lj 1ɺH5=OoHD[]A\A]ÐHHH9zHJA BLGa ATUH@1SHHZ:L$t@HL9tSI1H57hXZMfDkAA9sSL[LfDL7H561E1ihHD[]A\A]A^A_HDKL1AS E1H5i6L=hY^H@@bt$HEL[L]LA\A]A^A_GL=Kf.Z LE1bHL=AVIAUH551SgH fD$D$ DhEuwCP9{LDt$ AD;sLs^SPDHsADžuL1ɺ1H5;5ffDD$9CLwD$CLfDD$CLEt$HH9TADCLfDID$PH5Q4H8|HC¹H1H|ADžLe1ɺ1H54HfATIUHHWHBHtEI$HHHHHDH F`"HLH]A\HB Ht?HHt7I1L,<#H5]eH1]A\@LJ(fATUSHHHtHH#E`u9H{L <7IH519e[1]A\fIHH2tHF!HH!E`I,$Hǃ[]A\ff.@AUATUHWHHBHtwHIH@I@LD11=`AąHEHULAH @H HDH B` D]A\A]HB HtGHHt?I1E1HL;H5ʈdD]A\A]f.LJ(f.1L1ɺQH5cD]A\A]fDAWAVAUIATUSHHHSIE@ EGd HHH9CoHE1H-L3fDLCM;ELM61H9HEHH9DKAvADKE;u(1E1L:H5b=f.I}E1tL :IH5V1bHD[]A\A]A^A_.H1L::hbIHH fDIUHBPH(I}X}HhH IH8H@fɾH HfɾHIF{ HHHxHHHǀH1H)HIEHP@ooXo` oh0HHV@HPH^HVHHPPM~I]XHNXHNpHVPHNxHNpf n0AIwHHHLH IEHPPHH} IHI^IFHL0LHL%SLAB HIL/1 o`HHCIHBHHH LPAƅL11ɺ 1H5˄`rIE`HtHHp8-1LKAƅAIt3HHEH9ǸHD1AƅsILAƅ?I}XHtLpAƅ6I}HHILeH9u$fHI $ILI9IHuHVBtH9~XuHt?LvHGPIL@HHGPHHxAƅHuI}AƅHEI}H@XffDIEIHAH!P`IHp`4IDžI}IUHHB HtHHtLI DLJ(H1SL,5E1H5]XZDL HH4fI}LpI@I}`xHHH9t1H H9uHHHH9q1HH9uW@I]`H=HHs;YLHHL1ɺL%1L\I}~L4LI1\LH@ L1ɺ1L\L1ɺ41LE1c\fDHHH*H9ukD8LpLLgAƅIEHtH@PLHHxAƅ)MuHMHIH9pHIFPLbHxIHue Hf1LpIaL91QH5(o[Lk1ɺRH51E1K[L%L;1ɺL$[L1ɺD1H5Z\L1ɺ71H5Z6L%v1ɺ1LLZI}SL2LI1Z1LLw1cZI} LK2LI17ZL.1ɺ@1H5~Zo@IFL1ɺL%~1LYI}LL 2I1YLHE L1ɺL1ɺY1H5&~oYIv`$AIDžIEXIE`L:1ɺe1H5}Y{L1ɺ=1H5}XUH HHfLH0HXH|L%Z}1ɺ1LLXI}7Lx0LI1dXIEXHǀLY61QH5Z%,XL(1ɺ,L1ɺU1H5|WVL%|L1ɺLWL1ɺi1H5b|W L51QH5$WL~1ɺbLk1ɺoU ATUSLGIIH9HE1HPHzGfuMu=IHH9uMHI#@`tID$H@Ht_L[]A\f{I|$HnH{IbUATIL;/1E1H57{VXLZ[]A\L#I|$HLM/IH PSLE1L/IH5z1V6AWAVAUATUSHHGPL0HG`IH%H-D$ @hHHE1E1H9uf.HH9thD[LEtH:uHBIL$H@HP@cH5+ !L$IMtMHMH9uMGDl$ I w M90HAE MA$I~jx AI~LMA$HE$> AYLAZI?HI~LAEHMA$j H$L-AUIUH5x1(TH H[]A\A]A^A_D$ ;H5L$IIIH9_@TL9sHAELMA$I~j+ _LAXH-IIH9a_HAEMA$pTI~j H5wIXZUAU1L,SIY^H9^D`TLL$,IH5jw1RH[]A\A]A^A_DLIL1LIIIHuH1HII Lo+IH5v14R1ff.fAWIMAVAH1DAUJDATHUSLHMHLl$@HI9IMH$HHDjL: LIXZ=HH}H3jI$DL Y^ATAWI7=zLM+H5u11"QL_AYLDHAAE\HD[]A\A]A^A_f.HD11HHII9sMqAMH$LHDjL! H}$$DILH3 =zL<$I1ɺK1L+H5tPXZDL#MDE}EtH$HHDjLc H}$$DILH3+ =DyL)I1ɺ=H5t1L<$YOAZA[@H$LHDjL H3$$DILH} ^_LH臿ATLq)SIDH5fs1NAXE1AYL1ɺSH53sNE1}fAVAUATUHLhdH%(H$1ID$`H(TH(HIHLJhID$`LA It$H1L﹀QH_LWOH1LHLLgAU=nwAVL5MrIL)1ɺ1LMH}XLZ1LAą111HVA=fDD$LL(IH5q1E1MH$dH+%(HĘD]A\A]A^L舽}L'IfLH5H9HLI(E1互H52q{LefDLl1ɺ1LSL=9OfAV>AUATUSHHdH%(H$x1H$HHHHH;$<HDH5H$XDŽ$HDŽ$DŽ$DŽ$Ƅ$DŽ$H$hHDŽ$pDŽ$DŽ$H$XH$`RH$0HL1ɺ1L-oLs'L&KHHqIHH+HdIHHbI\$PHhHtI9H_oIL$HI澀1H+L ML$HH11jAVLL'yJH;X1ZLLLIl$`(LhH$xdH+%($HĀL[]A\A]A^LE1L&IDeL1L&IL1ɺ1LE1Ib1ɺlLLIIL11H5ndI1ɺaLLE=IhL,1ɺ1LIKfAWAAVI1AUATIUSHLhHHHHH9IHJLH#q`tIp9v ΉH9sHH9uEMtULH-mL% HI13HI<$1ɺLAąeDAHD[]A\A]A^A_EH9GMNIE`MI%I9MD$Ht L\HEMp1ɿUL=0l1LLj%mGAMp^_9O|$DAD$L1E\$8)E$It$jAAUtRAVUDL-H AąL 1ɺ%1LF@L!$1ɺ1H5vkFf.L1ɺ1HFfDL-.k1ɺ1LAL.$aFLLH;LG1LE1-FHtD$E1rEHEMp1UL#1ɿH5jAEXZHHw@/IH1Ht)HVHH9tJ HH9uHU1SHHo`Ht+HHpHtH5)AtH[]fEatHs@HHHt @|H[]HS@HtbLH?L119H?4< AWIAVAUATUSH9_HHH9t&f.C9r DcAD9rmH[H9uHF@HHHH9HBHAPLM1H5XaB>XE1Z9E0LsA) H@,HHhD)LpDhH@ @(H@kHHHXHBHS HHtHRHsHHRP)AMtIHD[]A\A]A^A_H1HGH-e`L 1!H9=L511mH=L11HfH t5H1LH5s^];1HfDHGHWHHHt H9tHz t.HtH9tHy t8f.GBHHBHQH H@QH1WHQHVH2ff.AUATUSHHH9 HE1L-]fLS MI:I9tsHsLHfI9tKLfDHH9t8Hx uPO9ADCPO9HGщD)DA9DFH9uH?I9uHH9lHD[]A\A]HCH@@HtY-6_AXD$HD$8|$(9t6HAPH5YLW15Y^D$HD$8|$,9t6HAPLE1H5X5XZD$D$HH[]A\A]A^A_DL=?ff.AWAAVAUATUSHHH|$HDxBDA9DGHH9fIAfDAHHH9BE99CCPD9rH{ uH|$AoD)(D)A9Ce IHfH@ @IEH@@HHHH9LJU5AVH5X1LE4IMIuM,$Et$Al$ HAAl$Z_H9uDHBHH9t HP;h vHxIT$IL$HH IL$ HH HIMHP CAmCL =H@H[]A\A]A^A_@H-XW1ɺ31HLt3H11LibW3H1[]A\A]A^A_H /$H5H=G.HLHG HHO EYHAHD)AA9wzr H)rMQAIqz zHFL9uHAHI9t HH;x vHxHJtBHrHp E)Hr HP H HH EYHH #H5)VH=v-0 ufHHH9)>USHjL9u H[]H踢S$UIL1H51XZ1H[]@HAVAUATUS9HAfDED9wD9H?HDIHEPHDL$Hxj IHEPHDL$Hx$ 1ɿH5IXZAUAVL-_10Y^[D]A\A]A^A[]DA\A]A^fSH9rҸH;WhwG[DKHLK(LPm1H5n0X1Z[ HLK(LPsff.@AVHAUATUSHH9<HuHGPH8d‰HuhHA9HEPHDHDL$Hxj6 IHEPHDL$Hx$ HIXZAU=XAVI1H5L1/DY^[]A\A]A^HHH9HDGdDALESI1H 9YLv)H@Hǃ8u&H@Ht@gu׃9YLw׸[DLHAٺPLT1H5<.X1Z[fDf.AUHATUSHLHI9ĸLDGdt^AT$LtUI1DH@I$HH|tI$HD@auIEA9l$Lw1I}H[]A\A]fHHH9w9AVAUATIUHSH8tsHHѰ1 AąuCH۝L_&IH51-[D]A\A]A^A[]DA\A]A^fDIHH9u@HI9tLkEcuLH3tM fDAUATUHSHL.L9#H'fDIuH}AąMmI9tGI}nAąuL1>H5,HD[]A\A]DL+L9u)I}+AąMmI9I}Le"*LHwCAąu1L1ɺIH5:+HD[]A\A]Ð1Lz1ɺDH5 _+HD[]A\A]ÐH}ǟuZtcf TtNTAK1L 1ɺKH5*HD[]A\A]輞f.AVHAUATUSHH96HE@O}L HGPHI0Hx- IHHHxI~HHHxZAŅOHI<$ID$M&IFID$L0HMt$HxHw`"(HI<$HpIFIv(`IT$MfHIV IT$HID$ AŅ HAH!C`[D]A\A]A^DL H51E1a)[D]A\A]A^DHP HtGHHt?HI1E1L H5)[D]A\A]A^@LH(f.1L1ɺH5z([D]A\A]A^L,3f.L1ɺ1H5*(5& DAWHAVAUATUSHL/I9q4AEL1E1IH@IHH؃8L`MLHt$ID$`Ht$HHIHtL ID$`IHDL x`ID$`HtL!ID$`AA9mLSEtAEHH[]A\A]A^A_f1LZ1ɺH5?'H1[]A\A]A^A_ff.AWLy AVAUATUSH(DwLE HGHAH@t@ uG1L1ɺ H5[&H(1[]A\A]A^A_ t tD11DEILAHH@H@PHx HPL1HIAD9ELDDfI A9w1҉AAB*MLA9wͅD1@A9I49tHHRH<HLH9Ao oHJ MZLZHIJAH IH HooHzLQH|$LRHy)$HI: >ML9aEt AɅ:H([]A\A]A^A_LbD1H5x$1H([]A\A]A^A_H}cHUHHB HaHHUHIH1SH5Lb$Y1^둋UL1tƒA9ELwD9ADE1E1E1tmfLDD΃A4A9t/H4RItFcuA9uىA4A9uD9tAAAE9vMt I~ H([]A\A]A^A_@}LwIEPH8D$HEH@ZAEp1uLD$DMt I~ LV1ɺm1H59H(1[]A\A]A^A_L5H5H(1[]A\A]A^A_DMt I~ Lַ1ɺv{AUtAV11jI}PRLSPD$DPDD$HEX>H01ɺ^ILH.D$fH@|$xpH $H5H=Nff.AWAVAUEATAMuUSLMHL1H1HHH!H LIIĉ1IH1HHH!H LIAt!EtE1D9tED)A)A9DBHD[]A\A]A^A_DI1LLH1HHH!H LII^f.tRHwtFu> tɾDΉHҹDщ1HDHH9кGHG uaE1F uP@t AFu=t AF@u*HHv(H(LE1AHDD@E1F t t@tHLHI9LDGp9A@LAp(tZIH@HrH| DHHt@HHAP(H9tfP(H1H9uHH9u¸HL/1H5q1HLf1ɺ)f.AWAVLAUATUSHXLHT$HL$dH%(HD$HHGhHD$M9G&Ao8L1ɺHGPID$(wAą9Ht$@LlYAą[9C1t$(EAG(Aхx9vH|$@gHD$@A)VAGH}*H\$Ht 1H|$@IEPIAG(AGHI9A%KL1tpfHH@HHxHHH1H9tD1ɅuK(P P$H(HH9uB;kLrA0L8LTIH51aHD$HdH+%(HXD[]A\A]A^A_L71ɺIDH5´1E1IAWLH|$ GHG)EDAG8LT$(DL$0D$,EGLT$(D$8ADL$0IGH@IEPH5_DL$0DD$(H8pDD$(DL$0HIGAG81LDL$1II9"xLL虒+D$8LkAąII9"xL1L-fD1ɺTALuH5 f9gLP11H5DL$(E10DL$(1;L 1ɺ+LT$(ОAą<AG(DL$(oL$,LT$ ALϮ1ɺF1H5]LL1ɺ.rH|$ 1Hx|$,x8HD$LIEhGAąH-11HLUHLD11IH+H|$ 1Hx|$,x8HD$LIEhAąG1H1LL׭11AHXL1ɺ1H5C2L1ɺ71H5r Li1ɺ02LV1ɺM1H59ff.@AWLAVAUATUSHLdH%(HD$1M9:IFAN(HHEfLHP@A)DE7 tD1AAąHT$1ɾH2AŅT$1AFHHI9@PDHAAŅHI9~@P1HAAŅsHH#C`HtT$UfHHR`u2u*IHt!HTHtHR`@HH9uD9LH- rLHI 19LqLHI 1D9ML9t$ MG`f.GHIPU6AŅBIILL AŅIH9D$ XLDd$EKH1L^AŅIPHAŅ?LAŅL 1ɺ 1H5HLS H-1HLՙ1ɺ 1HE1HD$xdH+%(n HĈD[]A\A]A^A_Lt1ɺl 1H5WDH-LE1ɺ^ H.PfA\DAH-LoHH1SIL 1^_LpoLp IH5F1@A5ANL1҅tG\$LADL,@HILtHxxuAD;sLrLna LIH51E1BLQ H-1HH\$PL9ufHL9H{u1ɺ HLL Lp1ɺ 1H5SLmQ L+IIn0"H 1LHA'H$MIo` L9t$u IAHH5H@H P`IGPH8}IFHH-@L1ɺ HE1tLl1ɺ$ 1H5Of.Lt$`Lt$hLLt$`[fH\$`Ld$ H;\$ u1f.HL9H{u1ɺ HLԕDIދ\$IoI)D$`HHHL$pAoMIMHHfoT$`AUHD$pIEA9VL;DHB HHHLHLH-ޗkHLSI H1A[[/LLMLl$(kI|$HkHLSI H1ZYH-SL1ɺ HLj^D$ubL"kIIH9|$HGHP HHHHHO1LHH=`H-L 1ɺq HL\| H-tLϐ1ɺ HH\$PL9mH-:1ɺ 1LH|LgHLSI H51CA]E1A^~" AWAVAUATUSHLH$T$L$L$HD$dH%(HD$x1HI9AF8IVfIIDD)D$PD$HH#BD$p)D$`t$s9HL$_Ht$1L0I21lDL\1ɺ 1H5?f.^L?IH51ADHR(L^H1ɺPDL$8L1Ht$(A[A]LT$ fHt$1E1LkCfDHt$LW11A@Ht$L/11@Ht$1ɺ1LIFAN(1Hp@xHt$L̆11"ff.AWAVAUATUHSHH_`LoPLHLI}LpL IH/LHLH5~LH9LLHBLpM5IFPMeHHtQ tHL1HiLAąu-LɅ1ɺ&1H5WnIIH9eALH@HE1Hf.HH9tH9luHL|HH9uMMeLHLAąhMeHdHLHAąvIF`1L%H E`H"HE`AąLA][HHR[=VFHI1S1L[H5oXZ2[LBIH51E19HD[]A\A]A^A_L1ɺ1H5E1f.HZLIfHxZLI`LPZLL5IH5&1y;@LE1ZHH ZHH5SIL.1.Y^YL;IH51L1ɺD1H5rfAUAATUHSHHH?!]5t# +t) ;t.HtH;u5AHD[]A\A]Ð;\ u f.HH襻Aąt^H[HEtHjtvHtjH}\/t# tyf\Ĺ1ɺ1H5Z;f.L1ɺ1H5*E1|K[fAWIAVAUATLUHSHLt$ dH%(HD$x1M9LDHIAULALH) Aą^IDžAIGPHHHH9u aH@H9tWLH#PtIED$ AHD$xdH+%(HĈD[]A\A]A^A_AL1/H5,IE1LH51E1sHLiAąt9HD$xdH+%(IPHĈH[]A\A]A^A_L1ɺ1H52fHD$PHHD$HD$XHD$PV L`RIH51=MM9AFLLd$`Ld$hH@Ld$`HIGPHHT$Hx詏 HD$ HH$HT$1AFLH4@IGPHHxs HANLtNIH IH4HH H|$`HHL HL$hHHHHHD$hHH9uHD$`L91@HL9uIGPL4RIHxLՎ HD$(HL1HHD$`L95D$Ld$8Hl$HHl$Ll$@II}T^H5iIL1 IGP1Ht$(I}HH9ËD$HEH@L$ID$HHD$07D$H|$P`HD$XI,$ID$HD$XL Ld$XLd$PI9uPM$$I9CI|$H薵uL}1ɺvH5LSLW?IH5q1LlSL(UIH5B1L|1ɺlfL||1ɺ1H5 _LV|1ɺ[1H5~9ALt$PI9uDM6I9I~H舴uL|1ɺiH5~MmL;l$8Ll$@Hl$HHt%HH9tHHPHH!H9uLER H5%~IL1[nH|$oHD$ LIQ L7eIH5}1Ht$L A4LQLhIH5}18LuQL^IH5K}1Lz1ɺX1H5#}xI}Ht$0HI}QLlIH5|1,4Lz1ɺ71H5|6 H ~$H5}H=}AWAVAUATUSHXHT$Ht$,dH%(HD$HHHT$HD$ H9L|$ HIG@5DMpHD$0AWLE1HD$1MHD$8HD$0EIBAH@HNLl fDH9HLL9t fP 9wD@$D9HL9uOHL%s{SILLg1Y^Lx1ɺ1LH7OLE1IL:B1aHD$HdH+%(HXD[]A\A]A^A_HL$11HAąlL1L9|$LDE9EGHI9ElDE1AE;nLspIDH@H|9_pvމuL%EzLw1ɺLLw1ɺ1LlAL1L9l$H5LDHEPH8)^HH5HAELE1E1jHjjAUTARDjAWPjAE8PHPHH|$0HT$HHT$8HPHT$8HAVLHD$8ADD;ephH|$0MH;|$+1E1IE1+MDH@IL@IIH9t @C A9r C$A9HH9uLLHL̤ATIL%x1LXZnDL%x1ɺ1LuLFL%ixLu1ɺL1HDL( AWLAA9M6Dc$L;t$HL$ALH IIGHt$H|$HBH[ HEPHu` H5רH8\HT$ HBH|$,A1H费Aą Lt1ɺN1H5cwRLt1ɺ>1H5=w,H% L%w1ɺ1LotL_HHL%vJLLI1H $H5wH=wLs1ɺJ1H5vE1nHD$HdH+%(uTH}PHt$HX[]A\A]A^A_L%8vLs1ɺ&L|L%vVfDS9A)K @PLHH)L@FL)IH@HHHL HH4LLNLPLVLHHtH LHpLBL@HrHAL9u[DAIH)K@HHHRL)HLRI@HNHH4LLNLRLVLJHtHLHrLALBHqHH9u[UHSHHHH9HWHB HtHHt H@HZ(HHHLSI1H5stH1[]ff.@UHSHHHH9HWHB HtHHtHHZ(HHHLSI1H5s8H1[]ff.@AWAVAUATUSHD.EHG`IH HHHLLL%[sM9tkDAFL1ۅtTfDIH@Hƒ8t/L2G1ɺLILf1bEA;^LrM6M9uH[]A\A]A^A_HHH90HCKLH$L$@ D$$D$ E1%f.D$ AD94$t`D1EHt$Attփ|$ tDd$ L?FL1ɺiIH5r1AeDmE1E1fDDHMAAD9t$uD9d$tnH$@D9stLEHSIHB HtdHHt\HHSDJAT1ɺ{PH5wqL1AY^QL^EL?1ɺtIHB(fATUHSHHH9HGH9Ft|$ H)tH^(HP HtHHtIL`(HDSATILeL%p1LXHZM t [1]A\fL1ɺLm[1]A\fDH@ Ht7HHt/HHJDHLSIo@H^(fE1E111HD$ D$D$@ATUHSBt L%(tLb(HHH91HWHB HtHHtHHZ(HCATL%|oSI1LdLXHZ t [1]A\fL1ɺ%Ll[1]A\ff.Ht$ Ht$Ht$Ht$Ht$Ht$Ht$Ht$Ht$Ht$Ht$Ht$pHt$`Ht$PHt$@Ht$0Ht$ Ht$Ht$Ht$Ht$Ht$Ht$Ht$HHt$HL$ H9AE1D$6fDATHUHH(dH%(HD$H|$@Ld$XHD$H$tSH}P1LHHT$dH+%(H(]A\H-lLj1ɺEH1Li1ɺ^H1DH-blLi1ɺHHH->lfDAUHATUHH dH%(HD$1|$@ILl$XLd$L$$tOH}PLLHHT$dH+%(H ]A\A]H-kLh1ɺEH1Lh1ɺH1DH-RkLh1ɺHHH-.kvfDHHDL$DD$LT$ H9HLDD$ALT$Vff.HHDL$DD$LT$ H9KHLDD$ALT$LVff.HHDL$DD$LT$ H9HLDD$ALT$Uff.HHDL$DD$LT$ H9HLDD$ALT$Uff.HHDL$DD$LT$ H9vHLDD$ALT$[Uff.HHDL$DD$LT$ H9/HLDD$ALT$ Uff.HHDL$DD$LT$ H9HLDD$ALT$Tff.HHDL$DD$LT$ H9HLDD$ALT$kTff.HHDL$DD$LT$ H9ZHLDD$ALT$Tff.HHDL$DD$LT$ H9HLDD$ALT$Sff.HHDL$DD$LT$ H9HLDD$ALT${Sff.ATt$A tDA\ÐALd11ɺH5wgDA\fDATt$Ak tDA\ÐALd11ɺH5'g|DA\fDHHLL$ H9PLE1]Hff.fHHLL$ H9PLE1Hff.fHHDD$LL$ H9|PLGff.HHLL$ H9JPLE1Gff.fHHLL$ H9PLE1]Gff.fHHLL$ H9PLE1Gff.fHHDD$LL$ H9PLFff.HHLL$ H9nPLE1Fff.fHHLL$ H97AL1E1VFfDHHLL$ H9AL1E1FfDHHLL$ H9AL1E1EfDL$c AWAVAUATUSH8HdH%(HD$(1HH9iHEHIHD$H@H $@uu H<$tuVLa1ɺ1H5cE1HD$(dH+%(H8D[]A\A]A^A_HtH\$LL-]cH\$H\$]7L LI1ULE1HHH AąHDžHE@t6IGPHHHˆH9uXH@H9K@tHE1LߤAąIGP@atjLt$I9u^fDM6I9tPIGPIvH8`&fDAWAAVAUATIUHSH(dH%(HD$1Ht HuLxHHH$IHD$AH9øHDMH|LDHEPLHHxLm IHHuMA1H H;CLc HACLL,$E1uuDL4@HIJ|0t?tgHt5Ht$DH֞HHHJ|09?AD9cLLDH蕞HHyL[1ɺ1H5C^1HT$dH+%(}H([]A\A]A^A_1H H+BLb xHR`u2u*IHt"HTHtHR`l@AHH9u|$ DD$I1L>Aąu)MH@ILxLA^L9wA1L=[*fDIEPHH8Y5A9^LI؉LH@HHh襶tH9/IVHHB HHHLIH11ULLHDLHHAV1GXILZH|.IAHHTHB`H%H HB`E;eLH}DH5豍IHMLJ1ɺ:1L踰E1HLDL1H5'M|E1@ELiJ11H5LLDULE I~H HLESI0ELL1DU=MLm3Ls LL}I 1C蠯HE1LID$HI#E`H IE`FtKALcI1LE=IDUEL3EL I1LJ1DU_H $H5LH=Lʱf.AWLAVAUATUHSHLM9"jGdM AIuHF A9AM8}AąQEAH ~E9VEeIHt 8xHI9-H@@H AąHIUHHB HHHLIH1SLߦH5,J膭A[[7tLH$LIH5I1E1JHD[]A\A]A^A_L,G1ɺ1H5IE1 f.LF1ɺ1H5I߬DHEPHAH$DLHxj9[ AYHAZI:IUHHB HtHHtLI LJ(ATL5H1ɺSLԥL15Hu`<_HAXAąTHEPHAH$DLHxjuZ YH^HxIUHHB HHHLIS=XLU1L61AqXZ f. IUIHB HWHHKLIHEPHHDL$HxjY AZA[ATAUIL5H5wG1E1ǪY^vHEPHHDL$Hxj&Y HHD$A^X&HDIHEPH$HxDLjX H=HXZ1HL$L]=11He}LWIFHAw7IWPHH\$H^2DML@u9 DD$)AEDXAv  D|$Et  D$t;t : H]LHu"HCER uD\$E DT$,EgA$ M$L9L$ IQHBtu t  ID$PH8HB DŽ$H@XHH$LL$0Ht$H1Ѕ$ LL$0LMyLIGLL$0 M9  F|$t$( 6uA|$uAQ89LL=>L͟LI 1)LLIIHpLE1H5z>ϡTD}LID$0AlLPLtIH5&>1yH$dH+%(}HD[]A\A]A^A_DI~(H5L\$8HL$0.t `vD$0AI^(H54oH~L}LLgL 7H ~M9 H}LL$0HL$\HL$LL$0IHEHP H HH HHL$LL$0H1IH=TL3t$(A;-AQLANu9 )D9 MyIG}LH}-HHEHP HHHHIP1ɺR1SLL6H]ZYD$0CIDL01ɺ L=21L1ۃLAHLI HHcхuD{Hp(1HHI^"HH58HuHHTHtHH L MLD$0HLDL /1ɺ1H51rHT$tHt$pLe{H$l$tH@I9LL=K1ULLI4 1肔L*H$AHAѹ6 DKLPL1LGXZLh(L=0L,.1ɺ LLH(L迻fL=0L-1ɺ LΓcL=c0L-1ɺ% L觓QLILN1m"LH(#Hp(I$H9l$ YH|$1 =CID$PH8t(QE1E11jLjjHL$(苯H L9ut+=L=!EL1L1΄HE@ tD$1T$t$HL$|L+v]Et$pI$H9T$ HJDj(BLQHAu9)L= AHUA)ƋBEDu(HBu 9D$\$)DLË\$|)É\$|$LH=L DARLlSLD1ɺRAUP1΃H LrEVL=pASLP11蘃[A]|$,HE@ t1LVpL\$ LIH4=HFAD+L$APLAHDºcP1HL$PE1LE1ɉھ${_AXT$t$LuI$H9T$ HJr(BLQHAu9L)ƅ\LC }LILG1pHL$@11LhD$;ELr^D$E8Il$`o1L1ɺ 1LLLك LI1ŁD$DELH8HHk%HHtHHV`HH HV`D9r.1ɺLLiaJLX1ɺ1L?L wLILÂ1HL$@1Lf]1ɺgLL؀L{IHEHP HtHHtwHH‹t$1+t$LH=ǁuH1[]@H-ff.@USH\$ u.HT$8?AEH[]HHH9ehL9tS$UH-ILUH1tXLZ1ɺH1tH1L1ɺKtH1[]@H-"ff.@AWHAVAUATUSHXH$Ht$Ll$0HD$dH%(HD$H1HLl$8Ll$0HL$H9H@HAE@uÅoEu+HHBHH=yH1HHtHtHfDuHzXHtGcuB3t1H1LL1ɺH5W1i1Hf.H1HtGdtuHB0Hf.USHHHo`H0rt,HHH9:wHHxGdHtH$ss@L _ uwHHS`tHL ouJHHH0L $#@uL  DL ~1L;pH5g1H[]@L x~f.L ~HHtH$r L ~뀐HH}H1L ~ZH-`1ɺ1LnH'gLo11H g1L!o1ɺHfHHH L ~AUATUHSHHH?H[XHHS`AŅt HHpxHHNH1tHH9u HHx&fAą;HDžH8"H{PEc9NHCPHH8AąH{P^@HEPHH87AąHCPHH8mAąLKH~1L|H5ZeDHCPH8rt` ΎuَHCPHL jcHL| AąlHS`E1|SHLxmH5H@LHH1dHD[]A\A]LtoH{P&?HA[D]A\A]f.+=fDL1ɺIH5O1'dfL1ɺf1H5%E1cHD[]A\A]fDO,HA Ll`IH51cf.L1ɺp{DLKH?1LkH5`cHyhtHyxHHS`HHa0HAhHǃHHS`LKHj1L lH5bH{P7@%fLMHy1LqH5bATSHHuKHHHt#HHQAąCauYAHD[A\HE1LhkcIH5 1 bHD[A\fHLik1ɺqIH5Ԉ1aHc`nL1ɺl1H5aGf.ATASHHHHt8t>HnAątgHAHǃHD[A\D1E1LjH5aHD[A\fDL1ɺ1H5͇`ff.fHG@tZHHHuH9u0H9ptHH9t"Hvu9Puf.1DHHLjIH5$1$`1HDH9ff.AWAVAUATUSHHHG@5HAAHEAąt`H{HS^HE1HPHH5SILi51t_Y^HD[]A\A]A^A_HC H@PHx HAAHhDhHEH8HAHL  LZvAHPHH5DžHWHHpLD1^;DHE1LLh.IH5u1u^Dx4 HEE1P81LhH5*,^XZDH;HfDLh>H5ׄ]g[ @UHSH8dH%(HD$(1Gd HGP@a覻AE|HHH9u eHH9t]HCHxktHCHxL^hIH5#1#]@ "gH8uK1HT$(dH+%(upH8[]fLgIH5ă1\1HHE1E1jHjj H t$1t_@ATUSGd HHH9ŸHD,tE1AD[]A\:ftHUHtHR HJXHtHGPH1H8AątGE1LgI1H5[D[]A\ÐHUHB Ht9HHt1HILԟ1H5mo[+LJ(@AWAVAhxAUATUSHH8HWdH%(HD$(1HHJPH@hL)HD$ HtTHmfH*|vA^YX,t Ahx=t@x}A9OA)HRXH=L0H{HT$ {AąPHT$ HBp8D@0 ȉ ȃD Ai@B9O;jBD99HBLH(L9tfHH9HEI9tIL%qH{HH1ATI1LfAUH5E1UYHT$@H H: HD$(dH+%(H8D[]A\A]A^A_fH=ELpLDH p@HDHp@HDL=pLD$LD@H{HL$L%pHT$LDHLD$ IH51APHL$ LAdQHT$ 1RAWATE1XHT$PH0HB@8cHƃfHH H*X~f.HQXLLIHD$ pH{HAT1ɺ=UILd1H5E1 XHT$0XYDLLIHD$ pH{IAV31ATI1H5~LcE1WHT$0^_B@L>LIHD$ p+H{IAWLb1ATI(H5B~1E1DWHT$0AXAYfDL,1ɺ1H5 ~W{f.L%Yff.@AWIAVAUATUSH8HGPL0HG`H$H%:H$E111ҾLLD$,1LD$(AdE1,LD$E1ۉD$,IpPHHH9fDH{Gd HWXHGPHLLD$ D\$HT$5,HT$LD$,LD$ H{L$D\$IpPA9DLA9DOH9<$t9HHALhH9tf.HHHHIHihH9uHHH99I9HubHAcEI шL$L9jHmHD$ML=kLELL$HAHEI~H-{MA$jm 1HIXZt$S1L bAWLT$ARTH |$CH8[]A\A]A^A_f.H<$H4$1HHL~hH9tHPHHRHjhH9uI9fHPXHD$,L$(-fDHHH9bHH$H3dHIH9HkH HD$HyH`D\$HI~LAEMA$j HD$Y^D\$&=}HL`11$SAc~0=|HL a11RE`=|HLxa11R4H<$iLI|$MHy VAVAUATUHSHFhHDoTL9r!1IHuA[]DA\A]A^DH{@AąuHEPHLHDL$Hxj HuhIHEPHDL$Hx$` H{IXZbHHWHL`AUI1AVH5vxSwQH D[]A\A]A^ATIUHHNSuHthH5HHnLt2H5$iH[LugEA$[]A\fDE[A$]A\1Lb`H5wP11IٹLb`H5wP1D1HvqStqHLW$LjDL׃ L6h1H5wIX1Z P[fDL_1ɺH5vO[fAVAAUEATUՉSHHDGTHHpt[EuFu HCHH`D$0ADHǃ[D]A\A]A^ÐHCHh`3@AL911ɺ"H5vO[D]A\A]A^UHSHH5-HH1JuEH[]f.H5fHJuEH[]f.H5WHIuEH[]f.1IٹL^H5GuIN1afAUVATUSHHw@H[]A\A]H$ HDjLj H{$DI$L0 H{$DI$L Y^AUATIL]1GH5%t,M_1AX@ HH{$DjL H{$DI$LP OL$$L8]I1H5~sLXZ1H[]A\A]fDAWEAVAAUIATUSHHhH$HL$@DD$(L$HD$H$HD$0H$HD$H$HD$8H$HD$H$HD$ dH%(HD$XA$D$(HD$HD$ LKHo҃HD$HHD$HNE$EDEJ41HHD$8L=6rIHHHD$PH9JD(1IIHD$PLT$(HHDt$LL$@HLD$`AXZELT$(Lt$IHT$PHA6H =H1H{AHI$H;D$8HDLHj A4$$$H{HDL =sLI11L.\H,$JA4$]HA^QHD$8A4$IH9[HD$DE*HD$ BHD$HH{$0DjLI 1LIL\X1ZTIAHD$XdH+%(QHhD[]A\A]A^A_ED1IHD$8IHL$PHHD$(t4 ) E$9Gº9BEL=oA9HH{j$L=ooDL YLY^I1ɺL1@HE$ PXLXIH5o1HE1fHPHLPHA$HD$LMH=HMLHHH`H|$^D$L^1ɺTH5An1AGDL$LLHHhHLL H|$ ADL$L1ɺL1FDL$v@A$%H5ɒHD$L1ɺDA4$HH{$DjL YLX^I1L1 FH$jH{DLw _1AXILXL1ELt$ 1L ^1L^LAxEAHDLHj A4$$$DHLH{ H,$LVIL1DAZE1A[A$HH{jL=k$DLB _1AXIL\L1DE$_fDHL$8LLHUDEA4$1HD$8IH<HH1HD$PH=v>Ht$H!@HA $H=HƁvH΄tHD$PHH{$DjLT A_L=j1IL[Xn1LCHD$PE$R@H4H1HD$(t!w% ) H{L=j$DL9Gƾ9BHj{ AZLTA[I11xLBHD$PE$fD$L1ɺfH$DLjH{ LTH$HD$PLH()@HD$P7@L!SPfD$L1ɺcD@HHH9jPATUSHH9HHHE`t H$H H@L%Y%uSHHH9HHDAąA[]DA\L%YH豱HMPtLPT1H5gE1@ZYD[]A\L%zL%xfH蘞Z}1E1LTH5WgY@LL1ɺz1H5-g/@Zf.AWAVAULATUSH8dH%(HD$(HL9NHH9Hu\AHH}PH'oH}P>^HD$(dH+%(FH8D[]A\A]A^A_D5]9AHgG1HI9MHHH9txHH9uHEPHH8YAąHEPHH8o7HEPH8[5 nty ehu螲HEPH82 mty E1yHEPHH8艴AąHAąyuD57D GHyH}QHEHDVHSILQH5ud1z=AZA[D%xEJ7HEPDUGH8EtmHHE1E1jHjjgH tE<$t>H1I9HDH虭ZL(QIHxULPIL%c1L'>wHTAJcH>HdxHUHSH~SH>HfSHJHA11L^O;H5:HTH@AWIAVAUATIHUHSLH(HL$dH%(H$1I@ A@(蟯HUHLHHEPH HLt$LLIL6( H$xHCt4H$dH+%(H([]A\A]A^A_fDH{HCHGH$HJ HrHtZ1HtSH9UHlfH*HfH*^Y6,ЅDHKHƉS H)HtZ1HtSH9H;fH*HifH*^Yd6,ЅhDЉS$HHH9QGHEPdHHH9Ht@SH~fH*^Y5,ЅDЉS(;H訨LLIH5171f.HhHLLAVI1H57X1ZfHH_1HTH9FHVfH*fDHD$HKHhLLp?IHC@HD$HKHOLp?XHfHH H*XfHƒfHH H*XmfHfHH H*XfHʃfHH H*X1fHƒfHH H*XffDfDfDlfDHfH*X8f.fAыSIuk1H=H  HH=uH5WLHfH3H9uHI9uAMAIH= HLEPApIA3XAPDEB3AAB3 DB3,EAEB3ADABAAED1B3$AÉ(D1303<@343833 @33I9AEt$DH=HH13H9u[Lf~]ÐHDIE1LLIHuHH uGHAR_L-OV1H53XZ1HARIgVL1OAUATIH5}jUHSHdH%(HD$1H$D$ HT$H5NjH AA t@tux$D$AA$HD$dH+%(HD[]A\A]DHEL DHtLLN17H57y2HEL HtL=1E1LNH5762Z5ff.UHSHHHL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1H3H$IH}HD$IHD$ H$D$0HD$s.x/HHcH9s$H)HMHHT$dH+%(uH[]ø$4@UHH0.H].fDUHH0o.H]f.fDAWDyAVI(AUMATAULSHH|$s HfHH|$(KL=rIHkHCLk 6 HtqfKdLH@ II>HPHhtqIVL3HSIVHI>I^tUHXIVL0HIFH[]A\A]A^A_1LLH5Og/1- AUL-Jg1ɺ.ATL,gL1UHSHDOL/DMP11L!g/L/HHt!LHHL g1L11Y/11L g9LL% ''/1LH11Lf;L.}LvfLHP9]LwHLL1[>]A\1A].@HEHH@PHDL$Hxj 1LILfX1Z6R.ff.fAVAUATL%u3USOLH1L5 &L-fA1M1ɺ!L-LHOEL9wHHt]tY1L-ef.HH@HDHt%HpH(1AM1Lv-XZ9]Lw[L]1A\LnA]*1A^G-UfH1SHIeHHHdH%(HD$81H)D$H|$1)$)D$ HtAH@ Ht8u2AHtH@EHD$8dH+%(uLHHD[]fDHCL DHtLLVI1DH5cy,E1_/ff.@AVf1AUATL%udULH1SHHPdH%(HD$H1Ll$)D$ Ht$(LHD$)D$)D$0 Ht%LHH AąHM0 L%f11LL)D$ )D$H\$()D$0 HHT$H5Hi Ld$<Mtf11LHII)D$ )D$H\$()D$0 HHP HHsHgAHD$HdH+%(HPD[]A\A]A^LHH~ Aą6HEL gHPHHCHtLHLGR`DHEL ,HPHHCHtLHLzHRz1H5aE1Q*XZ6f.LuLI~PHH@HHHH`H@PH, fDHEL HPHHCHtLHLFRVH57a1)^_DHEL <HPHHCHtLHLBGRs fHDžHCIVHL HtLHLFRi,ff.ATI1H5HaUHHWLL+) E1 HHtHPHH51a1L(t1H5aL( LAT$ t!HHL]HA\HtLl1ɺiH5=Q(H1]A\HEH{`LH@PH1$$L 1ɺH5j_'@L1ɺH5E_'H1]A\L1ɺH5_'C@L1ɺH5^q'ff.AWMAVAUATUHSHH(dH%(HD$1H?Lt$`Ll$hHT$LHA AąHt$HFIHIEH~HMtAGP1HHAHtY1HtRH9YH fH*HfH*^Y9$, =D‰HA HD$dH+%(2H(D[]A\A]A^A_f.L,1ɺ1H5]&DIHH $LL$ H $LL$HHLL$H$Ht ED%H$dH+%(XHD[]A\A]ÐHL$ LL$ӍLD$H5v@AąT$ H\$L$L-cCt$L$9retK.I1LL/81T$ H L9utA FH $@C9wuC9rfDC @D$t uD$uL O1ɺ;1L7H5ZDLL1ɺ(1H5/DAWfAVAUATULSH(H|$H$L$`L$hdH%(H$1)D$p)$)D$P)D$`HI@@@7uL@HEHD$H@HD$(% HD$HHB1Hl$ HE1Ld$011E11AHII-DEu]Lt LHH ŃH9HH@`t MIM LuIALu?EAE!EtL61wH5rf.AI1HT$LLt D$LH}L5KIH5q1H$dH+%(5H(1[]A\A]A^A_DHD$8E111HD$ HD$H@ H HHT$0HЋT$0IHEHD$H@HD$(% HD$HD$L$@DŽ$ML)H|$$uSLt$pfo$fol$p$$E@$$ED)$$)$E8H%XE1D$$HD$ H$@AHA$THLuK HWLL4 H$\$@fo$fo$fo$P4H$X0H\$ fo$H$HXh$ H$HH$dH+%(DELH|$LHH(1[]A\A]A^A_fDHD$Lx(fHEL 3RH5LHH1tWH|$|DŽ$EL$Gf f1Hl$8Hl$ Ld$0UHHD$ HA@L21\H56HD$( $EL$gDL1ɺH5L1ɺ1H5oRM1LIH5hLHHLM21cH5h$E<DŽ$$HD$8HD$Pfo|$P)$fo|$`)$~USHdH%(HD$xt5iHӅt6XHtHT$xdH+%(HĈ[]HL$LL$LD$ H5j8t|$uL$ tf jHl$ PHJLD$HL$H1HT$H5x AA|$|$|$jjf.HGIHWHHp0HBPH8>rff.HGIHWHHp0HBPH8rff.HGHWE11Hp0HBPH89 ff.@HGHWE1Hp0HBPH89 ff.HGHWE1Hp0HBPH8\9 ff.HGHWE11Hp0HBPH8/9 ff.@AUIATUHSHHHt)HHH9ƸHDr)AąH]L%3H9u5DHH9t(HsLuHA[D]A\A]@LHLbAąu1L5/H5D HD[]A\A]f1Lj1ɺH5CO HD[]A\A]ÐAUL-^tATIUHSHHH9u 3HH9t(HsLuHA[D]A\A]@LLHAąu1L.JH5 HD[]A\A]ÐATHUHH#IHtrHYHID$ID$ HID$(nID$0Ht IL$ML$(L11H5B HL]A\L1ɺ 1H5iB fDATISHHHAu*-Dt tID$It A tHL[A\ff.fAWAVIAUIATIUSHHHl1ɃIILLI)ىL$ Iǃ,.t1A?:tIH[]A\A]A^A_I_HL$ IILLI)Iǃ+tA?:tI_f1uI_H1IغILLHI)fH]Xf.UHAWAVH`AUATSHHdH%(HE1A H`L5̏HH`L9 IFHHH%H)HH9tHH$H9uH)HtHL OLd$IHKT4I9sf.I$IL9wHDžPE1LpEfLHHHX2IHPLMt*ILHI9sLHHH9wLHXH9w9DA)AA u@IcHPHUDLHHfA uE~ELy*11H5A iOHHHt$HxHfHHH9wEt1LI|HA9HEdH+%(u]He[A\A]A^A_]HIHHHs됐HgHHS ff.AWAVAUATUSHXt$H$dH%(HD$H1tP0NAHD$HdH+%(IHXD[]A\A]A^A_f.H$H"IE1H-^L-?HHH=a|HtI9r+HH!HH HH,|=6|11 HH!HE1/HH)L9{Hd!IL9hH5{={L)LHuH4!L9;H{LAB3 D\$D|$H HD$Hu>EHDHD$ H3IH,HL$@HT$8HHHD$PHD$CPHD$JP1LL$QLD$PWH D|$0rLcl$4L5LILLHIHLI9uHD$@H|$HD$ HD$8HD$(DHD$Lp Mt3fDA>uM~A?tLLmHMvMuHL$ H|$(HL'H$II)L0AUD$;LHPD$BPD$IPIHIjr,QH WPLL$H1]DD$PH@LH|$8ENI\$\@F8L 1LPH|<UH5QP5 8D1ɺtHPHL kyPLp1E1[]]D81ɺoHPL *yL01AUeA^A_8L -1LPH PH5PsIL;H1D$H=wxHL%H1E1i~H SLL$L$H1AYAZUD$L D|$HH:L(;LEHHD$01CZYZ8;Iٺ6IH .HHEHH :APLzQPH1H D$L5ML=%:HNL9M>ILLHtSL$AWLL$SL#AVLL$S$L$AWLL$Z8;Iٺ1IH .HHEHH APLzQPff.AUATIUHGHWLH@ 1H59LHE@ t%U82HE@t U<EU@RUDUHt1H59LDILAT$ tiH)gHL]A\A]JfD1H58L_U8uXHEH8L@HfHEIAT$ LuL1ɺi1H5l{]1A\A]1H5c8LuLW1ɺH5L$ED$MMIpAfAAwՃA:@LHfED$AH<$I(M)y H`DfH 8LhH4vI>H4Lx HpINL0HHINHIFL}EHL}HEBDx uD}IH$EtnHfL8HfE(1ɀ}:AH$H<$LtL$E}DI녃|$M9M.Ll$M9u\ 'MmM9IEuIE1Im L=^:MuI9HEH61IEH|$I :LHH9tAGtH@H9uA<suLLuHH9HDIEP w4Ht$Ht*HF86HH5C6HpIEfM1LH5*y@IEHI9f.HP !#/H@I9HuMmM9}HD$-L 5A-A-MQ;Qt#I΃ 9BA9DGI9HHHH9uL9HrHAD!I9tHHL /M9 mHtHN / xLJL\@H= 6HxH=5HxH 5HHMH<$LE1~ H$dH+%(\ H(L[]A\A]A^A_f9FՃEI9HD$E1A1۾;D@A9t91ۃ HI9HHQAAutAt E9pEE1EAfDHD9?AA1i yHz }LRLfH<$B HD$HHD$HHHHHL$ H5*j DDL@t$CfEt$H.@IMH$H$1A-L MIH9 Hr I9p LJMPHJ1LJ1LH5&L1 H5&WH<$1 i-A-A-H|$Ht$0wfoL$0foT$@fo\$PHD$`M<$)$)$H$HDŽ$DŽ$)L$pM9b1Al$1Dl$LMMDt$I\fC CHct$HH)HHH)H9HOHiҀQIאI$LI9IID$CvCу w$DSI|$ 1IyAOtitSIIڃIDH낍CvS n eH5/HcH>IQLDA-l$0D$|'HD$p0D$x 1ML H5$9GMl$Dt$LDl$A)A*A#A-A!H|$pH)HD$ HD$(H$H|$ H$t Hl$ H|$(H$<H\$(Ll$ H<$LH$ 1ILH' H蘍 HH<$HXH IHC3$A$DfAD f.?6 HHHcLt1 H5;&L&H-"1E1HtLp113HWtDŽ$D$|.LRMHHJ1wH|$pD$pH)HD$ H;HD$((Eك-JH|$pH)HD$ HD$(!H=HD$ H*HHHHH?HH)Ћ$)H@H$H)Ƌ$xHcH9~  $)%HHB8l$xHiŀQIHHBP 'IHiIHiŀ: Il$p)$sl$tjIbHHH)M*MLDH1SHC8ZYHt Hx~ HkhHtHUuH, HHkpHtHUuH HHkxHtHUuH HH{H[]U~ DLH1[L]GH5w)ff.@HtGUHHHtH5Lqu]H}@H}HH]Dff.@AWAVLAUATIUHSHDHEufM$I$Il$PHHM$I$HHHIt$`6H[]A\A]A^A_DL9tE1H{hHAL9uE9wTH11L-,(DL:L~XLylZ1ɺxL1_H ff.AUATUHSHLgHH_PLH|HHHPH0HQH H0H8H0AHPH8HH8H[hHm`6Ht>L4HsLHI  u]Lk1ɺH5'~HD[]A\A]1ɺE1L]kH5&NHD[]A\A]Ã+HD[]A\A] f.UtLeSHFH!Ga u/F=ArHD[]At@tHGHDL$Hxj _AXILe{1H5%MHE1D[]L1H5%HE1D[]HGHDL$Hxjn~ HHCDL$Hx$0~ L!H5 %I1H,$eYE1^HGHDL$Hxj} LIXZAWAVAUATUSHH(DG`AA9HGHx)D9H{DHGH@H@PHt HЅHHEDHJ聚HHEDH YLHHD$I9H\$DMeID$@A$HHHH9HrI$ADHID$@HzHHnH9eHrI$ADHN 藙tM$I$I9uDM6I9I~ uID$@HHHH9HrI~ADH HID$@HHHH9HrI~ADHۘc1ɺD$LfH5#"DL$fDMmL;l$dAH\$HHHD$H9uDLuADHIvHI~pL[MIHD$I9Hl$IvHI|$ ADHIvHI|$$ADHIvHI|$PADHmIvHADHI$蚗IvHADHI$dtAD$LE1t=DI$H@HHڋHAE9l$LwM$$L;d$Hl$HmH;l$fDAH(D[]A\A]A^A_LL1H5- E1뾉D$Ld1ɺH5 1kDL$@H5y>@H5is@H5YZ@H5I@DH1HH[L1H5yE1fD$Lc1ɺ;f1ɺD$LcH5 DL$D$L{c1ɺD$Ldc1ɺELH50E1V1ɺD$LcH5DL$)1ɺD$LbH5kDL$IvHHzADH Ԕ1ɺD$LbH5DL$HzIvHADHHzI$IvHADH{H|HK1ɺD$LbH5DL$$1ɺD$LaH5fDL$1ɺD$LaH59DL$1ɺ D$LaH5 yDL$D$Lga1ɺ1ɺD$LDaH55DL$Y1ɺD$LaH5DL$,1ɺD$L`H5nDL$AVAUATIUSG`HGAH@@`tu(E$[]A\A]A^@AI$M$L9t1H{\HL9uA9sI$M$1L9tDH{O\HL9uH;1AAVLH5|X1ZFL1L3,H5E[1]A\A]A^f1L5H5p1fHG`trHGH@@`tuHÅDA9vHW1LZH5X1ZL1LHH5M1HfDy1LQH5x1<SHHH?dH%(HD$1,u@{1Ht$9CT$1HT$dH+%(H[38lHL fPH^LhPHH5IP1H k8HL x}PHLPH51AQjH 1:Jf.UHSHHI HH@ Hu+eD8ukHH9t HcHLH@Ht<~LML1H5W1H[]@H[]@LMLfLML(H5j1fDAWAVIAUI1ATIUSHdH%(H$1H|$@D$$Hl$@HID$PH8UHT$$HHD$@ID$PH8ID$PLHHx9HD$HIMD|$$H HD$H$IAVLT$ H)ID$PL$HD$DLHx@j4DڃH o L$LIH5%D1 $1LT$AGL$HHLTPL1LT$b LT$AN xAGHcD$4HLH|PAXAYJADHV1a A~7tAHPD|$$McJD@I$I9$EHcD$$HL$H1L|$0L5JHL@ID$PLH8e HHu0 HcHt$HHH譼HI}u1HT$(LH{uHD$(HH4ID$PIuHDL$Hxjm LL$81H5PBH$L{A1"Y^LADžIMHPH|$AI|$PH1ҋHHIH9tgHHLDL$Hxj0m LA1H5AIX1Z\jf.H$dH+%(HD[]A\A]A^A_@AL)X11 H5(A f.L.0LIH5@1E1νifEAAKf.AHH$H"IcǾHH\@1^ HD$DPMcI H 1^ D=IٺJL>11H5!@ (DLL$@L1OH5?׼rfLx- LIT1E1LH5?聼LL$@8L^}Lff.AWAVIAUATUHH5SHH(L$L$dH%(HD$HGPHD$L8DL1ɺ1LL޿~IFPLLLD$ʹH|$H UH$LT$HI)LT$M9 LA>IFPL\$HLLT$HDL$Hxji Ht$HIFPHDL$Hx$Ai Ht$LI1H$xXE1ZHD$dH+%(H(D[]A\A]A^A_DI̋$H4HHt$ hL"T1ɺH5=E1fL*L=1LIL޺1ѹ3IIFhHD$;fHH)1IIVPH:LȉID$HjHh =AZA[L[<I1L21L+ L@1LH 8LIL1҉"HiIIH9oE<$LjA$oM4oU DHM0HTM8`\ dIN`@Hh`? @HT$HLL$)LI^LL1L$LT$LT$L$L$(L|IH5:1ηD$RDLQ1ɺ}1H5:蟷E1$LQ1ɺH5:qE1T@AW>AVAUATUHSHHHHWPdH%(H$81L$@LL:HFXƄ$HDŽ$P$tHF@HH$CHL$L$DŽ$uEp$$H$H$%H$HH5^QH$ 1H<$HLH$H$(HDŽ$0DŽ$@DŽ$HH$H$#7H$IHo=)Lc@HMHMXH$HL},eK\LCPH$$HHsH}PLOIHcH[@HH$8dH+%(&HHL[]A\A]A^A_f.H@ H@XH>1H$LЅ'H$LgLH(fD5uFjCd11HPDKhDC` ZYK\DHEH1L'1H57蟴K\H<$H4' LH!' H4$L ' uHEH1HLH$X1H$XLx1H$Hh1HHL9HDjJHLII9HDE111z<1ɺ-E1LMH56谳LL$1LHLL$T LL$kH}PLιLLL$hLL$HLHL AL5M1ɺH516D1ɺE1LLH56SfLL1ɺ 1H55E1輲!LL1ɺ1H55菲f.H(#L/IH5o51E1NfL賣M1PHuH5>PL>1^_W u;,ED$D$,bD$DL$K(L}1H5胣;蜝11ɺLa=H5pM1H$8dH+%(HH[]A\A]A^A_fHt$;DHD$H9$HD$H9$21D $L=DT$H5=諢DT$D $DA>M1PHcL/=PH51cXZ@A>A<$MIH\HRHDHH zxAPH5.LQP1H 1DEDUA<$MIH[HHDHH 5APH5ÙL.QP1蕡;H 誛hUHSHHHL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1H3H$IH}HD$IHD$ H$D$0HD$违E1x"HHH9wHH9tH)HEAHHD$dH+%(u HD[]d@HUSH-.tdHoKHH)fDHAu.t_t +uI:Hu=DH[]DGt <.uuH[]ø뺸UHSHHH_tKH HHGt3HLIMu!H[]fDIٹL41H5  H1[]UH5OHǚt3H5CH诚tH]H]fATIUHHHt"LH IHt7HL]A\@HHT$kHT$tRHfHLIH5̟1HL]A\fDHHT$uHHE`HH!H9tH.Hc:H/HQ(H4HH%rCH&H-H'Hq@uHT$HHHHHf.AWAVAUIATIULSHH(D}LH Lt$`LT$hLD$pDHHE0% HHE]PH@P9IAsA0EPHH9pH9eHL$HzHDD$H)HjDLDJ YLIc^I1ɺH5Hj1L$DLҾLm HHH1L1$IHpbE1 u $fDLi HHH5x1ɺ1LP5H5L751ɺ1!@1HuaHuLHFPLNHLփLp@hH(EL[HL]A\A]A^A_1f1AfDLEH~LA@a HEHL$IHHE#LLHHH51H4$+H4$f.L41ɺy1H5xfLLD$LT$H$D H$LT$HLD$HLD$LT$H$HD$MHL$uLLD$LT$H$H efDLl31ɺiH5QH(1[]A\A]A^A_1L:3H5AL311|H5DxE1 nԒ0 $WLHL$;HPIHHT$H8TC HL$HH+HT$LHL$HAp$tH5iLHL$H1A$Y41HQXA`DydHAhVfDL1oH5I>A}HWtLHL$P HL$HHǂHLHL$HT$N HT$HL$MH5L11ɺۡH54HApH5t1LKH5H-1HL[H11L0JHݖHL@LHHmH}OLpH5IHEH@PH /11Ƀ`HEH@PH M1H5NLLH5DUSHHHt$(HT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1Hl$ H$$D$0HD$Hl$'@ƒH$H2Ht.HHHu$/vHT$H2HBHD$HuHD$dH+%(u HH[]ff.fATI1UHH蓘Ht>H_QHHtYHxL轗A1Eu EH]A\fE1L1ɺ8H54{H1]A\ÐH1]A\fDUSHt[HoVHHBu6.t1_t,Cըt%/t =t!t:t&t #u]HuH[]1@ATSHH=tAHD[A\f.H=VE1葕Hu跐HHHIHt7HώLŌuH=E1衔Hv|L%U1ALLSL1LRKLY1"H5̒AU1ATIH="USH1HHLljEH9u(A蓌HD[]A\A]D胔L-h8赑HL PH|LPH=LP1 H AątL1L+1ɺ~E1בHD[]A\A]fE18!HL PHLwPHH5P1qH DH[]A\A]1LR+1ɺH5]7HD[]A\A]fκAULATD 3L%^`ULHPPPP1ʐ5H uVt ]A\A]DHYL ZH_MV91ҏ 1L1L@ ڹtV1HH~[]LL)A\1ɺ4A]fD1ҾHT{u=pL-iu#Hh"H;L0 1L1N襑8ގL 1L*PH+P1LAXZf.˅fDH PL]LL HA\L1A]GԎ]LLhA\&1A]鯎ff.@UHx1ҾdHH H1ҾH'dH1ҾHH Hvd]ff.ATUSRI11H7ÃtD%wD9V[]A\f}tDL(1PHoL GPH51裍_AX[]A\11Dlu8HAٹATH5ԅL]Y^[]A\fD}踌HE1P1LH5XZ[]A\2ATIUSuHH5LtEM1LH5.辌u[]A\H0HHHH9t$@HNH0HHHH9uM1LH5`/HdfS11u6AٹLH5Q[ D84HA1P1LԿH5 蛋XZúf.fATLÿIUH-ɃkSHHD ~dH%(HD$PϴPTP-P1H t1 tHD$dH+%(H[]A\HH$L HtMu8HL]HP<1蛊A[[@11LEBHkA$upHLu1ɺEHL9$1DEteStA uH=l_GH1L ,Lɉ=RՃufH=2L%.H$HI9a!HLH9vnHHMSLH1ɺO1R^_&v8诈1ɺJHPHL PL#1AXAYXHT1SML>HZYŋDHCt Mt HfDHwAWAVAUATUSHH $HH $H8H<$HHHT$dH%(H$( 1D$HtH HD$ E1E1Hl$ A L-@AAFH IHtIcL1LH)H) yL%DI11LGL複όŃKHt$11҉A9D$AApHD$AHt fDH$( dH+%(H8 D[]A\A]A^A_@H<$--t tgDEtkH D$ HHl$ E18!HALPLg1\艆_AXI[f;fHD$L HH1LRLIi1+Y^@<1E1LH5@LL1E1bͅE18!HL ?PHJLPL1AQ{H :H1LrLRkMXZ1H<$1ҾrJ UH;HE8H{L LIH>HyA9HARHDAPL]SVP1Ą}H (AUATUSHHdH%(HD$81HD$HD$HD$ HD$(D$0D$ u#HD$8dH+%(HH[]A\A]@H=R HHH)HD5HH1mAău=DMAL-pL1L"调XE1Ҿ裂ZD}t}L-߂1LIPWH:PL 1FY^oL-vL1@LH|$/|L1L _Hl$ LbӂHIHPH FLSPH YHnH5HD$(PH|$81讅H H|$1HT$ H5誃DL$ ETH|H|$肀H|$xDMAAoDL-Z0|}pWI1PHLPL1ׁXZALL1x譁UH5)H葈uMH5>H~u:HLS1Lt$0L UP_AXHL 5L1t$0LAYAZL1LALL1赀NL-1LƶQL艀Dzhl_f.DHHBHI`@( H%scH3sDH HJHJ t"LR1ɺ1H5gHDH HJHJ tH 9HJHJ tff.HH׃Au5HHHHDH m9HHHDHG HWHHHH{H5nHDHaHD HfDHH׃Au5HH+H4HDH 8H7LHDHG HWHHHHH5HDHHD0 HfDHH%Au;HHHHDH K8HJHDHG HWfDHHmHHSH5FHDH9HD蘔 Hff.HH!Hq@HH H9u<@HH9t0H;puHH51AuB- HHH5v7AtH5 HfH5 Hf.HA`H׃Au8HHNHWHDH 7HHDHG HWHH%HH H5HDHHDP HfDHA`H׃Au8HHHHDH p6HIHDHG HWHHHH{H5nHDHaHD HfDHA`H׃Au8HH.H7HEH 5HHEHG HWHHHHH5HEHHE0 HfDHHAHHAH91fDHPHHHH9uEu;HjHSHEH5 5H3vHE蘑 HfDH/HHEH5HHE] HHH54EtH5@HA`H%Au6HHHHDH ^4HHDHG HWÐHHHHkH5^HDHQHD谐 HfDHHHA`AH rĀtz%u9HHHHDH53HHDE HHHHHDH5HHD HfH5[3HtH5DHA`HHAu4H[HdHDH 3HHDHG HWHH5HH5HDHHDa HHA`H%@Au6HHHHDH ~2HHDHG HWÐHHHHH5~HDHqHDЎ HfDHA`H%Au6HH<HEHDH 1HHDHG HWÐHHHHH5HDHHD@ HfDAH׃yHt(HHBHHB @HHQPRu:HqHzHDH5XH1HD词 HDHGH0HEH5HHEu HH<HBHHB ff.AH׃yHt(HHBHHB @HHQPRu;HHHDH5vH-0HD HfDHWH@HEH5-H(HE腌 HH;HBHHB ff.AH׋QuGu#HHGHHG H;HGHHG @HQu5HHuHEH5./H3HE躋 HÅHGHPHDH5/H&HD腋 Hff.AH׋QuGu#HHGHHG H:HGHHG @HQ(u5HHHEH5N.HHEڊ HÅHgHpHDH5OHFHD襊 Hff.AH׋QuGu#HHGHHG H9HGHHG @HQ,u5HHHEH5n-HHE HÅHHHDH5oHfHDʼn Hff.AUATUHSHHL)LpH}L`L Ht,LLH~yHCHC H[]A\A]fD1L2ZH5H }H1[]A\A]ff.AUIHATUHSHHoI}L`L Ht,LHHxHCHC H[]A\A]fD1LZH5k|H1[]A\A]ff.AUATUHSHHHHt HHtH9uOL-{L8oH}L`LX Ht3LLH%xHCHC H[]A\A]DLjf1LZH5{H1[]A\A]ff.AUATUSHHyHuHAPLMuYH*AHCHC HC@( t"L1ɺ1H5e({HD[]A\A]f.HL%nH}LhLE Ht0LLHA wHCHC HD[]A\A]fDZ1E1LH5ժzkAUIATUSHHHAH@ toHBfHPHtWHjmI}L`L HLHHAMvHCHC HD[]A\A]@uHx)AHCHC HC@( t1L1ɺH5yHD[]A\A]@@AHHtHH9t$fZ1E1LzH5Xy>AUATUSHHHAXHtVLhHLGlH}L`Lg H~LLHA*uHCHC HD[]A\A]@H](AHBHB HB@( t1L1ɺH5ܨxHD[]A\A]ÐZ1E1LH5hxqAUATUHSHHL MtHLXkL`H}Lx HtCLLHEtHCHC H[]A\A]DAL-o'f1LZH5wH1[]A\A]ff.AUATUSHHHAHt H@HuUH&AHCHC HC@( t"L'1ɺ1H5yOHHHHw1ILZbL1ɺ1H5LSHD$(dH+%(HD$LLLE1HGH8[]A\A]A^A_d f<1҉ILH=|{YA1ILH=QfYHHHt$ H{t|H|$ H5:ugCsHE` IEP@A}CSIEP@8A} CCIEPuHHH9{FrLHH@HHHLVHRHH)fHH9HPBgt9A}tCMCI9CmuI1/LH< MHϔthHHH9t/HPHtLzMtHRXHt AGbtH9t8HH9uLMHL1H5m/S6ItL+HHPH{HHH9EH<pLIkHI~L;yID9wLJHuHAwHLӇ1H5.5XZ^I$sVAtHOHH6HH9&H@0%HSdA@mDM_vAMI%t=I&T-AI"r9lAHHtI$skӁt4oHRHݮBiH胓u-H轭i8 SsViHHt$ HT$tHT$HD$ 1LхH5-F 0uH1AwHrHAV3HD$@H B<0A:LJHuHAwHLMOHLQuHPE1LuHH5,AwHrHd3H IfDAWAVIAUIATMUHSHHHHH@LxHL0LL`L HHL1H,L H MHLH1 LeL0LL`L8 HLLH9HLHH H[]A\A]A^A_HpulL{HLA$ t^L/LL`L HHusL71H5Ji1H1[]A\A]A^A_fDHSHH}HL[]A\A]A^A_b fL~ DL1HK+L H AUHATIUHSHHHz;H s;H}@AH9ufHH9txH;zuL HL81H5w01L 1ɺH5*h0H1[]A\A]f.LS HtaHH҃ⵃxPHH҃mPHCHC HC@( tI1Lh1ɺH5j:H[]A\A]1@fPduDH[]A\A]E-uOшAfUHHSLH(u?HHHHDH5=HVHDE H[]DHHhHHDH5THKHDE H[]fDu'HHEH5HE H[]DHHEHHE dff.fATHIUHSU HlH1HfCCHE`%HwHE`HೃzCHE`HൃxCHH9O1DHPHHHH9uགྷpCEP*(&$-ScEatVCID$I\$I\$ @( u[]A\@1L|1ɺH5h7[]A\@H-Htb-຃sDL\1H5 -1L 1ɺH5Nd,[1]A\@-1@HHTݸָϸUHSLHHHt4,t+HH5H{u4HB H[]HYH5tH5:H53UHSLH 6tFHAPHHt ,u-H~uuHH5>B H[]fu'H~HEH~HE H[]DHHEH~HE H[]fDHH5f~A H[]ff.fHHH9t(fLHAAt LMuYHH9uHHBHB HB@( t@H1Ly1ɺH5Oe5HLHfSHHHH9t#HfHPBt HHuHH9uH/fH 'HtBHCHC HC@( t"LIy1ɺ1H5d^4[1L 1ɺ0H52a)1[ff.HA`H-rH%s2HHH9t&Ht!HHHHt-D@uHNHBHB HB@( t8H1L{x1ɺH5c3Hf.SHA`HHH-rH%ssHHH9tgHtbHHpHtRH HtMHCHC HC@( t"Lw1ɺ1H5&c2[f@uHVLl 1ɺ0H5_Q(1[ff.fHA`H%rH-s*HHH9tHtHHtHHBHB HB@( t7H1L w1ɺH5^b!2Hf.SHA`HHH%rH-ssHHH9t`Ht[HHtOH FHtQHCHC HC@( t"Lhv1ɺ1H5a}1[fDHL 1ɺ0H5?^&1[ff.fHA`H$rqH0rj HHBHB HB@( H1Lu1ɺH5`0HHHH9W5HHtHHH95HHH@HHH94Hhf.SHA`HHH$rjH0rc HjfDHCHC HC@( t"Lt1ɺ1H5_/[DHHH9[4HHtH HuL 1ɺ0H5N\$1[@HHH93HHp@HHH93Hh{ff.fSHA`HHө@uĀt#HHH93H8tJH/HCHC HC@( t"L_s1ɺ1H5^t.[DHpHF`tĀt@uH Hu1L۽ 1ɺ0H5#[#1[ff.HA`@uĀt#HHH92H8tIHVHBHB HB@( tPH1Lr1ɺH5]-HHHHA`tĀt@uff.ATHSHHHQPHqH"Y HtMHCAHC HC@( t"Lq1ɺ1H5@]-HD[A\1ɺ;E1L} H5Yn"HD[A\AUIATIUHHSLHHHtHILL[H]A\A]HID$ID$ ID$@( t L%qH5{\1<,H[]A\A]ff.ATHHSHH臙HtJHCAHC HC@( t"Lp1ɺ1H5\+HD[A\D1ɺE1LE H5X6!HD[A\ff.ATHSHHHQPHqHV HtMHCAHC HC@( t"Lp1ɺ1H5`[#+HD[A\1ɺE1L H5W HD[A\AUIATIUHHSLHHHtAdt1lHHt4HILL[H]A\A]fuHHXHID$ID$ ID$@( t LoH5sZ14*H[]A\A]@UHHSHHHHtAdtk趯HHp HqHt\HCHC HC@( uH[]fDLn1ɺ1H5Y)@uH@XL 1ɺ0H5_VH1[]Hh@AWHAVAUAATUHSDHdH%(H$1҅t]HPhHtTD:LrI9tHHLD& HH`Et[uVDADLHrAąAH$dH+%(CHĘD[]A\A]A^A_DHAąuL 1ɺ1H5CUfDHHH`AHH$szHHH9,LrXMLME6HR`H$Ld 1ɺ1H5TGfuLrXDH$^L 1ɺ 1H5RTE1fAWIAVAUAATUSHHxDD$ dH%(HD$h1DLzpHjpL93Dl$ Lt$ A6fEu90HPHDD$ AąM?I9IGuHHL@$ HHHAąIG@AHHHL$LpH9t{HD$ HHD$fDM~pMtMH|$L1Ҿ@# HHHwDD$ DLHIFxLpH9D$uAHD$hdH+%(sHxD[]A\A]A^A_@HHD$ LHD$I9ufDHmL9HELPABdtIIH99*L9xXt L9uH|$L1Ҿ@LT$" LT$HHCHLT$oLT$ODD$ 1DLH]1ɺ}E1LR H5QCfDEIMI9D|$ Lt$ AHmL9HEtEt1HHL@#" HHHHE0HPHDD$ u1ɺE1L H5PuLl 1ɺb1H5POf.L< 1ɺ]H5P1E1L 1ɺ_1H5RPf.Lܲ 1ɺj1H5"P`f.1ɺlE1L H5O/f1ɺnE1Lm H5O^LU 1ɺy1H5O81ɺ{E1L H5oOL 1ɺ1H5NOL 1ɺff.AVAUMATIUHHSHH dH%(HD$1H4$3 HH@HHD$HHtulH1EH1AA^AƅtWIGE1LHHT$m( AHD$dH+%(H D[]A\A]A^fDHPDHt$H<$r Lΰ 11+H5NLg E1H5gL 11"H5MHD$Y:?ff.@AVAUMATIUHHSHH dH%(HD$1H4$ HH@HHD$HHtulH1EHAAAƅtTIGE1LHHT$& AHD$dH+%(H D[]A\A]A^HPDHt$H<$ LN 11EH5L1Lhf E1H5>fL 11<H5ELHD$=ff.@AVAUMATIUHHSHH dH%(HD$1H4$3 HH@HHD$HHtulH1EH1AA^AƅtWIGE1LHHT$m% AHD$dH+%(H D[]A\A]A^fDHPDHt$H<$r Lέ 11H5KLd E1H5dL 11H5JHD$Y:?ff.@AVAUMATIUHHSHH dH%(HD$1H4$賽 HH@HHD$HHtulH1EHAAAƅtTIGE1LHHT$# AHD$dH+%(H D[]A\A]A^HPDHt$H<$ LN 11H5I1Lhc E1H5>cL 11H5EIHD$=ff.@AUATIHHUSH1H菇HtJHHI<$LhL/ HtzLHHAHCHC HD[]A\A]H-AHCHC HC@( t1LX`1ɺH5KoHD[]A\A]ÐZ1E1LZ`H5uK8uAUATIHHUSHӺH蜆HtWHHI<$LhL< HLHHAHCHC HD[]A\A]fH-AHCHC HC@( t1LX_1ɺH5JoHD[]A\A]ÐZ1E1LZ_H5uJ8lAWAVAUATIUHSHHAA$IxjEHM# ZY8HI HLxL IHLLHH HHHfH*LL% H[]A\A]A^A_fD1L 1ɺ, H52FH1[]A\A]A^A_fDL]/ 1H5EH1[]A\A]A^A_L4 DH؃fHH H*X1f.HLDIpdH%(HD$HL9t HtAdt8HAPHዀIH$HT$dH+%(u-HfDPLDX(Av H@D+PMM)ff.HdH%(HD$HAH@`@u; u4HQHBH`HB HT$dH+%(u)H@yHuHAXHH@HH$R ff.HdH%(HD$1HHH$ HT$dH+%(uHfHdH%(HD$HAI H@PHHH$HT$dH+%(uH_ff.@HdH%(HD$HAI$H@PHHH$YHT$dH+%(uHff.@HIdH%(HD$1HHPHHtBdtlHPHJ t/HBfu*Hu%HH1H9ufDHtHTH $LHHT$dH+%(uHÐuIT<ff.HIHq`dH%(HD$HHtgH$s0HHt[HH9tOHHtCH@hfDDEulH@H@hH$Ht$HL2fDH$ru_H|HBH]HB HT$dH+%(u=HH$s!HHH9tHMDHAhk" fHDdH%(HD$1EtHHH$ HT$dH+%(uH fDHDdH%(HD$HtIHH$HT$dH+%(uHf fDHdH%(HD$1HHH$lHT$dH+%(uH fAWMAVIAUIATUSH(Hi H|$dH%(HD$1HtGH]HH9t:IHCH@PHt HI9LGHH9uIu fE1H|$LHL$MLLd$HT$dH+%(uH([]A\A]A^A_L ff.AWMAVIAUIATUSH(H|$dH%(HD$HA H}HXHhH9tpIHCH@XHt HI9LGHH9uItAH|$LHL$MLLd$HT$dH+%(uH([]A\A]A^A_DE1~ ff.AWMAVIAUIATUSH(H|$dH%(HD$HAHXHhH9tyIf.HCH@XHt HI9LGHH9uItAH|$LHL$MLLd$HT$dH+%(uH([]A\A]A^A_DE1 ff.AWMAVIAUIATUHSH(HIH|$HYdH%(HD$1HAH9t|IDHCH@PHtHHMI9LGHHAH9uItAH|$LHL$MLLd$DHT$dH+%(uH([]A\A]A^A_DE1fDAWIAVAUATIUHSHAA$AIxjEMH0 ZY8tyHIHLxL IHLLH H HHfLLH* H[]A\A]A^A_1L 1ɺ H5R<H1[]A\A]A^A_fDLS 1H5<H1[]A\A]A^A_L ff.fyxtHxDHHBH~WHB ff.AIхtH0IfL链 H֋钿 fH֋Q 避 H֋QLq IҋQLIrv0HfH@@gtttH@Hǃ8tHA+PA@ t 1ADLL H֋uH<HFHVHF ˾ ff.HAHIPu+u HHFH6VHF @DYLEtHAKE1H IHLfDHH9tG8uHxLHI9 Iyu AvHAH9uDEt E9<L H֋Q$ HAH@uHHBHeUHB 饽 DLIH1IAIIH9tfDHH9uIA(MA(I9t1fDHI9uN ff.LAH1I@II9tfDH HI9u H֋du At H;PHFHvTHF @HHH1H9t%@L@HMAIH9uz f.HA HHtPxX HHBHSHB @AVIAUIATE1UHSHH9t H{藖HAH9u[D]LA\LA]A^һ fHLH1I9t@HI9u頻 HHH1H9u 2fHH9t(L@ItA@duHAH9uK ff.HH#A`HtHHH9PM 89r~f1LD H5)\1hAMALL=,ff.AUIATIHUHHdH%(HD$1H$UuEbuXLL` (fDHH=VH$HtԋP LLF HT$dH+%(u1H]A\A]@HH1H9HDHH$`AUIATIUHSHHY`dH%(HD$1H$H r:HID$HODID$ HT$dH+%(ulH[]A\A]fHTtHEPH H8sHHUtH$LL( fDHAPHHH8N) uH]``|ff.AUIATIUHHSLHdH%(HD$HA`H0rjH%rH-sD$ A3LK#D>E=m>?H`H#C`+Ll$H{ @L譹tHHSHLLHD$L LPLL$ZYtsD$ A$H;H5;DA$uH;H5f7LF 1ɺ H5 +A$uEH&;HEHC;HE bfA$;H ;H5:6fDHحHEH:HE DD$ A$D2f.HHAQuSu/Hh:H:HGHW H9ttHf.H0HGHV:HG HËQuqH0:H:HEH5ҠH> HE^H@HG@( tL51ɺ1H5A![H9H9HDH59H9HDHHAHHPHAuTu0H99HZ9HGHW H9HHHGH&9HG HËH8H8HEH5 #HHE&H@HHHH95HAHP&fDHG@( IL41ɺ1H5"HV8H?8HDH5,8H'8HDHf.HHQHHR`H%s yHH0s xHAu"H7H7HGHW H9t'ÐHHGH7HG @HG@( tH1L31ɺH5HfDHAPHe7Lp8@ fH@PLHB7@ ff.@HHH#A`Au9HH6H6HDH H6HDHG HW@HH6HH6H56HDHy6HDHff.HA`H׃Au8HH>6HG6HEH H4HEHG HWHH6HH5H55HEH5HE@HfDAHHHt*t$H5H 5uBHOHW @H5H >H5k5tHH@H5K5ff.@HAHH@H)rzH*r#HHGH)5HG HXAukH4H4HDH53HHD HfDHH@HHH93HAH@XfHw4H4HEH5]4HX4HEHff.HAHH@H)rzH*r#HHGH)4HG HYAukH3H3HDH52HHD HfDHH@HHH9=HAH@XfHw3H3HEH5]3HX3HEHff.HAHH@H)rzH*r#HHGH)3HG HZAukH2H2HDH51HHD HfDHH@HHH9GHAH@XfHw2H2HEH5]2HX2HEHff.HAHH@H)rzH*r#HHGH)2HG H[AukH1H1HDH50HHD HfDHH@HHH9QHAH@XfHw1H1HEH5]1HX1HEHff.HHHHDf.HGH@HGHGHG(HGHG HHFuG3u'HWHB HtHHt HB(H0LH2tHGH@(fDF$G$FPGPf.H(dH%(HD$ttHT$dH+%(u:H(HL$ LL$sLD$H5XaHdH%(HD$HAH@H)r[H*s4(HH H$^HT$dH+%(u\HfHHBH6/HB HH@HHH9HAH@wff.fHdH%(HD$HAH@H)r[H*s40HH H$HT$dH+%(u\HfH-HBHv.HB HH@HHH9HAH@wff.fHdH%(HD$HAH@H)r[H*s44HH H$HT$dH+%(u\HfHmHBH-HB HH@HHH9OHAH@w-ff.fHAH@H)r=H*r&HHBH<-HB f.H$@HH@HHH9HAH@DHAH@H)r=H*r&HsHBH,HB f.H`@HH@HHH9SHAH@DAVIAUATUSHHHidH%(HD$1HE`HHH0QHHAPAL%oDI>LE HDAAHCHC HT$dH+%(H[]A\A]A^BAL%>tH)6tHAL%|+0iXHE`H AH)A L%n+1AI>L%Lh H#1L'ZH5'1#I$HxHHKT,JT(HH)I)D1ɉ΃M4L79r@AL%5~fDtyAH6HAPAL%GH8B DA $[ALfLKAL%H%AHuUHQPAL%OmB8A L%)B0AL%~ ^fDHHCHC HC@( t"L8%1ɺ1H5MAL%v~ +fDA $ALL?@HHH<$AL% )cyHHuHAPHP0Ǝ fDH-HBHv(HB @yHHuHAPHP 醎 fDHHBH6(HB @yHHuHAPHP(F fDHHBH'HB @yHHuHAPHP8 fDHmHBH'HB @yHHuHAPHP@ƍ fDH-HBHv'HB @yHHuHAPHPH醍 fDHHBH6'HB @yHHuHAPHPPF fDHHBH&HB @yHHuHAPHP fDHmHBH&HB @yHHuHAPHPƌ fDH-HBHv&HB @yHHuHAPHP醌 fDHHBH6&HB @yHHuHAPHG HHBH%HB @HAHH@H)r:H*s, H]HFH%HF @HH@HHH9]HAH@DHAHH@H)r:H*s<阍 H݋HFH&%HF @HH@HHH9HAH@DHAHH@H)r:H*s@ H]HFH$HF @HH@HHH9qHAH@DHAHH@H)r:H*sD阌 H݊HFH&$HF @HH@HHH9HAH@DHAHH@H)r:H*sH H]HFH#HF @HH@HHH9HAH@DHAHH@H)r:H*sL阋 H݉HFH&#HF @HH@HHH9HAH@DHAHH@H)r:H*sP H]HFH"HF @HH@HHH9HAH@DHAHH@H)r:H*sT阊 H݈HFH&"HF @HH@HHH9#HAH@DHAHH@H)r:H*s8 H]HFH!HF @HH@HHH9HAH@DAUATIUSHHHAH@H)9H*rRH߇AHCHC HC@( t"L 1ɺ1H5^!HD[]A\A]D\Aw}EH-~H0SAHDI<$L&x HDAANtMMHCAHC HD[]A\A]A H-AtL+1ɺ[1H5PAH-RXf.HH@HHH9'HAH@fZ1E1LH5HUHxHHJT-JT(HH)H)D1ɉ΃LD5L79rAH-fDMLLLfLUH-&1ɺDHLk1HL]1ɺ1fHH5|Hff.@AW1AVAUATUSH(_L;^LuvN8II9O8uhtsLL@1I=DIHǃ?u9HMDAwPHOI9Hu"Ap;wuHL9t!A<tf1H([]A\A]A^A_III1HL$IHD$HT$H9fHH9D$uH;l$ HD$1HH9u19uHL$H9L$tTHD$L`HD$H9YI@MmL9CIuLuHD$HHD$H9D$uAF$AG$AFPAGPtZH[I1HHH9t6<uILDH|HDOEHLHIxLH9uH([]A\A]A^A_H;l$1fDHH5<Hff.@AWAVAUATUHSHH5IHHhdH%(HD$X1HT$zLd$ L-11fLL)D$0)D$ )D$@H\$8mfH)D$0)D$ H\$8)D$@1LLVmHt7H@ Ht.8GMLu11-H5{HEL g HPHHCHtLHL&R3@L-1LLlHLHx D$ IHL=cf11LL)D$0)D$ )D$@H\$8vlfH11LL)D$0)D$ H\$8)D$@FlHt7H@ Ht.8MLe11-H5kHEL f HPHHCHtLHL&RF@AL6%1-H5HD$XdH+%( HhD[]A\A]A^A_HEL 4f HPHHCHtLHL"&RCH5'1E1YZYDHEL e HPHHCHtLHL%R@DLhA}1 LLH1H\$8jHuRD$ DHEL de HPHHCHtLHL$R<+f.HEL $e HPHHCHtLHL*$R9f.LxHEA?H$H$LL`PLoHLpMLLoH LhMD$LmXLLupETiILAZuIM`H}D$ HO`uJIHExIHUxIAHIHIHEHM0IM`I@u}Hg`H$HSHHHHc HtHQMLB$PIf.H$HSHHHH|c HtHQMLb$PMKLmhA b fUfH1SHHHHdH%(HD$81H)D$H|$1)$)D$ 6hHtAH@ Ht8u2AHtH@EHD$8dH+%(uLHHD[]fDHCL b HtLL#1@H5E1ff.@AT1UHH5SWTHHHCXH5HHPH1AąHCpHPHC3t4H5kH1AąAD[]A\f.H5&H1OAąuL\ 1ɺ[1H5DAL[ 11ɺWH5D[]A\@1L[ 1ɺXH5hD[]A\L[ 1ɺ]1H58o(f.ATUHH5rSHHHHPH1fHH5TH1FAąH5GH1$AąHHt HPHH5*H1AąHCXHt HPHH5 H1AąHChHt HPHH5H1AąA[]DA\DLTZ 1ɺ1H57D[]A\AL!Z 11ɺ H5`D[]A\@LY 1ɺ1H53׿DLY 1ɺ1H5 诿sf.LY 1ɺ1H5Cf.LlY 1ɺ1H5Of.AUHATUSHLHdH%(HD$1HHl$@Ll$H7~ H$Pt2AHD$dH+%(pHD[]A\A]@ukHHUHPIUIU@Ht H;HH9HuWA뛐ALyX 11sH5%\qAYHMHtM1HtFH9Hx}fH*HxOfH*^Y,tz=D‰AAHЃfHH H*XDHȃfHH H*Xnf.댸Mff.fATUSH D%MdH%(HD$1Et/D%5HHEtFD%HtEHD$dH+%(H D[]A\fHLL$LD$H58uHL$HT$Ht$ H=7ti<$UAFHtH1E3'"D%D%EHL$HT$Ht$ H=MAD%ڂԂuD$ b tUL1ɺ1H5T苻pfDLis 1H5uU \|$L3s 1H5?U &D ff.AVAUATUH(D% dH%(HD$1Et߁D%ԁt$HD$dH+%(H(D]A\A]A^ÐLt$Ll$Hl$ LLHH= RAąu D%pfD%yEt$LLHE1H=A@L)r 1H55T DHGHIHWpHp0HGH@PH8f.HGIHWHHp0HBPH8ff.HGHWpA Hp0HGH@PH8U DHGHWpA 1Hp0HGH@PH8( HGHWA Hp0HBPH8 fHGHWA 1Hp0HBPH8 ff.AUL-ATIUHSHHH9u 3HH9t(HsL贻uHA[D]A\A]@LLH:Aąu1LH5( _HD[]A\A]ÐAUL-+NATIUHSHHH9u 3HH9t(HsLuHA[D]A\A]@LLH蚓Aąu1LMH5迷HD[]A\A]ÐAVL5MAUIATIUSH*H9tgHL5mM HI9tPHsLluL5CMHmI9tOHuLCuA[]DA\A]A^DLLLʒAƅt[I,$L5LI9uLLL袒Aƅu1LH5#Ƕ[D]A\A]A^H-L"1H葶H11LP t[D]A\A]A^AUL-ATIUHSHHH9u 3HH9t(HsL$uHA[D]A\A]@LLH誑Aąu1LAH5e ϵHD[]A\A]ÐUHH0H]fDUHH0H]fDײATHUHHIHtrHdHID$HID$ H ID$(ID$0Ht IL$ML$(LL11H5ԴHL]A\LN 1ɺ1H5q訴fDATH+IHtNH L 1ɺID$ LHID$H521ML$(;LA\L1N 1ɺ1H5 fATH蛷IHtNH|L 1ɺID$ L0HID$H51ML$(諳LA\LM 1ɺ1H5y脳fATH IHtHHLL 1ɺcID$ LH51ML$(ID$a!LA\LM 1ɺ]1H5AVAUATUHSDOLA;L%11+LTL诲HEH@PHDM8LA1L21ApELtJ1L5TL-&fAM1ɺ6L14LHC9]Lw[L]1A\L!tA]:1A^f.HHxu8DL$jc` ZLaYI1ɺ.L1衱,@H1L%sB_ff.UH-SHHHGwTH@PHDL$Hxj_ 1HILX1Z*L tCL t7L a t+Ln1H5豰L ,1Lv1H荰HCE1HHH9tHAH9u1H1-L:GL11H/L"#H0H!0L BLEL11HH1[Lq31]ʯf.UHSHHHdH%(HD$81LtHW8H5H'af11HHk)D$)$H\$)D$ 5THt@L@ Mt7EP1HsuLEPHD$8dH+%(HHH1L[]a HEL N HPHHCHtLHL*RT1H5̮XZHD$8dH+%(u=HH1[]ÐHEL DN HPHHCHtLHLRNhAWIH5ڰAVAUATUSHHHLHPH1lHH5˰LH@HPH1DAąHH5/L1!Aą&sTH4L1HAąDAAHAtAHV^ HHDH5L1謭AąDAALHI91L-A~uLAW AąLL1%Aą|AG(fo =wfAnG(f89fA~G(AF/IFH5LHPH1֬Aą5AG(PAW(xH5UL1觬Aą$M6I98A)LLF 1ɺ1H5/HD[]A\A]A^A_DALF 11H5PfLqH5*1E1ɫLE 1ɺ1H5蟫kf.GAVH5L1被AąLcE 1ɺ1H5FIF@dLHH1E1L H5^fLD 1ɺ1H5;ߪf.L f.1҃H5L1ǪAąDLD 1ɺ1H5ǯk7LbD 1ɺ1H5E1E1LJ H5u@Lt_lH5iAG(YLC 1ɺ1H5迩f.H5L1ϩAą>LC 1ɺ1H5Ϯs?LjC 1ɺ1H5MLDC 1ɺ1H5'LC 1ɺ1H5]ff.ATIHUHH5QHOLHHE*A|$Lv!At$81HHHAHU tHLHH]A\6fDL\B 1ɺiH5-hAH1]A\L,B 1ɺaH5H1]A\LA 1ɺeH5ff.@AWAVAUATUHSHH5HHdH%(HD$x1Ld$8HD$0LD$(D$$UZL}Ll$8IPL(RHLpMLH5HZAŅ LmLd$8I}PLQHHpHHBAŅLH@AŅqHH5&HXAŅ(HUTH5&H=XAŅrLd$@L-$11fLL)D$P)D$@H\$X)D$`?KHvHt$0HPH,WAŅET=PL-n$f11LL)D$P)D$@H\$X)D$`JHq|$(fLL-I 11L)D$P)D$@H\$X)D$`JHxHHD$,L5&HD$H[HL{ MuLkLLHD$@D$,L'XHULL$@HzPLHT$LL$OLL$HT$HLxML$,ALHD^H-)L> 1ɺLH輤L> 1ɺ1HE1蜤Sf.AHEL !D HPHHCHtLHLR[H51IY^HD$xdH+%(1HĈD[]A\A]A^A_fDHEL C HPHHCHtLHLRaDL= 1ɺg1H5迣sf.HSIOHH@C HtHQMLP^H5Ψ1E1mAYAZ@L\= 1ɺj1H5?f.HSIMHHB HtHQMLPd{fDDžfLHT$0HUAŅoHEL YB HPHHCHtLHLgRt3HEL B HPHHCHtLHLRmfHT$H5bLSL/f.HEL A HPHHCHtLHLRpf.ADHEHSHHHH\A HtHQDE1PL1}H5ܦ腡_AX6DLHT$(HSAŅtHEL @ HPHHCHtLHLRLHT$$HRAŅ|$$HEHH`IHEL |@ HPHIEHtLHL2RIH-1H衠XZHEL .@ HPHHCHtLHL|RyHJHIUH? HtHQLmBPHEL ? HPHHCHtLHLRff.fAVHAUATULSHLHdH%(HD$1HLt$@Ll$Hk H$@8t0AHD$dH+%($HD[]A\A]A^HHpHHHtZ1HtSH9H<fH*HfH*^YŜ,ЅYD։AIH@IEOAL8 11H5輞#Hp HHHtZ1HtSH9(HfH*HfH*^Y,ЅD։AIH@ IE@HfHH H*Xf.HHfHH H*XHHfHH H*X;fDHfHH H*Xf2fDkGAWAVAUATUHSHH5^HHhdH%(HD$X1Ld$LOIL}Ll$IPLGHLpMHH5HOAŅmL|$ L-W11fLL)D$0)D$ H\$8)D$@jAH$HtPLLHSOAŅ8HULl$HzPLH$GH$HH@H$HL-f1LL1)D$0)D$ H\$8)D$@@HD$HtSLLHNAŅHULl$HzPLHT$FHT$HH@HD$HnHH5pH0MAŅDAL-fL1L1)D$0)D$ H\$8)D$@#@IHoLLH NAŅnLmLd$I}PLEHt LxM/HSIMHH: HtHQMLPDAHEL Q: HPHHCHtLHL?RH5ҟ1y_AXHD$XdH+%(HhD[]A\A]A^A_HEL 9 HPHHCHtLHLjRDHSIOHH9 HtHQMLPH561E1ՙY^XfDHL$H$LHT AŅLH6AŅAHEHSHHHH 9 HtHQLE1P1H5f.L1 1ɺ1H5蟗$f.L1 1ɺ1H5˜oUDAWHAVMAUATUHSHLH(HT$L|$`Ll$hdH%(HD$1+d HL$At8HIAHD$dH+%(4H(D[]A\A]A^A_MIHHH9,IFrT1H@hHDHHHIH9H1HtRL9H`fH*MnfI*^Y,u=D‰MeDAL 0 11pH5HHH}H$LjDLD H}HD$HD$ $L$H0D D I~HXZLT$1H5I1yARL!2U3HL$ L!^_HAIEDHЃfHH H*XfLLfHH H*Xz虗ff.@AWAVAUIATIUSH(D e[dH%(HD$1EMt 3[t7!A$'[HT$dH+%(H([]A\A]A^A_LT H*Lh H-)ML51 DM}A?MmMA}tL (1ɺ1LL蒓HL$LL$ gZLD$H5S)LZHg(L5HfD;D$r u0C;D$w&C ZHH9CfHLE1LSL (1ג_AXfH-( /YH'L-'L5щ fHH9<CtuAU1ɺLS1L I(LŭPX^0Y HO'fHLeu C HH9u?@HօtZf.1ff.fAWAVAUATUSHH-țdH%(HD$81L$XIHHt$4ILL7LMGDt$4AusTaFV1LLIHH1LHpxHD$HHCHPXHHPHuH9g1WcHD$D[T1DD$HHD$ATA oHEٹDh LBH51AYAZLV* 1ɺFf.L<* 1ɺH5}1E1HD$8dH+%(Q HHD[]A\A]A^A_fDHAI}A$jME]> A[[ILC$H51E1萏o2sTH$1HH(\(IHHHHHT$DHEٹ>hLˬfDH$ LD\$ aD\$ HIA}I<$&HwH0LLT$(D\$ ED\$ LT$(/AI0LHI9E1H\$ LMHl$(LEfDHkHvILY1LH5]HCI0HH)HCHHH9uH\$ Hl$(EMHD$I<$8L|$LT$(D\$ LFLT$(D\$ HHI8Mb1LrH5.HQXHL8*IH51=d)HcLyH5Z1E1@HHx0LI!LD\$ HD$(^ELT$(D\$ HHI0MM1LH5ɖ @L\& 1ɺJ1H5dfHwI8LLT$ D\$CCD\$LT$ u%L& 1ɺgH5EI0HL$ǀI8ǀ1HADŽ$A$HD$IXI`D$EhApIHIPIHAAuCTPE1 LA'^HǀtDxDHCH@`H3At6QLVH5PQ1ɺZ1襊DE EPLHI99L5̏AGt!0LAzCfIGHHH9LjXH@HMHkLPL b1LIIEZYL90IGHHH91L]M?I9$H9tML1LLnHLHQf]AŅrA!DEOs1LLAWAw1L]PL" 1LAźw܈OLH5PO1ɺT1荈 L[HHǀtbf.Až LAL[HD|HkLPL =1LIG^_HHH9Aw1 L! 1ɺH5L! 1ɺO[DL! 1ɺRH5ȑ L\! 1ɺH5a% L+! 1ɺH50oL ! 1ɺRL 1LAźpކL 1ɺ1L輆袉Bff.fAWAVAUATUSLH(IEHT$Lt$`dH%(HD$1H*IMHLHHHaEUEu8H{hHC@ct#HHtHPBfI>}LoLL=AHT$h LWH$HL8DH&HHHH9ǸHD2HCHH@hH9Ghs7NFH|$Ht$H(D$@HLHVHHj LWHH)I>}LghLL;AD$4L@u=ML$L1H5ӎADŽ$AHD$dH+%(H(D[]A\A]A^A_@H<IH=I1LH5TL 1ɺFH511ӃE1qHH-؄1EhHL4YL ^1ɺH1ԍ{LHHL17DT$H5;DT$I@+LKLHHH5b1E1@L 1ɺH58H0LLHHfD$L 11KH5苂DT$'L| 1ɺH5gH;IHI 1LVH5B|L 1ɺ\#fD@LOHPLfDL 1ɺH5тfDL 1ɺ1H5eHWL`LHHHJf.USHH\$ HH8+ HHxHHHHǀH1H)HB HD$(HBHB HB HHB(HHHHBHHHH[]@H-LJ 1H ȊH11L] JH1[]} ff.Gt@HH1HFH5ztFHD FA~H1jL2H5 X1=sFZ뭐HUSHH?tZH5iFitO+0tUH5HNAEt+1tLH5uH-AEt 2t;H[]CuH[]f{t{t뽸fATIIHSHHEAt$ T$(Eɋ\$0DɃDEɅtDAɄDEDʋL$8t$@Dd$PDEDʃDDDʃ H5EDEDʃ@ED'DE1H?Au6AHH5HDH=L%CHDH5(EIDASQLt$XPH IHtuHL[A\fH8c( HHtClvm2_fCzH@H2HH JuI\$HL[A\1L2H5HL[A\AUIfATUHLHdH%(H$1MH$Ht$Ll$PH$L$DJ$H6LDHLT$HDD HL$HD$0H$LD$ HD$@$Ht$(D$H$ Ll$8D$L)$)$)$)$)D$P)D$`)D$p)$Ht@M~Mt@LLLt=HtH1ɺHH$dH+%(uZH]A\A]ÐL 1ɺ1H5{L 1ɺ-H5{^o~ff.@HGH@dAVAUATUSW HLpHHLxHLhL% IHLLH藁_Lj|HHH5HozHtH}_<|HHt\EHCLHxP%HtCH@Ht:HHH9)HRHRtt ufD1[]A\A]A^D1DHG`HtHtH$sBE1H"rH!rHtL  1ɺH5, uL 1ɺr1H5 u|$%H-7,xML1H5^L1ɺ1H5 ZuILH5ff.@AWAVAUATIULSIHHHT$H$H$Ht$HHL$L$HT$ DD$,HD$8dH%(H$1MD$LHD$XHD$PHDvHT$LT$HD\$,Iſ EHt$`jHE1jMLjjHD$PH HDL$`EMtD$tAHD$0D$(HD$LxMMHL$ D$(MI~M~Mv Ht!HHH9LHCH\$MtHtHt$H|$vH|$tIE H@@HtЅtIE H@PHtHT$PHt$LIL$MRI|$HT$`RI$LD$ _AX(t$(D$L0HL$ Ht$PH|$Xu =t_ tYtM1HtFH9ffH*H*^Y?p,ȅDDHD$ @HHHH9HHHHHH9HuLIH-) 1HqE1@D qEu<ja(HT$LT$HT$LT$ 8D )fDL$(HD$ $ I|$H- LHI1!qAH|$0DL$<DL$D$,uGH$dH+%(HĨD[]A\A]A^A_HD$ 0rMDDL$DDL$1tHD$81ɺHL~ 1ipE1bHOLIEH-g 1ɺE1L$ HDL$pDL$D1ɺiD$H- L HoDL$L 1ɺ;1H5 oE1Lz 12H5v |oDL$H- Lg 1ɺBHPoE1AH-w 1ɺ1L4 H$oE1qfAWAVAUATIUHHSHHdH%(HD$8HHBHBHD$HBHD$HHD$ HBHD$(LHHLv HHjE1E11j1jjH HHfHx`kH=qpHE`HoH\AŅLL=- LLI1mHEP@AHP L4HII9`H)1LgHoD$H\$IA$L+LLlHHG:nH4HKHx 1HL$osHL$HH A $H1ɺMPL|1LHlXZ|$t_D$UfL 1ɺH5 1E1lHD$8dH+%(HHD[]A\A]A^A_fDAH~Ll 1ɺ1H5 OlDH1RH5LT~vA^_M1L1ɺLE1kD$HHDH^LDH5Av0nAŅL 1ɺ1H5 tkff.@AWIAVMAUIATIUSHHHdH%(HD$811HjLE1P1AQ$ PD$@H HMH"$AMA<$EuMtAEAHA $LsIFAN IvHD$H@PHt$DHD$1IFA~$)HD$ILX`I'vAHcMIAAuHEHuHHgLxHP H;uHpLhHH9ts ELHuMtMC A)MKIF@a@HD$LHx(ylHD$H@ H@@Ht LЅHCHxM1ɺ PHD$Lp(L%Z 1LiXZ8HUPLHr0HT$kHT$A$L% L 1ɺ1LAhHzHD$8dH+%(HHD[]A\A]A^A_I9H9fDHu1E1E1zfDA4${HUPAEHt[BtUz0Hz0H}HH}HL1H58rL 1ɺk1H5 E1gI@AFL+FAF(HD$HH5ڻLVjH5L?jHD$H5H8HD$HtL%D L  1ɺLffDEf.HD$H@ ?H*H$PH%UCAHr(LH@HH  vZf.AdA`IH@L 1ɺb1H5 E1e)E1H;HSL2 (CAH;HSLP, CAH;HSL'& CAHCHxH\$H1L^LK(PH;HSLP1 CA@H;HSL$ ]CAL% L 1ɺLdL% L 1ɺLdL{IvH;L| IvH;MLL)7CAL3 L IHfHHLHHL@LH5@1^M1H5zLnLLR" L 1ɺ+L% 1LcL% L~ 1ɺLgcLcACL%{ LA 1ɺL*cLL;f)D$ L IHLfLt$ HHHMH5LH@1]M1H5]LmLL5! L 1ɺ/L% Lw 1ɺ!L`bLW 1ɺ%H5w HSPIHHKHL 1HHHhPqZY[D1L 1ɺ|H5 T1[USHxdH%(HD$huHu0ǃHT$hdH+%(Hx[]fD1Ҿuɋ^t;Hl$PHt%1HL$HT$HLD$ H5Nt51L1ɺH5 SǃO|$t v‹;|$w^Vff.AWIAVIAUEATE1USDHHHT$AAAGd EtUA ItAGdtPIFuADDED DEH[]DA\A]A^A_@H|$tPAfAuAIIH9)cH^TfDLtIG`H%r@uIHAAD EDEff.AWAVAUATUSHH $HH|$0LE@IHt$(L$HרHL$8LH KdH%(H$1L`OHHHD$PL=8]HD$ HXHHzdHT$Lru݀zmuDbA-uDKLDL$NHD$@aSHT$1Hz HD$VLD$DL$AjE111jjPHt$@H IHD\$PE1LbHWHH9DAH2Uu.H$dH+%(HD[]A\A]A^A_fR8O L 1PHܢL PH5` 1#PXZHG M; HD$Hƿ1LNOHt$L 11 O+D 1E1LH5 O@H@PL$lLLT$HT$hLH0L$T$HD$t$L$ LIH| QT$HRG AVHD$(1 OHT$`LLH JHT$@IMPLT$HLHLDIIFH3H3H IVIFH3VH3FH A>H|$(LLT$KLT$H1ҹALLT$@L$LLD$RLD$LT$@HuƄ$IUPLLT$@HHT$HT$LT$@HIHHt AFd5LLT$课LHD$袾HH5 HT$I1LfR] MY^LT$H|$8LT$HL$8Ht$(E1LH|$0DLT$L~ 1ɺd H5 cMH|$_k@H LE 1ɺA HD$Hƿ1'M9LT$H1LL$ V LH5* LH|$(_AXAYALpXHt$(H|$01LK-LT$L 1ɺb vONH8K$MHEIHw@QH5 HDAPLPS E1P1)LH AWAVAUATIUHSHHHRHH?Ht$dH%(H$1ID$PHbL 1ɺ HIƋE(=H}HLIHD=E"LӅMLD$HL|$PHH|$LLH\ HD$PHHPfHM)D$hL H5K Љ)D$X )D$x%D$X ЉL$p D$tP1Q1AUJH DT$PHHDD$PEAH$dH+%(HĘD[]A\A]A^A_HEHGHH}E1E1j1HLjL|$hAWjH hD$L& 1ɺ H5K 1 JDT$[L 1ɺ H5 1IE1+E1E11HLHRL$lT$hE1H|$DHwU HL$PU(HLHULHT$HLAUI1SHT$(He HR !IHEH LHGHGc%;D$PEAD$a 9Ml$H_LAJHH5LDHt$1MLHwD$L 1ɺ \AT$|A$EDT$Ht$ H1QE1E11R1jH aD\$ DT$ENDT$HA$LFEL$| H5 P1GAYAZDT$DML11 H5 GAft$l9Lt$\$hL$T$ t$LdI1VH5u SL$ QT$ R %GH E1ufHHHH5+ D$tLp PDL$x1F^E1_ @D$L 1H޺ 1FDT$IHuAH@Hto"oj'o@HoB oJ0HH8HtooZ_ff.ATIISHHBH@PHBHP LR8MtTH_1@u8HL_LgSA@$)LHLPVH7AH H[A\APL+PAP(fHHtLI fDLH(1Ln H5 `E1ff.AWAVAUATUSHHHjt$ HdH%(H$1HD$0H9ULHEP1L$0sL0L1D$,HLAH$0H_8VHL EfvIWPIwHLy IHuqL= 11MC LLNDD[EA11LCHL$p@ljD$HHL$?DT$HL$I1I?H<HHuD=tSE83CA<$HPHPHPML$HV L1CH ML*L1Y YCAH$dH+%(HD[]A\A]A^A_@HEPHUHH>1LIHH NHc@LHD$V@HT$LLTLLT$lIHHT$1HaDT$ D$ L 1L` 1>DT$ eD\$0HTHLSILu 1|>Y^DT$ DT$ H-HH}2@8I=A<$MLIHL HEH=6HAPLBWP1 >|$,H 8A…A}\=A<$MLhBHDHN PHPS@L`; LIkLL$PL|k11 Ln=fL1H5V6<=L$0L1ɺg DL< 1"H56<D;d$4; L2>HtHL1LD$  PH9SATP1AVL$8;A<$MLIH,Ha0ARHDH=APWL@V P1H5L>H;0CH:fH@(@@IU`HH%sPHLhHHH !@HH(H HHH[]A\A]H0IIH9KHH|H@HHHHPHHX(H9pKHc@ WL@H 1ATI1LH5 f:XZH[]A\A]@L1 1H5l ,:H1[]A\A]L DAWAVAUIՉATUH-BSHHDO(Ht$dH%(H$1HT^HDE&HGLGIIH9[JIEPfH|$`L)D$`oo)D$pHDŽ$)L$@)T$PHHt$@L胟 L/ 1ɺ IHIEPIWHHH;HHHtwHH{E1E1j1LjHD$(PH IDD$EuoAH$dH+%(HĘD[]A\A]A^A_DL7L| 1ɺ H5 1_8E1f.E1E11HLHL$,T$(E1H|$DHwHK(JL豨AT UH-# I1HL7HsXLZLHGD$L 1H 17DL$fD$Lx 11 H5 [7DL$HH5{ D$4L PDL$817^E1_[9ff.@ATIHUHSHkI<$HHD$H%= M1L=[LL.Ht$H1AąD$H%-`;t$ L=t1ɿ1L UL#L+.Hc*tJ08_H11AUL IULL-XHZ HL&S11A ,fMLH5@1E1-H$XdH+%(HhD[]A\A]A^A_f.MLf.L yDLb1H5-zMLDK[L$ L={L T1ɺ1LL,ML\.Hq8+=SH.IH` LHDHE1APL oSL0SP1,H 11" wDH)HD$H2H$L=~HD$(fDH|$2Hx.L@uAxt܀x.uAx.uAxt1HLH="LD$ LD$ Ht$(H=".u$%=`p1ɿ1rL s"L L+H=]"H'8+-8([*1ɺtLPHdL "PL 1*A[XfDH|$F/~1ɿ1L 1LrLz*L&,8)1LPHΟL PL 11(*_AXK,8)L ]a1L PH|yPL1)AYAZ@fDM1LLk1))=PLH~IHH HDHL PAPL-SP1Y)H H$L&uLHt$H&u;HD$XH9$t\L eP1ɺ1LuL(L=1ɺ1L )PLL(qA/+*L=O8 (I1ɺ`PH{LA Pff.AWAVAUIATIUHSHdH%(H$1҃tNMƃAH$dH+%(|HĸD[]A\A]A^A_fD$LLHL=HH-1MHH=Ht$H6%D$(%=@yH7iIL11PH56'H~#AHiHMHҧH?=?t!Ht$H$xD$(%=@tmL=p114L LL&@H  -H߉D$ -i|$ ,11 LLLHD$vuQL=fDMt$LLHLLLHD$%taAfDL=L1JL%L 1ɺL1%E1r@L 1ɺ$H5!q%{@L= L:1,LA%L= 1ɺ놐L, 1ɺ!H5%@3'H'8e$=>LHIHL HDH9APL>)SP1$|$,H +11 Nz'f.AWAVIAUIH=ATIUSHHdH%(HD$x17& I* HD HHLw1  ) *HL/HIt$jAuLOHTPHoH=QUP1t$8t$8t$8ML$I $*4H@AąSsA@Mt2H1L1t$H=St$t$3H Aą?{0t3HHs011t$H=&t$t$3H Aą6H|$ t$t$t$5G^59^5+^*Dd$PH\$hH0EOHL-rf11Ht$@L)D$P)D$@HD$X)D$`|H{H@ Hn8ML-%11L4-L,HH.1LP11L HrL,XZH L 11 H5Y!Ll$0H{+fDH@11t$H=t$t$92H Aą,M1LBH5!QD HH5ATIL1E1H!Ll$@Y^HDLHD$Ll$Ht HxXLHxHD$xdH+%(HĈD[]A\A]A^A_L1ɺ1H5 E fDH1H=f1t$t$t$1H AąM1LH5R DM1LH5! @L-G#@M1LH5A@M1LpH5|@H@8OyxKoxeAE1l_"ff.@AWAVIAUIATIUSHX $dH%(HD$HHB` t ,H-F$1LLLADžH LLL3H yLLLADžWAF EEIIH9uHmH9HEHxޓLLHHEHP(ADžuL= 1ɺ3 1H5`  H LLL[AEd=LhLLLHADžLȷ 1ɺ$ 1H5 *fDIE`H%@H0;H4`IIH9uHHH94HCHPBft1LL)t9HCLLHP tL聒LLLHuL 1ɺ} GfII9IIH9-H1LLHP-ADžIH9i-H1LLADžrAD$EEN EuJEF(EuAL虑I>LLHXHHtLLADž IE`fDH4sIIH9~fAt8IIH9t%HU1LL1ADž HmH9uAF tAEc4f.A~,E~(EutIIH9u_HH9tPHCHxGftAF(荐I>LHHCHPGHLHAF(H9ufDIIHD$H9iHHt#1LL8ADžHHt1LLADžHHt1LLADžQHhHt0HC@t&E^ LLEE $ADžHHt0HC@ t&EV LLEE $xADžHHt%Av LE $LGADžDKLE1Euf;HCH@tCuLLH۹HH$E^$f)D$)D$ D$D$)D$0EtIIH9.&HH9IHL$LADž1L 1ɺW 1H5 _LԮ 1ɺ 1H5 6L 1ɺ< 1H5ѯ L 1ɺi 1H5 kLb 1ɺ 1H5 EL< 1ɺ 1H5_ L 1ɺ 1H59 xL 1ɺ 1H5 RLʭ 1ɺ 1H5 ,L 1ɺ 1H5Ǯ LLADžLh 1ɺ] 1H5 KLB 1ɺ 1H5e %L 1ɺ 1H5? ~L 1ɺ 1H5 XLЬ 1ɺr 1H5 2fAWAVAUIATUSHDD$dH%(H$HFH@PH8H|$ HD$D9D$(IHH@L4ILIOAHz#IHCJt0H5I}1"sHHI1HBL0HL$ JII}1Jt0rHHI1HBL0HL$1ɺ AL8 H5d )z@HrHIG@ I}1ZrHH I1HBL0HL$BI9\$L$(tHIH#G`bAfDHBHtH@HtH@@Ht HH9HD$ Mgx"HI#D$`ID$PH5vMD$,IEL8LLD$H|$H5MMD$DT$Et LD$2HED$8HD$0IG@cAG$I$D$HxxtGAH$dH+%(HĨD[]A\A]A^A_DLL%HuDKANHEF HT$H4$H<$AVE1DLHGPDT$H@`% H HT$AD\$ɌH|$D\$DT$A E11HLLLARSASHD$@H HHL$ AHHEAHCH$EH@`H2sE(H4H4$LLM9uvM$$M9t^ID$HPBftE1ILLHt$ID$ILLAHHPuL 1ɺH$H@`H-VH$D$lH|$.H$LHHD$8L9Ht$HHD$HHDHEHT$0HD$(DI|$LMMDI_HC H@H LLI|$HD$uHLqt$0 H5R t$@P1LL$8 HC H H@XHtIWLHJP1H9Ѕ@ M$MLGzH]LHHfHH88xLHD$HCHt$HHHD$!HD$HaLuLO= IH5 1DEED H}1LLH* E1LLLH IIH9ttLd$IHID$HxRyH}LHID$HP芨Ht0ID$Hx'yLLHIID$HP8 M$$L9uLd$LtLS IH5 1HI$HtE1LLH*" I$HtE1LLHb I$HQEVEI$huA|$LE1f.ID$H@tbu[I$HtNHTHtDI$HHDH@`HttE1LLHN fDAE;|$LQDH@I$HH؃8bHxHHW`Ht BM(tID$H@ 2E1@HLLHL 1ɺ 1H5М L 1ɺ[DH$H}1L6HH$H@`H-*H $HH9HHH9lHE1LLHHPADž H$HH9HE1LLHADžL 1ɺ1H5ܛ L=mM H$LM1L'IH; IGH@7 H4$H}HSF6 ! IpIIpHL ATI%H5 1AYAZH$H}1HPHH@PHBIHvH$@d #H<$^H<$tHD$H$Ht @dgH|$|H $HA`H%|HHH9HWH$HtLHLIHADžH$Ht$ HHADžLʘ 1ɺ1H5 H $HLL9HH$H4$HHH9HHsHfDL, 1ɺLH5Q 1E1 V{sII$H|fDu(I|${n L"IH5 1ID$IT$H@P1BtAD$L+BAD$(AT$$H|$ )HpH,AD$8AD$Lt$M$$9CƉD$L;d$8H|$H$H@`H%Hs&H$Ht$ HHADž'HC`HH0 u6H$H5:LxHLu_LHsD$X1ۃpHL$ U,tFH$@a tM 1LH5  L 1ɺ 1H5ɋ L 1ɺTH|$HH}1L%HH$HP`^L; 1ɺ1H5^ hIWp1ɺAL H5) 8H<$`*LILÉ 1ɺ1H5 D$pI\$HH|$ H貦HD$ Dx@hEu ǀǃI_H<$I_HLAWI>L 1ɺ1H57 AL 1ɺ1H5 LȈ 1ɺ1H5 H<$dHH$HH9L<$LcHXIW`yLV 1ɺ 1H5^ H$H}1LHIHlLHLHADžPL 1ɺ1H5 L̇ 1ɺ1H5 uL 1ɺ1H5Ɉ OH$Ht$ HH耱ADž[HS`{H^L` IH5o 1-L) 1ɺH$Ht$ HADžrL 1ɺ1H5 'LԆ 1ɺ1H5 }L 1ɺH5· IGH@L 1ɺ H5 H<$]L4 IH5 11L- 11 H5P H$HH9/fL 1ɺ 1H5 Lr\L IH5V 1L 11 H5 zHL\LI IH5 1FLB 11 H5e %L 1ɺ1H5? H|$ LH11Lׄ AH5 L 11 H5܅ jL 1ɺH5 xHH<$[L IH5 1CL? 1ɺL, 1ɺ1H5O YL 1ɺ1H5) 3L 1ɺH5 L 1ɺ H5ׄ TL 1ɺ 1H5 v.LZLG IH5 1DL@ 11 H5c #H<$YL IH5 1L 11 H5 f.AUATIUHSH8dH%(HD$(1HnHU8HE1E1H ILkH߉H L Ht~Ao$HL$LVM-Ao$D$L$ AąH{"H{H;1HD$(dH+%(H8D[]A\A]HE8 % HMHtsH9tnLIRLBOPH5 1AnXZ\L\ 1ɺ]1H5 A9)@L IL1HH5< Aff.AWI׺AVAAUEATUHH5[SHLHLL$dH%(H$1pAElLHEH|$01ҹHH|$(H81HL$ HT$(1LD$Б Lt$ MLGAHD$EA8H ϻH|$(HH3HH9LNPL1QH5 AVWH ZEtL H5ԚL_ H5ÚLCtoH5L+tWAH$dH+%(HD[]A\A]A^A_DEtHD$HtfA?CH#H#HEHHHH9LJHLE1UH5 P1AWH ?HtHHt H9L U1L4AWH5w 8HC`D$E1H$MM$$L9$$MID$HLhxMtDXLPEMt'MuMtA>tLLLT$45MuLPlt"H IF`HH%\A}uIMHL MHQPHIHHHHhPY^D$MLc`L9$$T$hL%FLfz1ɺILTo 1ɺ 1H5wp 7H{NH{EH;]Lo 1ɺ1H5

WMȿHhPAXAYLT$IUPIMHM1L HHASHhPZA]A^NAMMLQuH5l >ff.UH dH%(HD$   tHD$dH+%(H ]ÐH HR H5} HAHHHDg fo$HD$D $H~ )g Ex p tXH-g11DLyuHHD$dH+%(uWH HLu1ɺE1]fLu1AH5 xAUATUH~lLIMIHVHIE H taEUHRAQL .H5qELuLD1A[LXLH5 H]A\A]d@@tNH$JH1RH5<LuXLZH5QLLv1DH5\]1A\A]@H1RL(u2H5'_LAXLHH5N]A\A]銩f.Lt1H5<{L!t1$H5 KL)t1)H5܁|Lt1AH5LH1RH5~7LD$D$/H5W H5G HxH5zADžuMLKl1L溳11HxH5yfIEHt$11Hҙ)$)D$pH$)$ZhHtH@ Ht DEHL 11jLE1LH5j AXAYrL1LlpaL1LkKgL1Ll#lL1L"lhBDx9eDAVAUATIUHSH@H$L$L$t@)$)$)$)$)$)$)$ )$0dH%(H$1fH)D$ )D$0H$pH|$@D$@HD$HH$HD$L0HD$Xt$t$t$H Ht HcuH|$ t$t$t$555A\$PH0HD$Hl$Ht HxqkH虾\$ foT$0foL$ AT$A $H$dH+%(%H@L[]A\A]A^@H1H=v1t$t$t$@H E1Ll$`L5!f.H9] ALvL1  `HELH4HIDH11t$t$t$H uL9vH5Lv1H5w׿ff.fAVAUATUSH@D%dH%(HD$81D$ EtD%E4LLHHLD-#EtjD-Et^HD$xdH+%(H$fDAy.)1E1LgH5WHD$xdH+%(nHĈD[]A\A]A^A_uD-xEtD-hEtHD$xdH+%(!HJ$HĈHL[]A\A]A^A__L1Ҿ'L%AAELeL1E1迭jf.L5:1ɺ1AL^L膭1Ҿ'L觃A@=4$E1H肝 AŅHpHLhHH $tH|$ jQH DH=U17NL\tHCLHxPFHLhML52ULHL;MAąt4 $A@L1HAątgHCAHH` WM"1LbH5Ġ 9+@MWLbL 5 1ɺ_1H5z ՝DATUSHG@HHHH5JTHH@HPH1ԚAąt5HH53THP1貚Aąt{AD[]A\D1Lb4 1ɺnH5ҟ GD[]A\1E1jLaH5 D[]A\fL3 1ɺo1H5j ߙef.AVIAUATIUSILHl$0Hx&LHHHpHHSIHt$8HAHBPLJHDLD>AąteHHFHHH9HCHH@PF1Hȋ`LHipAątBA[]DA\A]A^1L2 1ɺH5J 还[D]A\A]A^1L2 1ɺH5 菘[D]A\A]A^1E1Lw2 1ɺH5 \[D]A\A]A^AVL5+AUL-NATL% UHSHGdH@PHHH`DL$H{jHƃuF1LILuQX1Z賗HH{DL$j`FYL:Q^I11LZL<L怽XL QIEHLQ1P1#YLLPME11L P<L,$Z_AX HDL$H{$jIE1LILPX1Z臖HH{(DL$j4H DYL`P^I11L'D,11LLPL[LHH(L 5PHDH1ɺ<LOP1H{0DL$$4H "D_1AXILO1L溴_HH{4DL$j4H CAZ1A[ILO1L溷D<11LpOLٔD@11L_OL赔DD11LNOL葔DH11L' 1ɺ&1H5 !ff.ATUHH5} SHHHH@HPH1`H9HH1HpAąEHCdH!HHH@PH1:AąwHU AąXQYZtH5HH1jAą$H5GH1 EAą2(HGH14 H 蜈Aą,H5GH1Aą[*H5GH1ыAąL% 1ɺH1H5 u$Ll% 1ɺ31H5ڐ OD[]A\AL9% 11ɺ2H5 D[]A\@H5FH1/AąL$ 1ɺ;1H5^ ӊ낐H5oFH1Aą`L$ 1ɺ=1H5 蓊?fD0HFH14 H Aą8H5FH1xAą}4HFH14 H φAąz<H5xFH1-Aą~@H5gFH1 AąDH5VFH1AąHH5FFH1ljAąLH55FH1襉AąPH5*FH1胉AąTH5FH1aAą'D\EA1L# 1ɺ5H5r D[]A\L" 1ɺA1H5B 跈cfL" 1ɺ81H5 菈;f.L|" 1ɺJ1H5 _ f.LL" 1ɺC1H5 /f.L" 1ɺ?1H5 f.L! 1ɺE1H5Z χ{f.L! 1ɺM1H5* 蟇KL! 1ɺP1H5 y%Lp! 1ɺR1H5ތ SLJ! 1ɺS1H5 -L$! 1ɺT1H5 L 1ɺU1H5l L 1ɺV1H5F 軆gL 1ɺW1H5 蕆AHBAtBH;At5HZAt([Lu11H5d HH H52CH1`AąL! 1ɺ[1H5 L 1ɺX1H5i ޅfAWAVAUATIUHSLHdH%(H$1I@D$8L$HP HJXHtHT$81LHC@D5L{EIWP=VfHD$P)D$@LLT$,L\$@IGhE11L\$11L)HD$@dH‹`HH9(9r)D$P09r)ȉD$THt$L褢H{#HHHCHPHH@PH1IH!HHxHHHHpLO 1ɺHHD$HLH@H@hHD$D$8HCEH@PAAdH苃`HHULL$HIA9I}HHH$HbyL 1ɺH5 ڍLv 1ɺH5 1E1V+@1E1L:KH5 )H$dH+%("HĨD[]A\A]A^A_DLpHE1E1jH1LjHD$xHD$0PH|$(U$H t$`IW`IGPH HH8H,fHHD$L)D$@D$<HD$PLHHD$H8LD @HHjE1E11j jjHt$8QH HL$`H HD$H8#,HCL\$@LD$@H|$Ht$PHPPL$TL\$H@hL9DLLL$K:I$HLL$L>H5 ‹DLT 1ɺ1H5† 7 fL, 1ɺ1H54 nfI$L 8Po$E$A$o4A$oDA$HTI$\M$AA$HD$I$ABADž2H)HD$HjLHD$L_HHIH5V 1LT$IBH;HHHx HPHL$ HHHL$yHHH5 LT$(HT$迂HT$LT$(HD$@H|$HT$H501AhsH$dH+%(HD[]A\A]A^A_@EhfHDŽ$H$AhHD$hHD$`$E= fTvL<|H5/ArGHDŽ$fL%/HD$hLHD$`HD$H$H=x6$HD$pL$HHD$(1HT$\H5 LD$0mLq/AǃD$\T$p HS@f $f$HT$ HnfxHPHߺ|0HD$ H Ht$ H5 HS@Hf L8Ix@HT$hLH LD$hHS@L$HfHHL!HH @G7q L.H5.ApH$HD$hHtH9t H;8tHzHD$hHlH98HxfA @fH5 HPsLA:fL%o-HL$(LsL$(fLL-HLrLH$rL-HLrfA($f.L)9wf.H5HHT$8\rHT$8H5,H@rHT$8L8LD$hfI1Lz9H5<,AnfDfA EtI@HhfAhH=2RI@H2HHD8@HD$nfH5IHHT$HHT$@LD$8bq`DŽ$ HD$`Ht HH$HH E1H$1E1H\$8L-FLAIfDAEEIHE`u0$tAtHLLH)Ht MHLDA(u$H\$8L}Hl$hH$H|$HD$pHD$xHEH$H|$H5NrHD$pH D$8LL$L% 11L+Lm$D$H}HL$Lt$(H\$ALl$0HHHD$/f1MH _4HH9\$HEHf11L)$)$H$)$<HHuL LJAL1E1.l@H5@GHHT$HHT$@LD$8 oLD$8HL$@HT$Htf'fDŽ$ ,fXf(xf111fH|$ 1HPHHHHPHt:uHPH>HQH8H@f.H|$ H8HuLy4qyLD$8HL$@HT$HH5$HHT$HHL$@LD$8mLD$8HL$@HT$HLHHT$HHL$@LD$8mLD$8HL$@HT$HH56HHT$HHL$@LD$8gmLD$8HL$@HT$HH5` HHT$HHL$@LD$82mLD$8HL$@HT$H8DŽ$H(Xxf$ft$ ft$ft$@ft$ft$ft$ft$$ !HT$`Ht HH$Hl$hHD$ L41H5@&hL41H5&hgLL$LE1L&hDD$8H\$t|Ll$pMtrL fLOltXuTjLX 1ɺ1L?hL; 1ɺUH5c%1Ah@ uE3@LK@MtfAxMPLG%1H5%AgJff_LL01H5U[HD$yfL< 1ɺ1L#[fDH+PL<D1E1DHLH5`Z}D1L01ɺLAZH$H(DHL0L1L0@ZH"L0W(L1L:1Y@L/1ɺ1LAYHHpHL9/LpHL1{YAZA[*]\ff.fAWfAVAUATUSHdH%(H$1)D$@)D$P)D$`)D$p)$@HH uK{nA{7HD$HyHD$@E1L=I~HD$(HD${U뇐HHkL  @LDL, H (Ld$PLDH4)LHD1s{h{Ld$ t@sHD$@L%kz11ILLT;e{x{}L>,1ɺ1L濄TC{hwHD${I_fDuu {n9Ld$IAuu {ns{h{~L+1ɺ1LS@DT$pDD$<su{hu { HGHcH>fDL1Lj+`SA{111E1DHLqH5xS10LL+DT$R;sL+Df.L1E1RDL$@H Et.H.,L1H.,zWIL0-L1VE1TR5L+JiL,TSL+H=LF+F'L+LL,PL$,RL~*BL+ND$<tL.1ɺ1LeQE$ELL1E18QIL;1L1A Q{ ߈Ld$A&iLHL wLEL+11PiL+1ɺd1LPGEL{hq{DT$v\L+1ɺo1L#PL+1ɺt1LPL+1ɺy1LODL$@L% Et.L%,,L1L+,TMLI,1L1{O>L_+1ɺ~1LYOLu+1ɺ1L7OL+1ɺ1LOL+1ɺ1LNQfAWIAVL5ZtAUL-ATIUHSLLHH$HL$ 1LL$(HD$0dH%(H$1RLi LdNHYL^IDHHLD$Ht$H $KH|$@jH -SHL 81SLD$(HAPLc1SHt$0HVH5SL\$PHVASQATVHL$XQH PSAUL-A LILE1LH$HhjT$PHLD$L0 _AX.DL$JHLHLhfH H) MHLHWLpMJIIH93HE1HLHp-HAHHH9uEIcHJH HS ML9M扅IvL费IFH@@HHH9H=PHtHzHcH L$(HI$IH{~11AL[%HE(XZDM6L9DMIjLH5LHM覉H@E(1ۅ~"fDH HCnTCKf.H5LAGqH5L*GZD{n<{-{fHf<HT Ly$M H@ L#MHO L#MHJ L#MG|rD0HEt1HO,L1H-,GHP; L"MDEPLf$ M@HEH5 HDL  LDLLDL@H LHDHH1V@FZYL 1E1EHLH5]gA7f 1ɿPL 1LH5'gAXZf.H1ɺ 1LAYA@H0ILLPHH5jM臅H@0ASHA. ML@[A]&H;u{n{He1HL~MR@HA[L[M@@HE L MGfL t EUHg L MHL`HH@IH6HHH9PHGHP HHHIH5d1S L?^_~H fH) ~H1ɺn 1L>Ip.=DžIpHLLHH1>LH(6H1ɺa 1LJAJ>AL H P{ LMd=.LlAQu M6IL HAAVH1ML}$ =A_Xh@=&H@HzdHE#QHxM1L=Ha^M_APnHL@MH`HL McH4yDExAHSHHK HATIL3AZA[AHD[]A\A]A^A_f.}uur}nul}ufL41ɺL1/AfH1ɺ PL5TL 1LLP/HsPAXAYHHC`HD$D$ H$H%H&H'MH]$HLxL1L` 1.fDLKHL}1ɺ$L1.A@H`HuDEeH[H$PG uq@HxLHsHL |D}u}nML$ D$HH`HH9PHH@H<HHt4}uu.}nu(}u"Cc@tH Ht@HSHHsPHK HL AHHHH9H1ɺQ LLL1,MAAL1ɺx fDLHsHL;d L1z,_E1AXL 1ɺQ 1LK,HCPHLk LsHfDtLAZL1ɺ| _L1ɺU 1LI+AxAA BA}0<I]H5H.IL1L 1l+LDT$AtIWHE\$ AFDT$AHIIwPM ATIO LGY^DT$AA EAEADL$ ȃ BAHAIwPIM ATIO LAXZEALHsH1 1LL`-*XE1ZGH1ɺZ LIL1)L1ɺr 1L)bfDAfDL1ɺu 1L)*fDMOHL1ɺ fL1ɺ 1LS)L L1.)E1JL/ 1ɺ` LL(ILV1ɺ 4IL1L (AL*1ɺ 1L(I]D$L1LN g(DL$6A{ff.HG`E1H$H&ryH'rrH(rk udHx_H4rXH-rQH.rJH/rCHtH$s6E1u*H7r#uuH"rH!DDËtf.AWAVAUATUSHH $H1ҹdH%(H$1H$HHH*HuƄ$H$HAHf,E(HtHxJfD1D1VfDHH5H|$AEtH|$H5HfDTu GatfD1GfDGgAWAVAAUATUHSH(H|$H\$HdH%(H$1Ht$HxJIIAH1@fDA9OAyOAy_LLLzA9u$HE8OuxOux:uALcD$IN|MA9-uAy-tb1LH5LT$MLT$A9OIL$t1LLLPf.LHL$HT$E1Lxt$CtT$A9HD$dH+%(ueH([]A\A]A^A_ÐH H…t JDHHLPH51RAQAfAMH fDAWIHAVIAUATUSHHdH%(H$1HHHHH$HǻI&fHxI|HH AHuLDLL`H$dH+%(HH[]A\A]A^A_`1IٹLH5AFfAFH$dH+%(u.H[]A\A]A^A_ATAFffDAWAVAUATUSHHdH%(HD$81HD$IIHcHD$E1fDHT$fLL)D$)D$ AfoL$foT$ AfAAHHID 0fAII9tPMtjO4LNnAH5L|u`HcIHA8I9uHD$8dH+%(uiHH[]A\A]A^A_I$8OuxPx:ktfDM1LH5fAM.AWHE1H sAVHAUATL%*USHD$HH)fA<$IcHD$1E1HL5)sHMHH=*L AIHA"fA9uIcHmfA$Hi3t AƄ$fAt AƄ$EfEt AƄ$fAt AƄ$AAtbHmIL+HH(BƄL9uE1L*LHL9tuf;uft-L:H4IMHf.D9tH(L9uIIuAHD$ IA;[]A\A]A^A_CƄ!IIYAWIAVE1AUE1ATAUSHH|$ 9HD$DH8 AthAAtDA2tnAAHDHI#tA0trA1Et|A AGADAGuqAA2uDAGH[]A\A]A^A_fDIWH5 1 P@AWH5 1p /H5 1U wH5 1= KHH51[]A\A]A^A_ AWAVAAUL-ATUSHH8GDgt$HHAT$ ADfD$&EtH{Ht H1H5p fEf ,HD$L=L5 ID-H\$Hk E1HD$(YfH51=H[LHIT1!H}HD$AH( D9ADeAIcH[HAT#uH51fD 1fH\$Hk E1L=L5 _f.H5N1mH[LHIT1QH}HD$AH( D9~3Hc]H[IHAT#uH51DH\$D$AL=^fD`HHl tnT$EH5{1T$H5U1tKvH5 HIT1TE1H} D9AH(LcuDT$KvMHAT#EJF D9D=y+)H51 fG+?D$|$f HHtEH5V1`HHtH5E1AH561.t$D$&IIIJHD$f ~L AL%d@Mc}L$KLHEL#Et;efHUH4HP(HfH(H9[;(u D9AI( D$fH E1fDAH(D9H}tH1HdfH51tH51T$4E D98H51f D$ uH{Ht H8 []A\A]A^A_fDHDHDD$DD$HA*HD$fxvB8H51DL$DL$EAH51KH5 HIT1I}H51 D9 T$D$[H|$HD5H|$HDDL$EB D$.@HD$(@DD$D$@H51LH#!fDH\$^1H5E1fH u@H51tH1HAH(D9~H}tH5@1+H; H5C1ATUHSHmvHHPL% 1ɿRL1IL H}PY^tH}P t[]A\fDHvHILP#1L(X1Z[]A\HH\fAUATIUHH0dH%(HD$(HF`H%r Hƒ u\HE1auLUIH51HD$(dH+%(H0D]A\A]fHHE1E1jHLjj.H z$ouAHtytLl1ɺIL-P1L L1H*iAąuHktLLI1 ;tL1ɺIcAUIHATUHiateo%Au D]A\A]@HsL1ɺIH5|1 HL!D]A\A]HAsLIH5.1D]A\A]DAT@u4uADA\1E1ADA\f.19AąuL^ 1ɺ1H5Af.DGc@HHG(HRL9*H5^DH@HkFHкP1Hff.AWAVAUATUSH8dH%(H$(HG( IIE1E1D$(D$D$4f.KIG(I D9~IcH\IG@HtHcHRHf|(tH~' Ht9uD$f.I}PW6N*CK H.PHcH>@FIG@AH f+ +A}xeAmxLpH1PA1L!+H5fL$8D$XZ ~"u.LLA{D$kfgvL j=#I11LFH5BD$DL L# 1ɺH5q+fDA-HE@AHHPfxIID\H9 D9 At0t+DHHtf/ALHT$艚LhL%kIH51"HM@HE1f/Iy/IH9 9 A:MID$xAI9N IG@t$IH@LHI9ǸLDM$HT$xHLL\$1L\$ D$x  E1L'IH5q1E1uIL|$Bf@HH1H9HEHD$fIEXAHCHtHXIEPH8Ho@H) f 1H-CIEXLgULq"1SI~H51;L$8D$AYAZIEPIAHIH9øHDHB@H> ft S@f  CDt 9C@8L$(D$b11ALLA L3fL1ɺIH5Ϸ1_L$(IEPH@H@h`PA]xLeHAPH5y1LY^HC@H1ft U<fHD$PH4IEPHx\HD$0HjLSHHCHD$,HD$I9jDd$8MLt$@Hl$XL|$H^H1HHD$ L8Hv A|:MLrAHLH1D$,M$$L;d$fA$0tM$MbLdHt$0HhHHcD$,HHHD$ IEPHxjIHGHD$ L 1ɺDd$8Lt$@H5H1L|$Hr&DIEPA1HH@@Htf8tIIH9¸HDIE`  @X9 X9IEPA1HH@@HtfXt<IIH9¸HDIE` @TY9 YIEP1ҾAH8IM`ƒt HHHuHH7r HIU`LbH1SIL~H5V1L$8_AX+1ҾLAKIW@HtftA9Et AEt 1ۃVL bH1ɺSIL+H510A[L[aL>1ɺI1Ҿ*LA|IE`HH39 HH3H3HEƒL$(D$IE`wfDIE`IW@AHH$f** H LIE`aL1ɺOIH51CIEP1ҾAH8览HHA I E`IE`L`H1ɺSIL8H$1 I9HHT$tLDD$tHHV D$ttEp A9$1уt(A AH$Ixt1$A AH$It1$A AH$It1$A AH$It1$A AH$I t0$A A$A@t0$A@ A$Ay0$Aဃ A$A$փt%A A$At0$A A$AH$B$A A$AHH$HIIAL 1ɺd1H5PLH-2y]=HI11L9t$(Lb D;d$I}PIG(Dd$(D$ D$=SIwHL\$Ht$aHE1E1jH1HjH$PHt$(茍H L\$ $zI\LoIH51IS\=RI11LaH5ޭE1r1L#LW 1ɺ$1H5E17LkE1=H5{ L[HL(I|HH59P1AYAZEL4CDL 1ɺ 1ɺE1L H5{H LIE`[L1ɺSIH51:}HHHI7I#E`L 1ɺL 1ɺL 1ɺH51|HH@HHH9 mDHH@HHH9i8ff8 HHHLA 1ɺzH5&HtH$HHE@Hf/IE1ILJxILJHAA)AH#1ɺE1L H5VIHT$H9EHE@D$x!IEPH@H@@at EvN E 1҉É ]9mH QL1ɺ H5L1A_AXA;]xiLpXL,IH5 1Mn1E1LH5۩mL1ɺ1H5G1L61ɺH5&HE@H f/ t$l}1ɺNE1L H5IWL׀ 1ɺH5*1E1&     1ۃ L"WHLSIu1ɺkE1LA H52LVHLyISL 1ɺLVHL&yISA]x9v1HLLGHqADf=<LH_H5ŧ11XC@CDWtGH$E1E11HLLjjjH t$t$LUL ;IH5=1tGH$E1E11HLLjjjH t$t$LUL HIH51HLTLOIH51LTLIH5P1Ht$tLNhDD$tEt$lS>H 1QAL'1H5tXZA;]x74L THL -LDHL PKDd$8Lt$@Hl$XL|$HHT$0HD$PHl$HHT$ HHD$@H+HHgDH9\$@uHl$Lt$0L|$8Ll$Dd$,IHl$ HD$Hu1HXPH;HHLHL9uM?I9IWH9B@uAD$LE1uAtNtE1@u>HPXHJ`t.HHHH$HfLhXA$I\$@Htf/LEHIEHLH=RH1(h1LILF1LHǤtSHE@Ht?f(tLHHE@HtftLH_t;]A\A]L1ɺL=g 5]A\A]f.1ɺLL g fD1ɺLLf }HG@HtSATIUHHfttCHE@Htf(tLHtQH]A\@f.L\f 1ɺH5Af.L,f 1ɺH5zf.AWIAVAUATUHSH8dH%(HD$(HFPHHtjta1HE HLuILe 1ɺ H5HT$(dH+%(H8[]A\A]A^A_fLHLt$HLt$I9ĸLt$LD?)AŅHmLH ZX Lh?DEt p=|Hd;IT$HHB HtcHHt[LX@DEHLH- D E[CPf.HB(I$H5HUPH L L=lLyBaHSHDPEVLDL1R1ɺmID$H HPHE`I$5H%H*HE`AD$LH4@HID$H@PHxtHHID$H@At$L1S@HӉD$ H{H$LH|$H$D$ HL$L3HKHL$HH\$A;D$LHII$HH|HuLb 1ɺ1LHIG@H>f/0Hx&ID$@H8XL`IL=1L1Lb 1ɺLs;=!A6fDHX8DLOIZLH$|H$H|$HBHD$L2HBHD$HHT$HH5.pHEPH8!E H=1ɺLLa H%H*HE`CI$ L` 1ɺ1LHH M7HBHID$@HDHP HtHHt LILH(ULSL1BZYIT$H5BHHD:9t' 71LID$H\$@!L9CH{GHL9u-f.HH6cLIJ=HEPH8EuiA!DH5H=H1gX}@L,X 1ɺ1H5(X if.ML|1H5W ٽH$H8 h'Hh.AULbATIH5W 1荽HD$H8gXZfLlW 1ɺH5eW Q@MLCH-L IH5BX 1I<$7gH$H8+gEfDLV H5X 1LV 1ɺ1H5W 螼LV 1ɺH5W }Hp[ML1H5W FA|iL0V 1ɺH5PW AWAVAUATUHSH8HFPHt$ HHD$Ht1Ht%1HY HHAHCPHD$HD$L ID$@H ff/T$,=HD$HHxfHD$H"Ml$HI\$H1L9u/l@LLHHD$H8MmI9BfAtMMHL$HcLHHD$^I|$LpL}eHHuHD$LT 1ɺHH-}1H蕺*H-|L1Hi1LcT 1ɺuHLH8[]A\A]A^A_H|$ *H=|H1ZMH5уLt+H5ɀ LtH5|Lu>DjAL﹦hAO1H5H_AXIm@HDfDc ECfDLeLsCdLC`LIm@H:f8#L7fDH5.LH5LfL1H5谱f/sDKhEH8 HCfHC@HsLuhf)7Hp)HC@H8HS@HL׸AąLK 1ɺ1H50(fDL)H51E1ɰ@f&A}DLDCX@LIDLdJ 1ɺ1H5|GtfHC8SC ftXH } HKKfVLy1H5̯1 f&uzLI 1ɺ1H5良oH!HChHJiHFff.fAWAVAUATUSHHdH%(H$1HHHHIII1HIHzL PI} zYIHL6I}HXHVYHH$HxLHHILHLHH) H)։HID$/H辯ID$HH踫I}LxLXHLHH衴LI$腫I}LxLXH|LLHnID$ID$H$dH+%(qHĘL[]A\A]A^A_7/$ ATfTfD81E1LH5vAi@I$L 1JH5A I}LE1k%HILj1S=H5E1LfLa1BH5茬ID$BfID$2f$ۉATT6fDIօu]t9EHH ȆHHDȸL5HD6DL'H R@6f.AVHyAUIATUHH(HNHdH%(H$1L$LLL|xILt$H}PLL`HtLHT$ L1AătXLaH5;1E1H$dH+%(H(D]A\A]A^L$ H L1KLx1LHL豐HuLE1亟H5gaMff.fAVLAUE1ATUSHI9tKHE@ELt-HH@HZLd Ct*tmHI9uHmL9u[D]A\A]A^H;HG`tĀt @tH<A묐KATDOfDHH@H%HAsA[]DA\A]A^ff.HHH9FATE1USHHt HG`uwQLtaHHRHX8H,tDHH9t9H8uHxHG`tĀt@uqAHDOH9uD[]A\AĀz,1҅IAfff.fAUIATUSHHRIHI$IIID$H9uP@fH@ @HSI<$HPIT$L HPIT$HID$HH9tQHCt닀tI}(TRHu1E1L)H5xHL[]A\A]L1H5{FH ͣ $H5D H=D EDHW`HHt]H9'H:tH1Hu*ÐHzHW`tƀt@tH1HtָGath7H9uӸff.AWAVIAUIATEUSHH(H9F`$D$ H1AD9tsHK`H݀HLL9jH9t^EIF@1Htf/LHLaAąvAH(D[]A\A]A^A_fDHqHN`tŀt@uHYEtHLL9ȷfDLL$LE9HSPDSpE1L $L\$DGL\$LL$3HI9J1HI9u1DL$ MDHLL$6L$-E1L葃AąL> 1ɺ1H5蕤H(LDA[HHz]LA\A]A^A_L\> 1ɺz1H5t?jf.HHH9X$BtD$ 1f$1ɺE1L= H5УL 1H5q 解L= 1ɺ1H5E1胣ff.AWAVAAUIHATUHSH-HH}P)HIEt%HAEat H3AE9*HHIHuIIL9%LMt]AFatVH9tJLE1LHhxAƅu,L< 1ɺ1H5k:fHEau21HAƅ5AHD[]A\A]A^A_DALH1LuAƅuL; 1ɺ 1H5ݡHH5IL@1詡HHL[1]A\A]A^A_Ivf1҅H EHE1E17AƅLS; 1ɺ1H5k6L,; 1ɺ1H5DE1 L: 1ɺ1H5ߠf.AWAVAUATUHSHdH%(H$1Ll$LxrEdu:AH$dH+%(QHĨD[]A\A]A^A_LuHH5qALʟHtL)L|$1LHHLʣHt HH}PLJHHxHLqPHLIH51諟"fDHE1ELYIH51nfDJfDHLDIH5X1!AWAVIAUIHATUSHH!DK EH{?tH5m ǡgH0In`HHHHHH{H5rAąIE@Hf8))L1H5ODDCEDH{?7Hs Ld| Aą!L7 1ɺ1H5踝CChALhAIFPLMtH5LL $bCu KhClF9t DQ-DShAwE&E9t1MNHL&11H5!D$In`D$t DKdEKC AACu s1҅OLD$5D$L $ tEL t9L kt.AL18H5j DD$E1H5a11ɺLDT$ H4$IE@H4$DT$ Hf8,AFaD9s E9E9D9LADHLLFAąK\L ; =:I11L2H5AW)DALI5 11H5a,HD[]A\A]A^A_f.HHrL L^ H&H5LLDHHC E1P1^_DHIn`H LP+AL $CE21E1LH5f1@V1E1H-/LHH1LGЙD9AE9LE1M LIH51vE =I11LH5mA7fAFaAIIH9t1HH9uLH4$ H4$LI+1̘H4$PfDEA)DShA@H5A1L5H4$zH4$Lr2 1ɺ1E1Y(@IIS`H9;L!1 H4$D97ChHAvHEH5L1Ht$輗AZA[H4$9L1 1ɺ1H5臗VfIID$H9ԩIFPHHs`D$DLHxjDڃE_1AXILY1H5.D$%H5LKH4$ʖH4$KAWAVIAUIATUHSHHdH%(H$HGPHH$1H9HD!I}L%LVADžu_H$H@@HtBf8)t8)t.Lo19H5? DAEAEhH0I#F`Iu HHCIM HPHq@uH9tu AUD$LgLLL#ADžH$H@@Ho fMD\$EEpE Iu AmdIu uAE`HAM(AU,WLPAEtPEM|H ADž L=I11LNH5袔A>f.Ls ADžLy. 1ɺA1H5\H$dH+%(4HĨD[]A\A]A^A_H9A1L. 1H5(AMPHC@IH9,HPBs@LAUhAMlDt)ЍzEA1A9D$ERAEt qIED$8AE uAEt3I}H5xa DT$7DT$L^oQAEE}EHCEEHPHHE:t{Lt =I}?H5; HT$ DT$H|$(褕DT$HT$ H|$(L腕DT$HT$ H|$(H5$` bDT$AHT$ fDd IAMdH$u uA]`Ee,ML9AELH LDT$HKHDA9HHT$HHBHD$ DT$ AELDT$=IHH9HGDT$HH H H H HT$(DT$HT$(HLL$ HL$E1H=~DT$d$DT$H5A@PIE LC~p(1\^_DII^PHD$8IE@HD$(AE,MD$LHHD$0L9IE$HD$ H@HD$tAEL$LHD$pLd$`Ld$hLd$`HD$@HD$xHD$pMt.LH5DT$LL$誎LL$DT$ALDT$hDT$A$D)ЃLLE IH5' 1:DL,% 1ɺ1H5Df.LaLIt$AEpE1IE 1E1f8sLI H5!' 1E1qH$L<\(CLH & HL$b$HL,@IHM<$Jl(M9u@M?M9~IwHtHJ|( FH1LJD(H``hADžLZIHJ|(F =EHI1ATHt$L1dHA\A_Jt(IFPH8ADž{LLAIHJ|( =HI1ATHt$L1߈[]|LD$D$L1H5蔈3HD$Y NLl$(HT$THD$L'5D$DL$THBAUL' H5$ EL  LD1AZA[LLȁ IH5z$ 1͇L! 1ɺ1H5謇KL1 H5.$ 胇",$$IDHt$1E1L EALDT$VDT$HD$ H@ HHHLIL1! H5# ؆wI 1L=H5W# 謆KL 1 H5.# 胆"Hp(1HD$ LH(kLA =I11LH5[+L$AEpE1AE`1UL 1ɺ1H5߅~EuIL}IHCHP H2HH&HH1LH=!Hp(mL 1ɺM 1H5 pLH Lo IH5 16I~P\LH|$0HADžI~PLlRADžI~P8gtI~P{Y1L 1ɺ 1H5] E1~NH|$0H-ADžL 1ɺ 1H5 q~LLv IH5 1?~L6 1ɺ 1H5 ~L 1ɺ 1H5 }LL IH5n 1}`LdL6 IAAWL=AVAUIATIUHSHfDI$I$HD$H9øHDID$PHHt%Q}t1Hu LLYL!LuA>HCHE H5+K LuuuHC@ ݆t+HE H@ H@XHt1HLЅLuLLu_LLtPH5+MLqt=H5#J L^t*H5LKtUuE DIE@Hf8Hu HMtHUpLLM|LExyZ9LuLL~t>H5LL~t+H5I L~tH54L~u DIE@HfID$`H0ra@I$IL9HL`fDLL%HE HLu$I$H9D$HL`ID$`@|H1yH #HC@uHx(H5B}1ҾLHLuIA> H5L^vIE@Htf8)t M'HE H@u RHLzH[]A\A]A^A_I$H9D$HpHu Epo@L 1ɺH5yH[]A\A]A^A_DL 1ɺH5yH[]A\A]A^A_H5G Lv|IE@Hf8)MH5zG L;|H5! L$|HE LC LH(1H5xH[]A\A]A^A_1LH5xL 1ɺH5xHLL[,IE@Ht(f8)ufufufHuH5L&{tHE @LL ILL:ILz%LIIE@Htf8)UfGHE H@6Ā-H5(E LczH5LLzLLcI,AWAVAUATUSHHdH%(H$1HH9IH~PHIDLXHhLI]H1ɺfAVI1L5LLvXHZAt AD$cH L|$It$HH$L3kL1ɺLIL߽1vH}PJ^tH}PPAL 1ɺ1LuE1f.IE@H5f$'1L̼1ɺLxuIE@Hcf/UǃLHD$ L; 1ɺL1"uDL$ H$dH+%(UHĨD[]A\A]A^A_ÐD$ L 11dH5tDL$ @LLLD$ L 1ɺbIE@Htf$fL1ɺzLIL 1HtH1ɺ{LIL,1 t|LGEDHLILH={H1! HLLAŅHLL%vH=LHI1SLl 1qY^EAAfDHL* 1ɺIH5 1pHtL+IH5Ծ1E1pDL8L?IfLl 1ɺ 1H5OpRf.HL/IoLHH=LHI1S, 1L[oXZHLMAŅHZLLI 1of=9L- L1LToLD 1ɺ 1H5\'o*fLch+sfHXdH%(HD$H1HtYHtTo&ooWoO 'onoG0HG@oov w o~00HV@HW@HF@VN F0HD$HdH+%(uHXpqAWAVAUATUSHH $HH $H(L$ HIԾ1HLl$`LdH%(H$!1k>L1H$1HHD$8C>HHD$`L9€HHT$@Ht8uXR 1E1LzH5ֻmH$!dH+%(H(!D[]A\A]A^A_DHADžH{P1LHhHD$>$VH{PHD$H9ht.oUH{PGHCPHhHD$HD$@HhH$HL$HPPLHH1H|$LH_ HL$HNHt$H$H|$HFPLNHL1  HT$8LH D$8H Ht$HPHcHL`HL$PHcHL`PH Hc҉D$8HHL`HL$HL`8Ht$@HsHT$<LH6D$$9HI9~HtH$Ht8'fDH|$@iHH3 /H|$iHH D$$HKHH|$1Hf H{PHT$Ht$ HH{PHD$H9hL$ L1L-!H1Ht$@I9HD 1HHt$@HH F`HT$HHF`H1Ht$I9HDHT$Ht$@1HH|$@HGPHhH{PVRtH{PDcH|$@1ɺ LIL?1iHCPHHH9A1HH9uAHI9t|H 1ɺ LIL,1PiHW L7IH5P1E1ipL  1ɺd 1H5$hIf.L 1ɺ` H5h@HD$} L:LHHmfLɲ1j H5lhL1p H5qhhfHD$@ LLHHL- 1LgH|$&fHH{ H|$YLLI 1gDl$1ɺ t$LL$L1LOdY^^gHI9wLHD$HI9HPI9t$ PL-LHCPsHL1xdH D$$Af.fAWAVAUATUSHH $HH $HL$(Ll$@HHLIԾ1dH%(H$ 1D$0HH04HD$@Cft9HHH9vH LV@fHADžyHICe EIIHL$H9yvHHD$8HD$@Ht8uVLo1 H5OcH$ dH+%(H!D[]A\A]A^A_fDH{P1LHhHD$H{PHD$H9ht.JH{P9=HCPHhHD$HD$8HhH$HL$HPPLHH1H|$ LH}HL$H}Ht$H$H|$HFPLNHL1@HT$0LH蓞D$0H5:HPHcHt@Ht$ PHcHt@PH5Hc҉D$0HHt@Ht$Ht@Ht$Ht$8HHT$4LHD$,'H|$8_HHx H|$~_HHx D$,INHH|$ 1Hf#H{PHT$Ht$ SHH{PHD$H9hL$(L1L-I1H9|$Ht$8HD1HHt$8HH F`HT$HHF`I1H9|$Ht$HDHT$Ht$81HOH|$8HGPHhH{PHH{PN:H|$8L1ɺ LIL1|_IH9D$vrHA1ɺ LIL18_HH9JrL@L H5#1E1^@L 1ɺ! 1H5^f.1ɺ E1L H5^ofHD$L E1: H5LHH1P^1L1' H5Y$^Ly1- H5)]1ɺ2 E1L H5]HD$8@ LJLHHL-ʫ1L]H|$[HH;u YH|$LrLIW 1F]'H|$8P LNIxDl$4HHF AUL-%ILL1\ZYLL` IH51\L 1LE1t \i1ɺq LLp h\HH#F`LL 1LE1| 2\L-QHLJhHHp`(8H{P[L 1LE1 [L 1ɺ 1L[LL$ L)e H5ȩ[tL 1LE1 p[QV^fDAW>IAVAUATUHSHH(LnPdH%(H$1Lt$ LHHBHHD$dHD$0H$FpD$T$IH$H$DŽ$HDŽ$DŽ$ DŽ$(H$H$ǹI9HE@H fHpHD$Ht$HT$IHaAąHD$MHD$pMtL=ZHH1LH9HDfAąH5HH$H#LӷLLPIHA1ۅLLHAąIG`IL%I F`IH9HD$HDAą+1L8Aą6LL-GLI=łLHI1AT 1L1XXZA.f.AL 11 H5ѦXH$dH+%(H(D[]A\A]A^A_HD$1*M LLH5p1E16X@LI9tLHAą-LL~IHLIVHHo AąHK5t Uu ` kxfDL8 L?I#Ld 1ɺ 1H5|GWfL< 1ɺ 1H5TW~f.L 1 H5!VKLL IH51V@1ɺ E1L H5VL11 H5\VL1 H5a,VL 1ɺ 1H54E1U[H11ɿL  HUI1H9|$HD%LLH/LSHHDm LtUtL=7 H1LҚ @ULSHHl AąHLLLI! 1TNL 1ɺ) 1H޿T,1ɺ, H޿L T L@/8L</ H޿uT[Wff.AWfAVIH AUL-Y ATIUHSDH(H$`L$(H$.DL$L$HD$ dH%(H$HFP)$DŽ$HDŽ$HD$1EHLLDHIL$@HH$HHf/HL$1ҾLHL$$P$$T/H$Xt HE`H%r H-HD LIH5.1RE1H$dH+%(vH(D[]A\A]A^A_1Ҿ>LIL$@$PH4DŽ$T17f.LLeHD$HtHD$1H$LH@ PXuNML L +DD$L( 11A H5@ RDT$ HEPHHt0 Rt'1HkJ HL!uE1HȯD$XD$/D$/D$uD$0ID$@HfLL$M5 HD$H$LHWAL$H|$LLL$8LL$8H LhM~ L9M9 L. IU`@ H1HHMMt H$LHT$8_AHT$8t MA$IEPHHt% AH@HLHa 4HD$q\ LIDH5̗1IDT$LD$0DHDŽ$E1D$\HD$HHD$PHD$HHD$8HtaHAIDŽ$HD$`HD$8WD$l L$L&fDHD$`DŽ$LW LIHD$HD$\H HD$8HtHEHt$LpH~LHD$@HtHt$8LHNLEHLLD$8ELpHD$LHxHD$`HHt Ht$8LND$/oM oU0)$$HD$@)$HD$8HELt$Ht$xAVH$PH$PAUH$PD$HL$H H@1ɺ Ll H5E1E1JGHD$HHt9TGt0E&Mt"M MtA.H$H Hx&E1H$LLH$L$L$s)xL 1ɺ 7Dt$0H_HSH EHDMHHHDHL61R PH PL$1Ht$`,FT$PH Ht$@L(11 EL蠶| L_IH$1HHD$L狐QLD$P L2? IHt$hH=1L HHƄ$dL$ H$p$$ L$$LD$0$$DŽ$($HD$ HDŽ$0H$H$H$H$HEPDŽ$HH8$(DŽ$THDŽ$LD$0HH$ H}PLiHD$0HR HD$0$HT$ H|$pp.DL$EFLuPH5oI>IH I>H 1H(IH HH E`LHHH9 @LLl$0LxLǀHǀH賲v L:IH1 LH޿A=|kH޿L w 11L AE1HLb1ɿR PH?PL$1Ht$`XAD$PH ELHL9t9M1M6L9uL1Ƀ HI9uGHt$@L11 @H pe 1LL&HD$ HHt$ MH@H F`IIn`%I9rHD$IGID$@H0f"*1LHL$PD$$$D$N^L _1ɺ FL$AOTIFh1LHHHHL8ILJlLDL$E1E1aDL$ LH5AQI1AV?XZ0IIm`*LLL2 tZID$@Iu`*HD/$jA11P1LD AZA[Ll$0'L< Ht$@E1E1>IUHHt$IM L LE1E1bHt$@L1I* 1>>LG E1H|$&XH|$FH HD$LHPXHt$@L 1ɺ >E1HD$ |$HDž Idž Hǀ IDž |$(DHD$8|$XI \HD$`E1HD$8HD$H$LLHHX9Y 1LL4-LHIޅHEHt$@1ɺm E1L" E1=L9MHH5TzL$$Iy(LL$pLD$x?LL$ptH$H$LD$xM9IMHH5yIy(LL$p?LL$pMI(Ht$@1ɺ L1c<[LH5` >Ll$0LT 1ɺH5_ 9;HD$LpLAR1t$PHt$P;H$A[[1HHt$@ 1L^:Ht$E1LLM L||$XE1%IGLTH5"_ LHH1e:"E11+LR 1ɺg Ht$@E1E13:L* 1ɺj HD$L LV1t$hHt$P9_AXH|$Ht1lH$1HL 1ɺH5V^ 9aHD$L[ LAR1t$hHt$Pm9A[[1H% Ht$@1ɺ MLF 99HD$ 1L>LU1t$PHt$P9A]A_Ht$@L 11 8Ht$@L 11Y E1E18eL 1ɺa TLDHt$@LI 1q8H|$`H|$HwH$HAWIFPHHD$8HH|$8A:8HD$`HD$8H0 LL)LM膨Ht$@LI 17Ht$@L 11 7L 1ɺH5\ k7Ht$@Lb 11' L7BLC 1ɺH5[ (7Ht$@ MLE17IFPHHt 7AkI Ht$PH2Lt$I~IuHI~HD$PLHD$H裔Ao] Aoe0)$`)$pD$\%D$\HD$HHD$PHD$`AHD$`ALIAUATIUHSHHG(@f$f(t41L.H55H[]A\A]1AIt$PU\HTHALE1PDLHAXZEu1Lc 1ɺ:H5}H5놐HE`H}E1HHHuL 1ɺ5H555@E1Cff.ATIUHHHvPW\H AEH8[]A\A]A^A_@L 1ɺ1H5,1H8[]A\A]A^A_1LUH51H8[]A\A]A^A_L 1ɺH51WL~ 1ɺeLk 1ɺ Rff.HHW`E1E1HPHfHHW`E1E1HPgHfHHW`E1E1HP7HfHHW`E1E1HPHfHHW`E1E1HPHfHHW`E1E1HPHfAUATUHSHHG(@f%f)Lo@MtfAM]\Le`~'{HcHcHHHHt:HLL1HM,$LH &]\HE1PE1ZYH[]A\A]@Lo@MtfAt=Ml1LH5a},/H1[]A\A]E13HHW`w\E1H)E1PYH@AUf1ATUHH dH%(HD$1)$HD$6HtcIHHHU`ID$HE1HMPLHAXZp9HD$dH+%(uLF#ID$@LT$Hf/HLT$x!LH: LT$HHH9*6H@@@u/LLT$HLT$tEa DIL71LR1LT$"LT$H}PLT$XLT$]ARpLDHLT$TLT$Y1L jIٺdL=KL/11 "L-$pL 1ɺ L!ff1ɺ4LL !=H1M%LLp!XZ 1HLT$H=˧覴LT$#tYHvD0Et<  +uYu=++kAD$,tI|$@AD$,I$H |L1ɺ#L L?-t$HL$H3HF! Hl1ɺ&LLњ @Dt$D$0=i*8LLB11IIH9HhLHD$n^L+蹼AEhD$0tHt$1HxLp=)LI1ɺUL+1AfDI$H>#tzHDT$=t .DT$t: B)u {sDT$H)QAD$, I|$@DT$AD$,I$DT$fDHDT$zDT$LDT$T+D$DT$uWElffDDt$LL1E1H3HL$(HDT$H $DT$u1ɺ[LL DT$_fD1ɺWLL] UDT$ L1L(DL$E}H3HL$(H] H^1ɺ[LL >L1LRDt$E1LLD$Dt$DT$I$LILA<=AٺAHL=C1ɋD$L LP1AZA[DL$ELID$@Hf$/fD$)؉$$ACHDL$rRDL$T=L=mBL1L)DL$HD$EL=7BM1HT$0HQ3D$0 LHI9LIU;B ID$@Hf/HEdIUHHB HwHHkLSL=A1ɺDPDL$@1LL*EXZH12ID$@Rf/u(1H=BL 11L L$DL$"hHxb-LOIHHH9!$V=1L=?HHL1ɋD$0LP1AID$@AXAYHy1H=a1D$$D$&D$H11`SLLXZM鋌$ALHLSu$wtf.D\$,EtdEatH9D$tKH`HøEatH迀S\$L+1ɺmLSAA)1AYAZDD$ E@HHDt$(A9*HV`HH{HSLAVA)L1Eq1u^_`[=I11L׈H5k=;ID$@aL=U=L& 1ɺ*LPHB(HLDL$qDL$HH\$H{HSH\$HHSHPHSHHCHW_IUHHB HnHHbLS5PL=<DL$@1LL1TIE_=AX7LDHL;11"cD$$G|$ \$(+\$D$ DL$H^IUIHB HHHLH‹t$01LH=߀ LEHW=LI11LeLLIHbIIWHIWHPIWHIGAODH0WwLςIL541LV1L~1H<=L5D4L/1LfDL54L#LffD=yL53L.1Lf.L| 1ɺ1LcLZ 1ɺ7LchT$ ˡT$ {f1ɺLL =LL1Yff.SHZBHt-H{HStHHHSHPHSHHC [fL~ 1ɺH52q[%DAWAVAUIATUHSHHHdH%(H$8HF`rH07H-H%r @IIH9|HLxIIH9LMIGPHHt IG`H0ID$`H4HE(@f f LLH lLSLHS-= HI1ULVH5*11A[]AfHHH9LIf.1H4 LHܱL| 1ɺH50Aof.HHH9t51HH9uu LHtHPB }DLRLIH5 01AH$8dH+%(tHHD[]A\A]A^A_HHH9fLhIf.L=H5/1\nH-sHE(@ffuIPLL5=/QLHQHL1SILV1IwP_AXHHH9t+1ɐHPHHHH9uLiL$It$HH8 LlKL Q1ɺLILW 1=tHD$@H9D$8L5,11Lw~LIIH9,Lǀw1ɺLLgq AYqG1ɺLILx1H5X%(I$G1LxIH5)%1I$HHH9Lp 1ɺ1H5$AL5$1ɺ1L5vL}D$sLHHX1ɺLLCp ;8聾tIPİLoU1H5 L1Lv1LL/vD$LHHY1ɺLL~o vHL$(LL$0HLD$,H5t H!9! D$(v|$, ! =L5#{L;t11LDL$DL$LpELIeELH=sH1gHT$ dH%(H$x1H|$0HHIvHHDŽ$DŽ$H$IF@Ƅ$DŽ$L$hHDŽ$pDŽ$Ht$HfLHHD$H;\$<E1LHD$H-#EI7H|$mAIcAHl@HH;\$ftHhH}@tI1HL HI?1HH H.II9uDHI9 HJH9A@uH|$JDE*AHIE@IHmf/_LT$A1ALtH5+1LEHt$IHD$HHEHt$EI~HL$@DLAvHHPHD$ H$HOHHHH1pLtRHLzHt{HxttL$1LHNHHHHD$ LHHH1DpL[tHLLhHHD$1HI~AH$H$pMHAA$$DjHt$ E}=(IH-H$1LtH1:H$hH5 LH$pH$hXZOH$0HHt$0LHHt$(HHAI}LA$jMELT$H5|YH_HH=r1`LT$8蔶]ff.fHcAHG@H_*LvIJ4HJ DQ(fEMcO[ILfx(F(fDP(HOHHHH9tZIcL RIHAJr(ft/Lfp(H2H0rpr p HrHpHrR HpP H H9ufF(u@JDHLNPL`1) H5n1HHfDP(HQPQ P HQHPHQHPQ P @HHG L nL(H5HLE11HATIUHSHZHvPW\H;LLHHH7AăC\uHIT$`Hu*Hx%H-HHw (Hr []A\fDHHLHDb!HUIL\1H5膰X1Z[]A\DLFAEuHIT$`Hx12@L LIH5H117f.I$I9$DHHW`E1HHL P#cHff.HHQw\E1HW`L PbHfHHW`E1HHL ~ PbHff.HdH%(HD$HG@HtftOHH$HHHIHL  E1P4bZYHT$dH+%(uHD1菱ff.@HHq2E11PE1aHff.HH3E11PE1aHff.AVI1AUATUSHdH%(H$1HH$HLD$DŽ$H$H$HILIL`LIHIV`MHL LP`5ZAYH$H9t>KD$X1LHsAȃAAHA9DLH9uLLH$dH+%(~HD[]A\A]A^@ qDLF 1ɺH5A裬됐Lq71H5Avk\ff.AU1ATUHHdH%(H$1HHH$HD$DŽ$H$H$JHIHILhL|thHHU`MHL HP_AXZLH謶H$dH+%(uxHD]A\A]fLlE 1ɺH5AKfL61H5QAuff.AU1ATUHHdH%(H$1HHH$HD$DŽ$H$H$HIHILhLt`HHU`E1MHHP]AXZLHPH$dH+%(uiHD]A\A]DLD 1ɺdH5)A릐L41[H5AƩ诬ff.@AUf1ATUHH dH%(HD$1)$HD$ȱHtkIHHHU`ID$u\HE1HMP\LHAXZ;HD$dH+%(u?H D]A\A]fDL31]H5AިǫAUf1ATUHH dH%(HD$1)$HD$HtkIHHHU`ID$u\HE1HMP[LHAXZ[HD$dH+%(u?H D]A\A]fDL21tH59AAU1ATUH-HtXHIHU`u\MHE1ɀH|EP[LHAXZ衲D]A\A]1AL?2H5VD]A\A]ff.fHH萺AEt HfD1LA 1ɺ}H5,Hff.fHHHF`t2H$s3tbHËuHݻDH$rHuL@ 1ɺ}H5f1LR@ 1ɺH5l7xff.fAW1AVAUATUHSH(dH%(HD$1H\$H$H\$H\$-HIIHu\LhHU`E1HMHP YY^A$tdL|$I9tZL-HE@1Ht1f"@ƋuMOLHLy/M?A9DLI9uLH3HD$dH+%(u?H(D[]A\A]A^A_ÐL/1H5A֤迧ff.@AUHATUHSHÅHHDHL$H:t HE`uGHE1LOIH5|1EHD[]A\A]uu?uuHAŅuw:Hs/AH[E1<MHϽHLDZHATI1LNH5}XZ1fDAWAVAUATUSHH $HXH|$H\$0HHT$Ht$dH%(H$H1HH\$8D$$ H\$0$UL|$01I9D$E1Ll$(Ld$,/f.=A1|$,M?I9t;IGLLD$,D$(Hx@ȯtыD$(=uD$fDT$EEtf $ tDHD$H@`H%H&_H1HD$H@`H%r H&- $E$%uP={LNRDL$1H51葡AXAY<$<$HD$AH$HdH+%(HXD[]A\A]A^A_fDH|$AL׆ IH531f.1E1LLH5ɠb@Ht$HL$Ll$@HLLHFPLNHHhL1A D%E611Ht$$L;L%v $LL\MEҁ$AɉR%=P11^_H|$1ɺ#LIL_M1賟1LM1ɺ$L濄薟HD$H@@Htf/4$1H=M2f%TD$$ $=DHD$Axf.L8 1ɺK1H5E1謞EALJ1E1H5}\H|$E1L%KIH5q1:=L%MLK1L1D$$;$dH?LYLPDL$1H5ÝXZZ觠AWAVAUATUSHH $HLvhdH%(H$1h"HIHD$tb1҃KHIFHH H H9H$dH+%(iHĨ[]A\A]A^A_ÐL$Hh"1H L>LH5, $IHVL|$L꾀L蓙Ht>HMemTotalI9uA:u1HT$H5nLRifL8HT$H KHIFHH H H9HHH{HIt$hjID$HL%L|J1L濄IXZAUU1LJ跛KTY^HHHHH9dHC@Htf/M1H=J.IHtH$LH)MEHLLD$LpIEPLHx$>H$HHt Ht$LAom Aou0M)$)$L,- 1ɺH5ALLg!IlL=L, 1ɺ1L贒Of.{fDLH T$ajALER11 _AXL詐HHL=ZLLBLI{1@LLCdLI1ՑpI$I$H9HL=LXLL\$@1ɺ*LIL!1pL\$gfD1LZ+ 1ɺDH5t?L1+ 1ɺL=K1LL + 1ɺ<;fDL)H5֐q@蓱fDL* 1ɺH5虐4L0kL@IL=1LVQLL@IL=LL* 1ɺKfDL`HH赧L=1ɺ1L) Lɏ@E11AfDLXLO?IL0LIL踍HH L=i1ɺ1L1) L!@LsLo?IL( 1ɺ"H5؎sHKLLt$L7衎XZ0L=1ɺxLL( xLЌHH%.XLL( 1ɺL=aL2( 1ɺL ff.AUAATUSHBb@uHD[]A\A]IL-fak@HHH9ǸHDHHHx  CLH{j1jLAE1pZYLHHuId$`1LlAŅLA%=̶I11LH5i_HD[]A\A]ÐHL=IH5Z 1豌1E1L=H5 _芌HD[]A\A]@H{Lx=1ɺIH5Z 1KfDLd=H5aZ hf1L & 1ɺ#H5n^HD[]A\A]ÐATUSHdH%(HD$1D$FcHHIHt$HH&D$0DCL)EuuH[HIAT1ɺSIL]H5]1"ZYD$tHT$dH+%(H[]A\fDH[HIAT=SIH5-]L7]1ɺ1裊^_|@H@L7<I1H5\i1WfHL;IfHL<I ff.fUHdH%(HD$1HD$t'HHt$H%tiHL$9uHT$dH+%(udH]HHL\IH5[1q1DLd# 1ɺH5[I10HHF yu!xuHHFnuxuHF1DUSHHH.HF Eeu'}u!HHCH[]Uet/yt:suE}u?HHCH[]D}yuˀ}tf}eu}tfsu}yu }tyu}su }tyu}uHCMau}uHHC*au }yu}t׃yu }au}tH5H蟊H5 H舊twH5Y HutdH5ZHbtiH5 HOtVH5 HH5| H躇t+H5 H觇tH5h:HE1葇AHD]A\UH.H5 HiAEtH50 HM]ATAUHH.H55 Ht+H5VH tH5HKHE1AHD]A\UH.H5 HɆAEtLUvtKlu}vtpptSH5OVH蔆AEtH55VHx]fD}gu}u]f.}vu}u]D}u]ff.ATAUHH.H5K@HH5, HH5%@HυH5 H踅twH5]H襅tdH5N H蒅tQH5 Ht>H50@Hlt+H5(@HYtH5(@HE1CAHD]A\fATAUHH.H5TH t+H5YHtH5THE1AHD]A\ATAUHH.H5TH譄tdH5YH蚄tQH5gTH臄t>H5aTHtt+H5^THatH5YTHE1KAHD]A\f.HHH2H8ff.AU>fATUHH@dH%(H$81H|$@Ll$HD$0Ld$@M)D$)D$ HLHHD$P1LH1HL$$Ll$ňIHHHAE1ID$H$11PHATjH$ԓAH$H HtHxW*HDŽ$LHH$8dH+%(H@D]A\A]fL 1ɺ8H5RAfL 1ɺ=H5RA{vfDLA 1EH5gRAFA,ff.AU>fATUHH@dH%(H$81H|$@LD$HD$0LD$)D$)D$ HHL$@HHD$PƄ$H $1HIHHHAE1ID$HE11PHATjH$AH$H HtHx(HDŽ$LHCH$8dH+%(uoH@D]A\A]L  1ɺH5QA}fL1H5PA}~蜀ff.AU>fATUHH@dH%(H$81H|$@LD$HD$0LD$)D$)D$ HHL$@HHD$PƄ$H $J1HhIHHHAE1ID$HD11PHATjH$wAH$H HtHx&HDŽ$LH資H$8dH+%(uoH@D]A\A]L| 1ɺH5wOA[|fL!1H5GOA&|~ ff.ATUSHH0dH%(HD$(HG@HVf!HHSP5ޅH:sxLChDKpHC`1Ƀ{tAE1E1HɃHUASVH5 Q1AQLhAPL-ARATP1RsHRiO{H`HD$(dH+%(H0[]A\fHHE1E1j1Hjj胥H HSP $sxCtLChDKpH:1ɃHC`l$E1D\$ DT$HɃ|$AIL AfDH0HSPH:W}AWAVAUATUHSHHHG@Hf!1HHHC@H`f)RL%8 1ɺ1LMLyHLL=LL5LL9HI11LLLyHCH@ Hxpt;HEPHHHx1ɺLILL1IyHCH@ H@HtHHI9t[S C$MLLULЃEbPME11RxHSY^HB Ht HH+LJ(*fL:1ɺ1LxH[]A\A]A^A_H[fDHG@Htfɀ2fDATSHHH6dH%(HD$1H|$Et1D$ACC HD$dH+%(u7HD[A\fDAL 11H5IwzDATSHHH6dH%(HD$1H|$u(t1D$ACC HD$dH+%(u7HD[A\fDALI 11H5CI,wzDHH6HHfSHHt { t [f.1L0JH5Hv1[Hff.@SHHktS v[D1L(H5CH,v1[Hff.@SHHt { t [f.1L0IH5Gu1[SHHt { t [f.1LHH5cGLu1[SHH+t]{ L'taH9Cwu[ LHt>s1҉A uvSu [L'1H5Ft1[ALI'1H5}Fft1[fLQ'ff.fSHHtS v [f.1Lj'?H5Fs1[Ht@SHH`t { t [1LYGSH5Es1[SHHt { t [1L&GaH5KE4s1[USHHH.U@uUH1tHtH+H[]ff.SH>HF )E1t C AD[@HF H>Hff.USHHH.H5 HmtUH5Q9HmuC H[]H#t1{ H[]C H[]DHH>PHfUH-CR 1SL 5 HLEHhdH%(HD$X1q{uK11L %W LEH_qHD$XdH+%(Hh[]H1ҹPH54EHtHtjIL9E1HT 1p{iPHTIL E1HV 1p/fD$Os@HW@1HtHcHvHf|(fAW%AVIAUATIUM$HSHHHoM|$HdH%(H$81H|$HBHL$HA$oJLHD$LAL$oR fod$fol$ fot$0AT$ oZ0fo|$@A\$0HB@ID$@"jr z0HD$PL$HB@BtL$AD$t$BtBxAD$x$BxHBXID$XHD$hHBXB|AD$|$B|A$$HI$H$HHI$H$(HL$lH<$HlLHl1LLH+Cq1LHLYAŅtRHT$1LL@AŅAH$8dH+%(HHD[]A\A]A^A_LL 1ɺT1H5@/nDAL! 11QH5@nfL 1ɺW1H5^@m[pDAVIAUIATUHHCt?HE`HLIE`*AątsHA]DA\A]A^fDHALH HbL%UI1H5?.mXZDH]A\A]A^D1L 1ɺlH5v?lHD]A\A]A^AUATUHSHHBcHIHL-?S=\LI11Lk%~ylHC@u7HspL1ɺL)AąAHD[]A\A]DHHxhtHxQ(HH`0HSLHH@hHe`HDžAąuL 1ɺ1LktHAZLC$1ɺyIH5>1kHD[]A\A]HH{pH HLl$UI1L4kXZff.fHtoATUHSLgHHMt LmuH]H[]A\f.HM)1SL$H5=jX1Z[]A\fHHT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1LL$ H$$D$0L$HD$LL$/ЃLHcHO@HtH@Hf|(tHHF*VLH1L H5;iXZHT$dH+%(u&HLIHcz1Dl@SIHHT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1IA I<@sHW@HtL@IfB|(uffDHH=H=t=(~gt=u@Isf.IsH$$H$H\$H\$ D$0H\$ʃHڋt9Q/vHHuH1ARLD*H59MHL <gXZHT$dH+%(u H[1pjHcHbD*LvIBD(t2HOHHHH9uDDH H9tJtf~(tFHO@HtLfy(t͋A1HIIv1IA@Ht/L AEt H1L 1ɺ-H5ԴfHDAUATIUHSHH^PdH%(H$1Ll$HD$LHHE@Hf)Hp)f.HL$PH.HHD$XD$haLM@D$lMfA/1ҾH2D$pA$H|$PD$tA/D$xHT$PHt$H(mpHKXHT$`LH,1LH'UoID$PHHt%Iet1H] LHQ4t$lHLHH-HDH1SILTH1d_AXDL$lELu1ɺ 1HdL$xu!L/H=H1H(LM@D$pM1H|$PD$tD$xH HD$P%DLa1ɺ 1HscfD1ZL\ 1ɺH5qAc.L, 1ɺH5AcL 1ɺH5bL 1ɺH5b1xf1L 1ɺHsb`f1HL@b-!eAVfAUATIUHHXdH%(HD$H1HG@)$I)D$)D$ )D$0Hf(tL_HE@Hf8HLHE@Htft1ҾjHD$ 1ҾiHHID$`H H ID$PHHC>a61HY LHB0H-L 1ɺH`^fDMt$PIHto`tf1H:Y LH/uNH-®L 1ɺH|`@1Lr 1ɺH[`U\ID$`$H LL6L=I11LH5_?f1L&L 1ɺH5ϭ_HT$HdH+%(HX]A\A]A^f.LLWIH-x1H>_fLLIfL 1ɺH5!^M1Lf!Lv=uI11LH5Ȭ^fDHE`H}E1LHH>H!H-LZ 1ɺHC^fDLLIH-4LZ1H]l@H-L 1ɺH]AfH-ԫL 1ɺH]t`@ATUSHdH%(H$HH@V,H)HHH 1V4H51HEȃttHƃuH5H1LCXH=H1HEL L1MIQLVLP1RH{1L<$LAA@tY1ҾHHt/=$MI(L,11H5R/<\HCH$dH+%(H[]A\@III*f.1ҾHaHRtLAA@Q1MLFH5.[1_fD1LH5.d[1.H^AWAVAUATIUHSHHdH%(HD$8HAL0LhHhH$YIL$@ H$f!!fAF4A$xAf+t+FAHEMFIVHpfSL1H5j/\ZL=f-1ɺ!1LH L8ZL4 11LZH<$uHhHt1LH>AHHYA$0M~hMwLH|HHXHHA$GHHSHHK HL PL y L Y^HD$8dH+%(HHD[]A\A]A^A_fI@uAdžA$x*HUXLIL$@A$xAHFA1tHA9KHE1PL=q+L1LOXIL$@A[A_HEMFIVHpHLLUML$@MthfAx(t%E^,1ҾLD؃AF,hfA(tAN,fAtL3EEM~XMLHTH L@MEEI}M~`MLHLD$H'HpLD$HFd YL)3L= * 1LOLVH}H5 IHHA fDIHJ 2H)sAHI9uLHLn LL+IuH IuHQ AU }HIAMqHW,HcH>IAF4@A$xAdžFA@MN`L}MLHLL$?LL$HQLXMDACe IG@H f L:L IL=(1LTL 1ɺ1LTf.EE EH}LcHG@Hf&1L9  AFp1AAFpL3 @HAAFH ujH} hAAH5W_AXAu IHHNHEMFIVHpIFPIF`k L=&LLjSf.L\ 1ɺ1LCS#fDAD DAF0[AE^,HHH9fHAH9uLY$LRD1Ҿ@DD$ODD$"I9[IHJEFpDMNhL.'w H5w  RDE] EI'AH(\(HD$A‰HHHHAMHEL s&H{ L,ELDL=$1LiQLe 1ɺ1LLQ,AIH(\(HD$HHHHHI@ t|AdžAtUIEL=#Lhp(AFpPHh HV1LSARP1PAH0A5I^XH(EEE~xqLsEH|$-H|$DyA;HEHHDL$HxjiAIHEHDL$Hx$L<$=4yL=y"I1L~L1JOAAZA[AVt9r1EMEAVpE1DӅiD)Ѝ9U=xL=!HLO1PL1NEFA)^_EAEtEE IHBH)A^+A^t H)v tqELB(HHEt IVXH5#IF`MNPH "I~HHHDMLDH1APL0RVH5 WP1MH0LMtmLMtaA|$0CH5LPu=IH@5 EFE  HL ANDLHsHI~PA2H@HIFP%DAH(\(HD$DHIHHHHA9HEDT$DHD\$L=DHLHx$j=/vLEH$1L 1DL[A_D\$AMDT$D"HD$AAEED I^XH7 HHHH@HD$HH\$AvxH AH(\(ACpHIHcHHHAMHD)BwAFIHd IHAutuo@u IFxEMHuXH}PjɾZYL=L 1ɺLJHIF L 1ɺ1LGuHEIMAHHxFIHgL=pL[ 1ɺLDGMI>n IHBfDL=L 1ɺLFLAvptBt<A9v)Avpf. DLL=1LtFAV1afL L" 1c H5k FA HHHH1H1IHHHH9HGI9IFHD$9LEAEMA$MxEDT$HMLjH L=xHt$ HHEDL$Hx$1ɺQLI1H$LFDXAMZ\$DT$DL=L 1jLDL 1ɺ1LD|Mh 1L H5j iD,@HEHL=bDL$HxjL}LIX1ZoCAf.L1 1ɺm 1H5ji Cf.AN IHAIF`IVHL nLIH5Hq(LE11R \CIAZA[HBA>LF1ɺ@ 1H5h CH}HDLL$L=HjiA[LP[IL1BL 1ɺ1LBfAɺB1L=|L LWBfI99IHJA@dIH@L=L1LAfL 1ɺ1LAfDI@L=L1LbA9 1B9Hr(L=XDHL1Lu#AAYAZwf.DL= L 1ɺAL@fL1ɺ> 1H5Jf @^f.LL=1Ly@ @LD H5e N@LJ 1ɺL=J1L*@ DL=*L 1ɺL?fL=1ɺ1L L?gLy7f.L=L1Ly?j@HMLL=\1LRLA18 H5/d >ALL=1La>@L[fIIL92RHH@HIF`DIFXvLwfI@?(f.L 1ɺ}DH`LGIL=1L=L=Lu 1ɺL^=>fyfDHt$HM؉jHLA IHEH DL$Hx$IHEHDL$Hx$=Y^AWAUIL=1LtLJm<_AXDL=j1ɺP1LL L<<;LجL'IsLHHHtH@HD$HIL vALLD$:LHhSLD$;LCiLIhf.LLLD$LD$LdLrI LL=&L 1ɺ3L:L= L 1ɺ L:L= L 1ɺL:L= L11FL:LLLD$+]LD$LL=e 1ɺXLILK1/:IHJIٹ2L HMLbL 1ɺ1L9Li^LIu ?v11}Df.~"tEu(t#u1D@fHgEHf.?p9v/f.f.gtDf.f.AWHnE1AVL5 *AUAATAUSH8dH%(H$(1H|$ HIcHD$HH,fDkE9|*DHD)DLcKH81yD{E9}A9HcA)H5I(f|QH5THH1L$H qsHH Au#HHuHHD$0DftHs@9tH(H9u1MH5!Lt$L5AL1MEIAAtKEOtaEt=fHrHHH(H@H(H9s9uAHAI0@EtAuH߿Lt$HHD$0A H51 D$L=Lt$f=ށHqtlH5 1T$] T$H5& 1E KvH5V HIT1% H;H5E 1 M9JH(LcsDD$KvMHAT#EWH5 1H5q1W@1DD$H5 DL${HD$E1DL$DD$ Ht9tKAH(A9ufD1H5h -A&M;1fDDD$DT$EAH5 1DT$DD$L1DD$H5 DT$LcT$HL$DD$KH HJHH D2fH|$HD@H51EDD$DT$b{9.H|$0D$,D$uOt$(toHD$ @HD$8H H5 HH<%tcH=7JD$D$HH[]A\A]A^A_Ë|$tD$L1ɺ#1LM"D$H=IL3L1"{H561*+DAVAUATUSHIՃtNH:1AAI|11EDH9HD[]A\A]A^@H:H5WH|$l$H|$uHLH=o H@ @H;H "H9uH=AHD[]A\A]A^H-11L H H1L  H1L  )L%dif.HH MHHHHb)pL1H 9Z)XZAAWAVAUATUSHH $HH $HxH|$HHHt$/HT$ dH%(H$h"1HR/1HxHC@HC HHH5(HHHfHHH|$PHH|$0L W)H HBHFLPH$`HD$(HPDHx t8LP LE1fx&AHFDVDX#ƒEAEH FHL9tJAHH@HLDP#EtDfx&tG:HH$`H|$PH|$0HHD$(HdfL-f))FH5l H0HHD$HD$ HL$(E1HT$0H0HD$8Ņ(?HD$H=a E1A:@XL`&Dt~D{E9|6DD)DHHI|DLD)D yDsE9}H1AULH5XE1ZXfAƒ:wHH5(ADHHHftHH5D)HHH(HH JH(HHfAt4HWfAt%HhfAetHH)H~HHL$8H|$HHL$8GE(fE(HfAtHhfAtH'fAtHfAtHӤfAtw#fAetfARHۦ\HfAI.HA+HD$LH5eH@@1DE1H$h"dH+%(Hx"D[]A\A]A^A_Ht$HA)HHt$ HcHH릉D$HHLI 0H5L1Y^DT$ayH u Hf HL UDT$HLhQPRH5a1HH DT$yA#H H HL DT$HL4QRP뒹L H5DT$DT${@L1H5DT$DT$DHHzX HO IHHSX 8H( I+H  $H5ε H=ߵ 8HG@HSfhHtLJ($t x.ftx+t#ǃǃ҉f tH Y [fDAWAVAUATUHSH6LM@MfAX-t DžA/fAth(HxH_HFfAhtDžHDžHE @ t t(H 1҈(:H 1҈HU JH HH ‰H0H/H HH#H H HE@HHt7fHfHtftH1ҾHHtH5y y1f1ҾHH]@IHHf+twLc`ftvH51 L L1ɺ 1LH5H]@Hut1fuH5 LtH5 LfH5.Lw L~Htf8fh  f%ҾH 1҈A1EMH 1҈HHH5 HtH5C HHE@HHffHt)L MA<$FH 3 HLLLfHHt :H]HLmHI9L=3 3LLHHtLHL9f0tLMtL, H}HuLLuL2@ H5v1]AHD[]A\A]A^A_D@L%J H@LqLxH}LhL蘼HLLLHZLHHE@LHuHU@HfHfDHDž۩H©HE@HHHHHH@HE@Htvft Džft3HH$1ɺHHZHE@Ht%f(tfht DžHYHYHYHYHpYoHVYqHKHFHT$I4$ID$HFHHVHT$0HtHHt H9HH1H5MPL1Wd HHD$8Y^H;\$(H\$Hf.1L1ɺpH5DL- L|$8HD$8L0M&L9uKI$MM98IInH1HHHPH1HHHu}dl HUHH9HRPL1MR1ɺwH5\ IIFHBHXZ_HD$0H@apXH=NDIFLG HHD$(HD$@H\$HL Hl$@L-L9d$@DML$M1gH5M$$I9ueDHH@HD$@L <g AWAVAUATUSHHH|$HH$L$dH%(H$1H$H$H$HD$xH$H$L$L$nMLEHD$HHP@HfH|$H$%=u?11Ҿ蠔iL4y MH5vVOHD$Hh2ujfufxLyRH5,1H$dH+%(3H[]A\A]A^A_HD$HH$ Hh2nHD$HHHD$HFHD$H1HHHT$hH9t fHH9uH\$HH Z,H\$HHC@H'f <$HDŽ$| HHH9l$hLt$hL|$H HmI9LmMt1L tIEH#L9LH11H޿Lu1LLIHuA}d$ IUHoL9fLJH1HPL1HmXZI9FH\$H11H$L= IHHD$|HH$HD$`L+H9\$hOLd$Lt$hMLl$HHkHEdHT$`HLY8DKE)HK0HS(L HC sHIDHҍ~IDHIDfH5)=-VLH5Q1RP1DŽ$D$ H qH$IHt.II9u^DHI9ML;XufDI$LM9tIL Ld$Ht$HHH9^HD$HH5'1HH@@HtH\$HHt$xLD$HѾH$Ht$hH$HD$8H$H$H$HT$pHH$H$HT$`HD$H$H$H$H$H\$hH|$8HHD$HHHHL|$H$H$HD$XHHD$PHT$@H;D$8H$fDDmfAt_HD$@L9tUIH@Cft6fA9u0H} Ht'Hs HtDuD;su' HIL9uHmH,$H;l$8uL|$Hl$XHt$8H9Hl$HmHl$H;l$8f}uHD$@L9tIHHIL9tf{uLm0MtLs0Mt܋M;K $uLLLH $uMLd$u)H{HM LC HMLHLD$H $HU(Ls(H $LD$H=M+HLLD$H$mH$LD$a,HS0HL ML LDCHfwHM H)1ɿPH531ROAVAPLH HUHEHBHHHCHBHH$+HD$pHEH$HEH$L H$L$+HD$`HH$HCH$L(H$L$HD$@H$HD$XHD$PMwMT$(Hs(MHt=LDD$@T$4L$(Ht$ L$L$Ht$ L$(T$4DD$@,E1f9HH LC0HDH yMLDMLDHd fwH=T HHJL C fwDH2 IIу=4(H)H1RAPLARVH5aAVAUP1:H@I$ID$HBHHHCHBHH$ *HD$pHT$I$H$ID$H$HH$H$)HD$`HH$HCH$L8H$L$HD$XHD$PH$HD$@Ld$XHD$8I9Ld$Ll$MHD$@L9tkHHLMw0ILIfDMt9Hk0Ht0DaD;cu&LH $HLHH $HIL9uMIM?L|$L;|$8xfDHT$8H9T$PHD$XHD$(HT$@HD$H9+HD$(HT$IpHh Lp(Lh0ft$4@E1MtLLmE1҅AIO0MDT$HtMHLHL$ =HL$ DT$u/AGf9D$4u#$tHt$(DNE9Ou E@M?L|$L;|$tqI_ Hl$HtHH$Mg(M5E1MIO0AMGHfM?L|$L;|$ufDHD$(HHD$(HD$PH;D$8L5 L|$8L%kL4$MH-)Lt$XH1 )IN0IV(MIF AvHHDHҍ~HDHHDfw H<$HL 7U=$LQLX1RP1M6H M9rENEs@H1L?UfD1H$MEIE)H{AL$SMt$ Lk " f9AAED$MD$MLLDD$4T$(L$ DD$4L$ T$(EMT$(Hs(MXHLDD$@T$4L$(Ht$ L$L$Ht$ L$(T$4DD$@P f9HC0MH=Z JLDL  fwDH IIH)L 1ɿRP1VH5.AU H LE|})H5 HɍxHHDHL  HDHHEfwHIH@)=i"PL1Q1RVH5H|$HH HHGHBHIIGHBHH$d$HD$pHt$PHH$HGH$H0H$H$)$HD$`Ht$IH$IGH$H0H$H$HD$@H$HD$PHD$XE@?LH=2)SAEe)H{HU0 Ls0H MtHLHT$TE1HT$AHM(Lk(H Mt1LHHT$ D\$HL$D\$HT$ { HL$E H MHS L LDHHDMLDCpf_=w H;)HLPH51AVQ1AUR H0_ @L1?H=)TAGI_ Io(IO0QH$HD$@L5 Ht$L%9H-)L- LH9t$@L4$L|$Lt$@~fy)IN0IV(IIF AvHIDHҍ~IDHIDfw H<$HL 7U=cLQLP1R!P1M6H M9t2ENEw@H1L?GYLt$hHt$L`Ht$`LSH|$89FH|$p/FHD$HLd$hHI9u=HI9t.HkHtEatuXH=/H3 HI9uHD$HH@@HfH=Ht$HLT$hHLuI9L=p L% L-H)fDILM9IH}uDME )HM0HU(MHE uHIDHҍ~IDHIDfwHN &L$L=SLQ1RP1HEHUH H} HBHH}(H}0HLL$IDŽ$M9&HD$HH@@Hf$|uHD$xH9$h H|$Hgd L 1ɺ1L8H5If.t%H\$H11HHHt HuvH} VH}(MH}0DHH5Hf.HH 1E1PE1׀ZYHAWAVIAUAATUHSHHdH%(HD$81H\$ H\$ H\$(uHG@Hf(-1HCIHHHXLHE1MDPH.D$ZYf%f=tgLHHD$8dH+%(D$HH[]A\A]A^A_DLѬ1H5bLD$fHLHD$L9u|HL9mfxuHD$ 1H9VLd$IAHl$Hf.MeH\$ DHL9t H{ Htf{uLuAMmI9uHLd$Hl$E%=LHL^1ɺF H5= /%=rdHWfDLU1$H5D$+11ҾHW6Lt$ 1I9jLd$H\$DLMfM9uMmM9tvI} HtfA}uLNuML11H5< P #IUIEI} HBH{I}(rI}0iLaM6L;t$[Ld$H;L1ɺZ H5T< sff.fAWAVAUATUHSH8LiHt$H|$AudH%(HD$(1IEHD$HH tH\L`MOID$`H"H!L x Ht$ LؚUIl$PHHt BIUH|$Ll6AMH L IULH5ۿLDIEt$=6R^AQ1P1aH HT$(dH+%(H8[]A\A]A^A_DLt$/LLLHXHIDM9u0HDt$ LLL$#DM?M9tMwHIFHxHuHD$H-,L%L5HfH|$1H L躖Lna 1ɺYH5SfL [ LZ71H5oLa 1ɺ\H5>H1t$ LL$L1H5XZCML$H>LէXkff.AWfAVAUATIUHSH8dH%(HD$(1)D$HD$ ^L*LbL螒IL%Å)/L\Ht&LHlIHtHLL/4L/HPHLEHHPLEA}-A$I<-LA}LI)L9A<$L4L%+L$LLL\$|H}LxLoHLLHeLHD$HH}LhLhoHLLH11HHD$ IH6HD$HE1LID$H11PAHATjLHD$,H QD$ LIU<-IջLI1H5NHT$(dH+%( H8[]A\A]A^A_@I4$1蝇Ml$/Md$ILHLHHHxLHxeHMSLWfL!N1H5,@/fDMeIL\ 1ɺH56L1f.HMAWL1H5ݹXZL$H5NU@HMAWL@1MLH5SLff.fAWAVAUATIUSHHLo@MtfA8M1HHID$(@JfwHHcH>f.L9VH5H1E1)HD[]A\A]A^A_Il$@1HtftHHCxHfC1f/C1f$C 1fCMLH5 E1rLAƅH LDLCAHCHH;Il$@Hgf8)0)kLDDHdIl$@ClHCpD$ Hf+f H{$E1HresizeHC$L= GfDG GCIl$@LaAƅHtfHmanageC<HK41fK@CB@T$ Il$@2H.fX'<'ChtP'SlT'Spf'H'HS`H'LbCpSlJfIl$@HtZftHHCxHt D$ vDIl$@D$ PIl$@HuD$ H{$1L=6 HchecksizHC$Gefw GiHIl$@HClCE1;lf8)&=EALe11H5ze7HfHHH5o H*t*H5= HtH5R HH{4HC CMDCTHCXAfD)PE‰CPf&tP|&CTtJ&LáEt't"LԡDCTf&bH&AHCXH&LfD1Ht 1f)C[@E1+1f^1E1H-LHvH1L_V(Lɟ1H5F,f LpMH53 LL=+ tUH5T LL= ׽t;LLȽt,H5{k L赽CH{$4DH{$LwCHC$@f&f&E1@1ɺE1L5T H5;&1@fLxf.LDqf.AUAATUHSHdH%(H$1HHtO1HIHtbHXHHU`HE1MHPlHLHAUH$dH+%(uHD[]A\A]ÐAATIUHSHZW\HvP~HHHLH/t@Lh)rILp11UH5膸fD[]A\fDHG`HE1HH)tHHiLER 1ɺNH5?*L(Iu+1Lҝ1ɺUH5[]A\1L1ɺUH5٬迷:IL{11UH5葷 ff.AWAVAUATIUHSHhLjW\dH%(HD$X1HvPHIHHE`t H$UH%r @{HEP L0uRL;1H5ֶHT$XdH+%(tHh[]A\A]A^A_fDH ,HE1E1jH1HjLHD$8P XH AD$ E(fHE`HUPH%L2*@L1Ҿ`L1ҾOAƃ1{c"E/HE`H%@'Ht$ HHD$ P H8T$_E1ҋD$5i@B9'i'LH5 DDdD9ALH1AVSAA1ARDT$,KH EDT$ ELHLE,AE;H%A=I11LH5ִ@HEDHG`HE1HHapIHKL}N 1ɺ9H5wbLEXML¾LcHUXHEPHLCAƃ1AL՚1ɺ L= 12L۳EHHH9HWHB HZHHNHH@Lf.HE1L1AVDH5v 1SARDT$,>DT$,H EeE1@LEXML¾L3HUXHEPHLAƃ1ALM1ɺHt$H HE1҅L= H9#LrLI=1fK1HT$ HAHHH9OHHPhKHt\HfH* c^Y ,Ѕt)Kt@x}9Oи)HiCH2Ht$ E1ҋVw/9Ni@B9~ i'D DPE9ELAAFH>DT$ D$[DT$ HZ(H!H#LSI1H5F~ XZ1LK 1ɺ!H5Li1ɺ1H5} ǰ1LE1ɺ$H5覰@AL1ɺfHPXWLBX$HPXgLBX4L#tELt  E,HL HZHD$dH+%(jHD[]A\A]A^fDIE H=@t HI#V`LIE(LHSLLE1PHAH8fDL> 1ɺH5yB@H}@E,衠@#fD#fDHLKE1D$ LH5P1_AX@IL1ɺH51AΣ,fLKLU1ɺ藦AWIAVAUIATUSHH8dH%(HD$(1BD$ D$D$SHH31jDD$LLL$A[A\HH>HsHMHL`MH{HtLkIG HtHI#T$`XL,HKLLL$ MHLAą7HHtV>#tQL5t uA E,tH}@E,|HLHHl$ EAGH;1E1'HHAƅzH3HL$HH L3AąXLK1LH5耡vIG HS *H= LL=XH1LRLQ1A"_AXHHtU>#tPL4t" E,tH}@E,HLyHEH3HL$H Lt1ɺLLf: ^TfLL: 1ɺH5F1 @LۭH=CtL艪HD$AHL$u HD$D5Eu}t~sH|$HOAuQL)/L9 1ɺH5rvD3 fDS놐H-Y1ɺ1L<9 HE1)LK1L߉HHD$(dH+%(-H8D[]A\A]A^A_L9 12H59 贞3.L8 1ɺH5|IѺL}1L=d1ALD H3HL$H{ L衃11L8 H5ADD$LK=L=͕L11LA蜝=ILKL1f.L=i1ɺ1LL7 L<1ɺLL7 gHL=E1PL-L1AYAZ7虽诟ff.@AVAUATUSHdH%(H$HG@HfXf8&Ht 0&Ld$ H21Lf1HH)$)D$`HD$H]IHT$HHD$LM5H]@HfXL5U tL01f{Xf8&&D$4D$(10&T$ H5 LD$$胞HD$@ HHD$8HvHD$HfLH L∅H$dH+%(H[]A\A]A^f.LYc1H5̚DL4 1ɺXH5ߒ衚vL!hDLmDD$4L55T HD$ D$(MB1H-cL{H1L4 1ɺ[HH5 LٜuMH HD$8Ht^DL3 1ɺSH5ב虙nH5 LyuH HD$8HRtHD$HH5O LIHq HD$8HsHD$HH1fD$(1D$ D$4_AWAVAUATUHSHHCIHvH;,H{!H{H{  H>CIHL{LHLpLCHLLHL{IELHLpLBHLLH語L;IEL苕HLpLBHLLHuL{IELUHLpLvBHLLH?IEMl$HL[]A\A]A^A_@Lq1H5lID$LHE1UL1#H5F,f.IEL91H5LHUx@IEfDIEfDIEfDLa 1 H5茖AWAVAUATUSHhdH%(HD$X1H}HYHpHD$ LHHD$HD$(HD$ HH$I9IL%LIGHI~Ht$0L|$HHD$8HHD$0HH|$ }HT$(HL$HPHT$(HHHD$(MmL;,$M}IG`H#C tHC(LHD$@HbStLLρOIH5H1,Ht$ H;t$'HT$XdH+%(Hh[]A\A]A^A_@=LL$@LL1ɺWƔMmL;,$1Ll$ L;l$HD$H$MeHIt$O?Ht\LxMtSI|$Ht L_u=HC HtI#G`t.IL$L $ILHLD$uCMmL;l$uLl$ L;l$fI~RD1L*<H5΋贓f.LaH5~MfLl- 1ɺqH5fQ I~LQH $H50 H=0 7fAWAVAUATLUSH8HLydH%(HD$(1I9IL5يXHCP;LHCHL $HD$tkH\$IHLH tI@ HmL9toH]IHC`H#B tHB(HHD$HuIpu=LHL1P1 HmZYL9uHT$(dH+%(uuH8[]A\A]A^A_@I}HHt&IIWtAHIWHPIWHIG)L+ 1ɺH5肑6aAWAVAUATIUSHHH4$dH%(H$HAHD$HB@HtHHt H9]H6HD$f1ҾL)D$P)D$`D$po)1ҾJLD$\)IL$@AH1HD$f@f@H<$L=ǚLM9H$HHHD$(IH9M9- MNHL$ LMMQfHBHHHL1L1HH  IAIyH3FH3~H  H$1Ҿ9H8TIL$@Hf-L=QL|14L螏fXHJL|) 1ɺMIL$@H{pHf8/HtH5, HT$; H L=LL$11LkALӎHH{p8DHBHD$fHD$1@H<$ DE1Ht%H5, WuL IL$@ttHft+11AHLr) IL$@Hf~11A"HL9 IL$@AHfH$HtDdEHC@HtHHt H9H-HEGHs@HA1Ht!HHH@1H9tHH9uA9 Hs@H訐H HHH@H9 1@HH9u EHHI1PHK L~HHD$@1ČHs@XHZ&IH HChLxH(HD$ LLKpMH5#* LϺLD$8Ht$(LL$FLL$LD$8H5) MI/L9t)DHDsHmI9uLKpH5) MtLϺLL$LL$tHDdE ID$@Hlf-^HC@I$I$HH9f.HE0H{HHPH3H3VH dHPH@H3VH3FH Ko oSHK S0ZhL$@HL \HL=11AULL$LLH{pAYAZHtH5{( 赆tjHLluVLL$Li{L蚊Dff-@1L=LL$11LLEH<$t&H{pHH5' 1HLkXHt^oocLl$PH}0)\$P)d$`MLHE0HLu1ɺLL6{衉=YLL$LLY11ɺtHD$H$dH+%( H[]A\A]A^A_f-bELL$=۲Ly11H5H)H9YH{pHt-H5l& HL$(H|$ 蜄H|$ HL$(tH$H@H@@`uHf-,H<$IL$@fDHf$H{pLL$GLvL=1LLL$1LLx߇nDHjHE7AoILvH5 莇@fHC`@` QHLH(Lut$YL=fH<$oL4$LaLS fDf$DHkpHt!HH5$ 轂H@ HD1H=uHq1H5P II1LpH5  LL$<L}nHH1HAHH9tDP HH9uMt+LϺLL$H5\ |LL$H: LDU11AUHt$@Lp肀HA]E1A^HNHAHH9tP HAH9uH L1DdLpH5 A[]$fDH$/Lc* LL=sxL 1ɺLLL$ALZm萂[}ff.AWAVAUATIUHHHW@dH%(HD$1H$H1f-f8/fffpAft1HGIHHIFHE@Hf!aEf-t.H55w HA誳tHQH E11LPADHAVDL$T$H A HAH%8 D)LJqHDAHE=ܧH4$H5v1RP1}H LHHD$dH+%(HD]A\A]A^A_f.EuAFt`&1E1LoH5vAs}tfDEAVLoAL1H5uA}LoH5u1A|ff.AWAVAUATUHH=wSH~Ht 8H&Lm@M1fAxHHE(H5? L LjH5? LSH5^ L<L|KADž fA8L5avL% NfAxMPLHT$ :T$ HIQH@H? L1PL u1Lu{H0LXZH8Ht+1 HHPHt92DHPHHuLH>ADžjLm@MHt@HH9IHH8Ht)1@HHPHt :HPHHuLH>ADžHAv11L te LLtzH0Lm@LAYAZMFfA8IHH9IHH8Ht)1@HHPHt :HPHHuLHT=ADžHAt${ 1L "tLs1ɿH5KyH0LXZHADžAHD[]A\A]A^A_DIL%{K11Ll LQyLm@M'fAfAt>HL%K1ɺT 1LnsLxLm@Mu_1L%JHeHa SL rLrL1xA[[@L%JfAtIZffA88HM&L%UJ+HPHcHQH8H@TfAmH@L%J1ɺ- 1LYrLwLm@M 1H6IH4IG1L5qH1L< PL q1Lq~wH0LY^@HL qLSLeq[ 1E11w_AXfL0l@HPHHQH8H@L 1ɺ 1H5Hv3fL5pL5p1Lej1# H5Hxv 1E1LiH5cHLvH@HPHHQH8H@Hw 1SH5HL ApLouY^JfHHMF AULoHr SL oLoH5G@L5oHMLAULo7 E1fH AWMAVIAUMATUHSHHdH%(H$HG@H1fxX$f8&$ D0&AW1A$1ҾHJHU@Htf8&t& $$L$$H$L$tD$EL$ HL$1HHt1ҹLwH=oH=W<5>$t DŽ$M_H$LHD$ H! $Ld$ L5v lAPfDL%ykLjg1LIsLLB 11A&sH$dH+%(m HĸD[]A\A]A^A_f.D$H$ E1H|$XLMHL5GH;HD$PL1L'gDŽ$r1Ht$P6rHt u)DEdwA1ҾrH6ǢkHk1HcqAă^ 1kH D k3 Dj A|HE8L LnH5jLHWu蒤H`~sDŽ$$3DŽ$E1䉴$$T$H~H=tHe{MLHAE1H$ `$LHt <${mAHL iLEH1ɺPLdH5kh1Tp$AXAY@2L1L  pBLHLD$ r$uHLHgHD$8$HL$0u HD$8GuA8H|$0HrJ%D1HwH$H=H $H$11HD$0H\$8E1E1HD$0H\$@HHH\$@HAHPQ1j蝂H AăL 1ɺL%f1LnLL 11eAnH4$HyoD[MfDL9c1ɺ>1LcnfDLT 1ɺH5NfA3nvfDD$Ew1H]vIHH$L5rIEH9 L= fDnZH1E11DŽ$1HAAVAUj>H HHA蜢A$$5HD$8HD$0u;H|$0H~pC2L1L lfDƄ$L%dL3aLlufD$E1f1ҾHB$nDLQ 1H5vdAVlHD$8HD$H9ILl$M7I9u"s$ IMI9tVIIHt$0LRD$HT$0tIIGHBH뼿;hDe)HD$0HD$(HL$ u HD$(D5/Eu(qH|$ HnL|$8I9Ht$Ht H})fH4$Hw@IwHL 1ɺ*H5bjL 1ɺ1H5bjf.L%bL 1ɺ%L~jfLl 1ɺ1H5ibAIj@kl8iL6cLIG1j$L 1ɺCH5aAifDL 1ɺL1H5aAi~@L 1ɺ>H5aA{iPfDLJ 12H5F Likk8hL^LIS1iL `H5`AhL 1ɺIH5`AhL 1ɺ/ks=AukAuE1Ddj8gcLAQLl L paPHa PHb\ P1:hDH NbdH=?ajHHt8>tw1 HlhA9dHH$dt@ j8t4?gOI1PHH Ln PH5[ 1gXZI1Hx gA9pi8fIكARLk [LPH PHa[ P19gH cff.UHSHHeH1E1HLI HHQu" t5RՀ4wEIr1H[]fDuAHI9uDEtԅuо<{uEttDESHHdH%(HD$1HH$vu8H$H HH%H)HvCHT$dH+%(uXH[DL 1ɺ71H53_eD1L1ɺ=H5 _e1hfDHHG(Hh Lɍ H5PDH@HkFHкNP1heHff.SHHdH%(HD$1HH$uu4H$H HH%H)Hv?HT$dH+%(uTH[ÐL1ɺL1H5^dD1L1ɺRH5]d1gff.AWAVAUATUSHH $HH $HxH|$HHHHt$HT$8HL$@dH%(H$h 1t$0gHD$HHE1L$`L$_1ېLHAH@BD=EDC>< IIuHAALHt$\L$ LL$qLL$L$ u|AH;L$v|$01HD$@sH0HD$8Ht$H0H$h dH+%(Hx []A\A]A^A_LcC ,L~e@Dl$4DAADH|$LITHTAGHDH9D$LHD$`DMHD$@1LHH|$HfDTLc؍HB ttHH=uܹA$`HcAHō;D$0_HD$AN4>E1M\$ 1Dl$$EMHl$(L+ IcA\`L9t"A\$I ttuˀ uL9uߐIcHt$L\$ DAD ` Hl$(MIcDD$ Dl$$hDD$ DDH;D$D$4A܍C9D$0|$4DfDAdAHt$QATHt$fTfHH5WA1U L&Y)^^1_`f/tIOIWLH4$ct^LHLcAEL{Y 1L]1H5g7@Lw x`AWAVAUIATIULSHHHFPHL$LLZI|$LxLHLLHcIEL{HLZI|$LhLHt`LLHcoHHD$HEoKMoS U o[0]0HC@HE@H[]A\A]A^A_HD$H1LNXZH5vp\H1[]A\A]A^A_IEff.AVAUATUSH@dH%(H$812IHILHE@$0H$/T$H5^T HD$\$L$$͐u*|$LW1ɺ)H5u[H 2|$1HcIHHHLLHEAA:fH$8dH+%(H@D[]A\A]A^HȇqD$1 LVH5tAZfDL1ɺ+1H5tAZZ@ @LA 18H5itAFZL<1ɺ1H59tAZ]AVAUATIUHSHPdH%(H$H1Ll$LHE@Hf.HHL$(fCL'V,ucH-Lt$lLHt$00rHE@L$HvfuVLU81H5:sYH$HdH+%(HP[]A\A]A^fDHfHT$8D$HT$(H1HHIHHHH9OLt$lfDHAH0HPI36I3VH HpHPI3vI3VH HLH$HH$HH$$$%LHHE@HtfhH5QP H\$Ld$Ì6@H1H_IH LHHLHD$ YbD$ 3H H9L\HU1t$0LL$@L!TH5#qVXZffDHD$(HD$8 fHD$(faf1Ҿ6HaPHE@Htf.%DH0LR flH$HD$`ZDf.LODLL$(1LROH5pUDL1ɺH5oU1fL1ɺH5oqUZ1L1 H5koCU,LQ&Xff.AWAVAUATUHSHHxdH%(HD$hHB@HtHHt H9L5^LcpMtH5ULPDD+LHE@Hf,HH}L$LjD"M1H$L`Q1H5mTXZHD$hdH+%(QHx[]A\A]A^A_MH5gLOujHH}L$LjD&=?}MH$11LP,H5mTSAYAZHE@Hf#Ld$ @HL$8|$ H DLDLkpLDD)LM$AAMtGLLT$H5XL\$L$ DD$NLT$L\$Hu L$ DD$LDHC@HHHH9LJHATL% APD$LOLP1Q1AVASAWARAU"RHPfLx@Lr.Mt!LH5}MH LD={MH11ATLO(H5akQLcpA[A_M0Ll$ @HLK"DH~kL 2 L%| ELLukLD11#QHC@HHHH9LJ11LQkLL= kPLspH LDMt!LH5PLH LDH1LAW1MLjwPDHYLH_LH9bIM)HH}$LjDIXZML$HH}L$jLDmLL$1LH$LM)1OA[A^AD++E4LHK L iLELj11LODHH}D$LjDAX1AZILiL1>ND11BLiLN11ELiCLND11LiDL|N|$ EL f MEL 11LONLZ 11FL2NHE@Hf)9HHL-miH9fDHPLhiLHBPHrH1Lh1MHE 1LBiDH p$DΉL$1uMHmXZH9t`DMEH1LMDȃP1?MHE Y^HPLh1ɺ1LMHmH9uL 1ɺ1LLL% L1ɺLLfL% L1ɺLLWfL Vw@L V@L"g1ɺ71LCLfDAL)g1L@1L/MLf1L,1KHII)Hf.L(g1ɺ1LKNfHHE11PE1jHff.AVAUATUHH(dH%(HD$1HG@AIHfH1HH$HD$CSIHHE11DID$HP2LHPAAT,DL$]AŋD$+D$LH=Tt$H5Xf11~JXZLHUHD$dH+%(H(D]A\A]A^fD10LQHE1@H5eAJF1E1LFH5eAIbfDL 1TH5eAI-L@AWfL=eAVIAUAATUHSHXdH%(HD$H1HG@)D$)D$ )D$0Htrf)X$}L +ef L=.e11ɺLGL IHE@Ht fx"t% 1H&QIHHD$1LDID$E1E1HH>PATAXZL$?HH}$DjLHt$0D\$ $$H}HD$DLD\$Ht$(H+t$0Ht$($$H}HDLDt$$D+t$ jLT$D\$L=vqL$LF1ASSAVPDL$D1GH0LHRHD$HdH+%(HXD[]A\A]A^A_D= qLLF11)GLE1H5cAFvL1L AF?DL bL=bf|Iff.@HG@Htf!tff.fATUSHYHLb@C@HHLaHHt:LC HK0HS(HAEt C8[]A\MtSI$HtJL9tELH=oL/ H5_11EC8[]A\DL O1L H5x_dE[]A\f.ATH1A $tDA\AL)11ɺRH5'a EDA\fDUSHHHt.HO:HH:u"9hLrUHDmH9\H[]fDH@LD!H5`LHH1|DH1[]A1'L DH5d`IDH1[]LKHLxCH55`D1^AWAVAUATUSHHhH|$H4$dH%(H$XHAHD$HB@HtHHt H9L%MH<$wL HHD$LxHxN MA?/A AGILHWuM1ɺ>H?H[L9uL1ɺ1H5Y?fH$XdH+%(2Hh[]A\A]A^A_HD$H|$HL@ HH0HP(AEtEHD$@<1HoL?1H5X>K1ML5?H5X>HD$@<HL$ HHH9tHx1S\HEPHH81L%gXLY1ɺ-LB>D gEML1LC>L1ɺK ڡL>@HD$HL$E1H4$HxL1ɺIHHD$huH$hPHD$hHD$HHPHD$Lp H4$AL$HD$@H] H|$@Ht$@HHH9ul@HHH9t=HHQt H{@H9z@t9uHQH9HHWH:HH9uH9HD$H $H=YDp蔦HD$HHD$HH``HD$Hx6HD$ HHD$ H@HH$HHHD$(H99D$8HfH]H9\$9Mt-H$LHx|GHH'H{H?M,$M9uMmM9IuHgtHK`@HHL$0JHL$0DH sHbLH1I9LDIE|$8HPuD$8u 9H$L$HHL$0LL$HL$HxHL$0ZMA?HH9NH@H@mbH{HL=NH$1ҹLHD$HH$H$H$HHD$0>HH|$0H5 9IH HD$PMIy_LL$X;LL$XH Hp1ҹLL$hL$Ht$`LLD$X=LD$XLL$hHVHD$0HL$PIyH^ L)Hp~1H[PHt$0HfH&HpHHHT$HHxDL$H$L;T$HLMMIHL9tjHUHHL9tRH;SuLJ@11L<LT$0H5RI8HCHLT$0HBHH$HmH;l$HuLMMpL%RL81PL81LLTi8HD$@<H$L9tKH|$@HH H9u9AtHpH9rHL9uH1H9tHH$H@HmH;l$(H$HH;D$(D$XD$HLd$xD$IMnL9l$AMtI}HL:D$HIIHL$0H9KH@H@ @HD$xHH9H HH9HsL聪tAEa@'LzL$8HŅHӔ\HD$xLLHD$@pLT$PD$t:LT$PHD$hMIBHP@HHHH9H@HL$LT$PL<"H5_ LIHP11AuH)6_MAXL;d$0LT$PL$ML$MAD$LE1LLuN fAE;D$L7 DL<@I$IL8uH@HJHpHI@H9N@uHJ HH9tD$IL@HH;Z ( I$HDDpAD$PkE|CŃA9rA9wIt$AFtED$LA9A9vLHL$`D)HT$PAAt$ JHT$PHL$`hL1ɺ!H5 4L1ɺ"1H5 4L%N11LL4L11Lg4fH2HBHFH09HHH9]HM,$HhM9uH\$0LIDHI9$HsL舧tL蜤L :IL%M1L3L1ɺ1L3 L1ɺ-1L~31LLm5^3HHL$0HHH9aGHvIUHL$0FHRHH@`H$HD$8H\$0HK`AH$LHHD$fHD$@H8 HD$@H $HLHL$H@L9l$HLd$ MIHO@Ao$AoL$HIt$ Hp H}HuH(HpHuHM$$HEL9(LHuLW H5 1L%K1ɺk1LL1L1ɺVL%KL1L1L1ɺ4H5xKi1fM6L;t$(D$HD$Mt\HD$DXpE HD$H@@H@f82H|$iLD$@H|$E>w H|$11IH7 HD$H@PHHHL$8H9{MHL$8LaL9d$GM$I$HL$@I9)MMAT$LE1MuAA9DH @IHHȃ8uH|$H;xuIwEgPhFAw E<$EtHL$0LMDl$(IEAf.II9t%C 9wS$ 9HI9uI~D$$H- /HL6t$I1VHS/XZLM1ɺ1H4/L4L%&I1L /F9D9r#A)(LDl$(MPLIf$I~AD AS$LDHHH911HH9uH#HHhLH}HS1uMM$$L;d$@HD$MH@PHL$8H9HH|$8H9Hl$ApHL$0ID4$Dd$(H|莞I~H肞USH- IATt$L*31VH-H ED)LHT$`H$AAt$ DD$PDD$PHT$`H$0LP1ɺ!H5^ 5-gl$Ld$ LL%"GL1ɺCL,1MLIH5F,7HL%FhCb@LHD{ L z LDHL/P1},AXAYH- 1ɺ1L`HP,D$L[L-L,KL%FL+L+`L%E1ɺx1LL+L%ELr21|L+L-V[L/.EL%kEMLm.LƄ$O8+L41ɺ1L+TDT$XL%EEH$LGL L1*H|$7LD$@H|$E 运IIM$$L9d$0MML$L$IH9\$0=E1L$L|$hLl$PLl$EML$Lt$ CL1uf;kLMH@HHЃ8uH@HPHz@IT$HJ@H9uML$ D@IL9tpPA9AA98DSPHHHQH9HH@H9H,H9#LOD\$`HARAPL-P1R!VH5c :)D$H0E=H@HHHPHJRIEPH5 T$hHL$`H8ϩHL$`T$hHIHCHI@HxHH@PLCPtHHHH9LHLT$`11WAPLEVH5 R!_(KPHAUpSA E1LjjjjQjjjH$ HPHH1HHD$`=H|$`IIHIE1IUPO HGIH8CPAEpHIEhLIH=#S9kL@M[AjHI9D@L\1ɺz!1H5m Ll$Ll$P5'C S$HH|$ L+H57 LOHR2"P1AuH&H EDII9tL;xHI9uHD$HxkHI>LxXIVL0HPIVHIFdL 0Ly1ɺ!H5 Ll$Ll$PT&L h0H\0L31ɺ}!1H5D Ll$Ll$P &L1ɺ!1H5 Ll$Ll$P%]L%?L(L%H IH4L%?L1ɺLu%L] H59 N%`AHH9\$0L$Ll$PL$HD$L$t;HpIM`@L讕HL$HL)H5>DIpP11D+$$[]`L'H|$0H5] )$IHHy HD$PLHt$`L%p>L'Ƅ$ILG$ L>1ɺ!H5L Ll$Ll$P$D$XH.HkI|ML'L%=1L#Lc=bMI11L%@H5=#D$XLt1ɺ1H5 W#L%F=L(L-#f L1L (#L%<LV&L"ML>H,WH|$H7LG=PLL&I11H5{<l"D$XH|$HL=KL/&IPH P11H5<"XZD$8D$X1L%;L*%L!&"1L H5 !HD$LT$P1H5 L'"LHHHt>P1AuHs!Y^LT$PLL$0L=v2$H  $H5پH=CLL$0L%;L|=L @AWAVAUATIUHSHhHZPH|$Ht$ LHdH%(HD$X1I92E1I}ǶMmAI9uDt$,M;$$qHD$@D$<HD$HD$HHD$@HD$H@@Ht.fxXt'HHH9u4H8n1A LD$1ɺ H5L #kL&7% H5% Dҍ C.:$L+"L1E1}rD$<HMLI!nIH551v1D$,H LE!LIu19LR6- H5; Z1LL!=BLL!11E1~L1ɺQ 1H5 S~ff.AWAVAUATUSHHHYHt$dH%(HD$81HLbpC HIMtH5εLeHE@E1HtD/I~@LHD$0HtHHt H9KIF`L-!@`HHt$0D\$LT$*(LT$D\$Ht$0L=: Mt`I9L=: Eu I9I9VML!1ARL1LT$ HAYAZLT$LT$0LHML!1VL1HL$@_L "AXL9ML9AI~`LHT$D$HGP0HD$Ht)HHH5?y11M麡L7LqMH5L4D$LH`H5ųLt$H|$^H|$M麵L=?L11C@HMfpLhIF`@`Mt1LH5u8 _L[1ɺ21H51>HT$8dH+%(] HH[]A\A]A^A_fDML {H58 fD\$HH}L=7 LT$$LjD>1LMH$L1zA[XD\$Ht$0LT$ELT$HH}$jLDHt$($H}HD$ $DLAYAZLHL$HH=1L$D$L$L$`HT$LL$LH\$ HD$dH%(H$h1LI@D$H)$`HD$XHD$PHHL$dE|LϦ1p;$`H5A%r0N*>H LVM2 x[H3$lH3$dH H|$Aă$tt0HL A1j1H5 _AXL;$xt/H1H5 AAUL 1Y^H$H9$sH1A$L 1H5 AXZEHD$$H$1ADHIM(HD$PPHD$`PHD$pPL$kH IM@ADd$HHD$DH$HD jjjL$lkH LL$XMO|$8H$HpHH H|$ ILLH$WHT$Ht$0ILL$H|$(譜Hu1fH$`H=qE1hHA1PL 1H5 AYAZ@HALj 1PH5 1wA[[7f.$81H|$LDR&H$HpHHH|$ ILLH$YH|$H5Es @IHDH$LHH5Ht?He1$LL$ L H5 {A]A^$HLL0XD$$؃Eu f.1H$hdH+%(Hx[]A\A]A^A_DEfMh1fDHH A1AULo 1H޿A1ɺ $pLH޿$1XZLHt$`fHA1PL H޿1MA1ɺ$L{H޿$1#Y$ALp1ɺ1H޿^$ALa11H_AXwM1ɺL2H5 1qHML1$XH5 kHZY,@HD$PLL$D$LHpHD$LL$HH$HD$KT HT$LH9$Ll$L$LLL$(HT$H|$ LLL$(EH4$L|$DҿϦIAD$ AA9t5jL 1ɺULL$(H5 1xAZA[D$ 1aD t$8HHH4$E1LHPL}MbM'Mt LcIIHtHT$LH5 薩H}-EGD$LM(LH1ɺPLt 1ATL% AULL$8L|$XH tUH|$H|$H5n IHhH<$HLnL)<H<$Ht$ =$L$LLL$0H|$ D)HL$(HL$(LL$0HD$H|$ LLL$0ID$<+$F,H$HT$(LLHT$(LL$0DT$<HL1AURt$ AQAjH5 \H0H<$f.HML21$QL1ɺU1H5I 1fDL1ɺo1H5 f.L1ɺm1H5 Bf.L% 1ɺ1LLlD$ ED$LH1ɺLLPHGP1AULL$8)D$XH 1|fHLQ1t$(t$ AQAj|fH1ɺt$L% LL$(L9LH}D$0AXAYE>31LLu 1sH<$Lu 11LMHL11t$H5f AQAjH|$ H zL1ɺ1LLߍ1ɺ1LpH}EtD$L1L%E1LTLL$1_LH5 iH1,LV1ɺN1H5 9Mt$AL1jH5S []LL$LL1ff.fAWAVAUATUSHH $HH|$HH$IHL$ T$XdH%(H$1H|$@HHF@H$H f HD$0t H HD$0H$fX HD$ H5 LHHD$,'AEmA$tLHt$L Ht$11L.H$HID$@HD$(H)HD$(f HHD$8H)HD$ H$ HHHD$$8%= HD$(H$=`V HI\$HID$HHD$H9t&Ld$PIfAM6L9t$uLd$PID$@Hf$fX\ H$HD$HH8H\11(AƅH${H$H$HL{LQH$IH(HHD9 ADDL$AA}#IcA^ IUHHDP t$IUDP tH5q L\H"@#A|u A|  H- 1ɺ_ 1LvHH$LQSH5OLHoXH\$HHH[oh)\$k,@&C<A$fC@DLϦCH\$HL{LkCH$HI$1LA$HA$I$1LH$HHP1H$HߺA I$1H$LH H|$8Hr A$H5>HH|$8H5 / H|$8H5 H|$8H5 Å_ H|$8H5 H|$8H5 lI\$@H$Htf$EH$HH$LB H 1H1AąH$XL$MVLIHQ%LHDD9I1H-4 L  HLFD=fDL1ɺ> 1HH$dH+%(#H[]A\A]A^A_DIHh1fDHAI9BIL$ L$1fLLLL$H5 )$ )$0)$@)$P)$)$)$)$D$HmetadataH9$ $ seqn<Hbackup_fH9$ Hmda_offsH9$ DHmda_sizeH9$ tHmda2_offH9$ Hmda2_sizH9$ THdevice_sH9$ Hdata_offH9$  $ pv_u$ mda_ H- fD$(_offf$,se$.tHT$@1H5 LS$5D$$o1H$H5= LL$1ɺH-U 1HMLw H11L݃1ɺZ1HL1ɺ f$(il$$*eL LxHD$PLHx%HHAA[ Et$A H$ f$Df$(et1H$H5o LL1ɺ1H$H57 L$@H$f(^H$H$HD$(Hb HD$@HD$8HD HD$(HD$0HD$@f$(se$*t1H$H5 LL1ɺDMS1H- LHfL1ɺDHAjLD$8HL$LHT$@Ht$P;A\A][f.f$$uie$&dW1Ҿ-LT$\1HtLT$\T$\H s $tH-t lL){1HH$fDDŽ$ $ID$@H- fXH0HA$H5r HH5Q H@H5rHyL$HL$0LHT$HHt$@0H- LCz1ɺQ H\$HWHIL P YH-D =$1H$ѯ#$LL$L 1 H5 ^HD$H H- L HL1o{HE1jLXy1ɺhH- 1H8H$HD$(H$xdcHL P LL$J$ECD=BD:HD$H L LH- 1Hf$$nu$&m1H$H582 LTCLgx1ɺ->LTx1ɺ 1H;GH\$HYHIL P [HD$H L L'L xHD$xE1HDŽ$HDŽ$HDŽ$HDŽ$D$xPH$PH$PH$PHT$HHt$ H|$PL$"D$H E j1ۅLE1E11HD$xP$$t$Ht$(Ht$pH0 H$HjE1E11LHT$|R$Pt$Ht$(Ht$pnA$H0Et8T$tt09t,L 1ɺ1H5 sL 1LOv1ɺ H5 4ECD=fBD:HD$tH|$011HDŽ$HDŽ$IHDŽ$I HDŽ$D$xPH$PH$PH$PHt$ L$L$ $H AH- H$H<$LH  HLABELONEϦDŽ$ H$H$HLVM2 001H$HD$0H$21ɺH$A1Lp ID$@H fX-n L 1ɺ1H9$ D$UL$M¨ E L efDL$HL$0LHT$HHt$@2H-c 1ɺ 1LtH H5 LLH$H$LHDŽ$HDŽ$ uLL$L$}fo$$fo$$$41Lg ; H$HHHH9LHH-T 11ɺ}L" HID$@Htf/d1H= lc1ɺ H'bL$MH<$LDT$cMDT$ILb1ɺl H5 ALb1ɺ1HLb1ɺ1HwXH<$LDT$H- aDT$I?LIb1ɺ[ H5u .MLb1ɺ. H5> 1>La1ɺ1HH- HD$8HD$(yH- 1ɺ 1LaH~Lya1ɺ, 1H5 \H- Iك1L $ H/LLZH-U 1ɺ 1LNH HL1ɺ HL(H ATIfHщLHPdH%(HD$H1H)$HD$@)D$)D$ )D$0H|$AHD$HdH+%(u HPDA\GHFL9w ffDIHL^ HH5Y HR AQI11HfAWAVAUATIUHSDHH"HsMMgIH[H H $IpL$HILLT$H}HPHH$pHH$Ht$HLIH}HPHH$oH.H$LHLIGH}LhLoH:LLHtLIGXH}LhLxoHLLHM>IG4tH[]A\A]A^A_@HMH[LƼ ] A\H A]A^A_Of.L %L%B 1L)1BLL  dIGL% L 1L2H}L]IGfDIGfDLI *CfIAWfAVAUE1ATIUHSHxdH%(HD$h1HG@)D$ HD$`HD$)D$0)D$@)D$PHtDhXH5; HCHctIH@ H@XHt<11HЅu/H- 1WHL ID=EudHU@LD$PE1HL$HHtE1f"A1Ht$HhHT$hdH+%(Hx[]A\A]A^A_DD5EHH=x:]D^E%DZEYeH}HlIHM$HD$@LLD$5H}LxLUlHHt$LHM$HD$ LLD$H}LxLlHHHt$LHt$1HHD$eHD$HtHE@I\$4Ld$8Hof)tHLp)LvH}L`LkH-LLH_HD$(HE@HfD$0D$XE41HIHHD$ HT$E1E1ID$1ɾHHyPAT^L_HLDD$`EDL$XEH5f HHE@HE1LD$PHL$Hf"ALyfDL a1H5 贿Rf.fDH- LY1ɺ.Hnf1HIHzHD$ HT$1E1ID$H{AHPATXLZHL$`|$\1LX1ɺH5 ԾD$\sHD$ vLZ fHD${L2 L jf.LD$PHL$HE1hfDL pkf1L*X1ɺH5# D1LW1ɺH5 ߽}DLH f.HD$(LG |ff.AWAVAUATUSHH $HL-` 1ɺL t$AdH%(H$1V1LAYH=N< AZκHaHfHHH<z.tL$E1HLLHHRLL= L ; Lt$0LLHD$,LD$(_AXLE1HT$Ht$9\$WD$ 9D$I1ɿ1ML L)LatiAUL t$AUSMH5n 1ZH +HAL AUt$UfH$@LH|uƄ$At$8Iك=t$11H5 L ]ȫY^l$H\$LAt$AٹL t$ EAUULE1ɺ5H5t g<=]= HA1t$@L H56 1t$ S"H HL t$A1Et$(H5 AUUSݪH0H ] $H5kHH=|Hե蠭AWAVAUIATAUHSHdH%(H$1HG@D$DHD!L|$P1ҾL|$Xf%Dt$L|$PfnÅEL 1ɺH5 1AH$dH+%(HĨD[]A\A]A^A_L|$P1ҾL|$Xf%L|$Pf`nD$HE@HQfh tH(1Dd$H=]( oqL5x( LXqpH=) Dq4D\$ELd$`H= ( D$LLd$hLd$`LH=( wH;@{H 1ɿ]HD$HLY 1ZH7Ht$11LS k$HhLB1ɺrIHu:DfHXH|$`_HT$hL HPHT$hHHD$hLH=HHqH}SRHuIEHth I}LL|A1ɺwHt$1aAcfDHE@H#fh ft(HHtH5SC H$H\$pD$HHH\$xH\$pHD$ H$H$@Hs L H5 A胦fDtDL$2L 1H5K A3;fDlL- 11L L蟷  1ҾHK# .H膸1ɺLL?胥fDfhtnH= A dHt$LG?1ɺfA-5La 1ɺD=AL 11H5 ¤DL>1ɺH5# 虤@L>1ɺH5]# ql@Ld>1ɺH55# I-@IEHth I}蚡L蒡HL$LMLHDT$AEL9|$P1H1HD$HHL$Ld$PHD$DHAI$M9H HD$CD=YHt$ML 11"tHIL9EHIt$HUtQMd$u"=HA1ATHt$Lk 1 ^_Ml$tz=Ht$ML* 1ɺȢMl$Ld$PM4$M9u̟HT/)|=ZAL 11H5 zDDD$LLt$LIDD$`HD$HD$`EL|$(MI1LLLH5+% D$`DL$LD H}(IHfH@ @T$`HcL$LHcHH H HH H|$pHPtlHHT$xHPHT$xHHD$xL9|$M'IA<$/1LJ 袝t$HH{M1PA`11t$ Hj H AHt$HiH="(HtxH (T$DHDE TtB uƽ˙|=A11L H5ʸ A跜f1ɺLL6蕜1ɺLL}6uH1ɺyPL( H5Y 1JAYAZML 11tH5. LG 1ɺ1H5 f.1ɺLL5ś==bAL 11H5 肛DLt51ɺmHk HD$H1OLK51ɺ@L AH5 1 Aۗ=A11L H5ڶ AǚHt$HA迥QH HD$L|$(LeHLmHM9ufM$$M9fA$`(T$LtA$@(fA$D$`T$LtA$D$` xH}(DH fH@ @T$`HcL$LHcHH H HH H|$pHPHT$xHHPHT$xHHD$x;Lt$pL-S L% I9/L|$0%H(IF Ht_M6I9CIVIvHuHuL]31ɺHT HD$H18L431ɺDIFM~ % t7QMML PMDͿL1˘_AXDML$(D$MD茕HLL$0AL 1QT$RAWyH HD$ H9$S< HL HD$Ht$1L 1 #H$HD$ IH9 H@It$H M$$I9uD$(H$IވHt$ H9 H1HH9uIL;t$  L|$8L-P MILt$kDHH9LH=LH11RL Y^IIGHBHHIH;\$ HI$1IWLHuIo}dA$HHE^HtaH9t\HhHT$0nHT$0ML=<AR1U1aXZVf.L i@H-YLd$pL|$0I9Ll$ XfDfH@IT$ H$HPg H$L(HPH$HH$M$$I9t.I|$ tH}X@HuL/1ɺ=Ld$pI9uM$$I9I|$ uI|$Ht@  L|$8H$LA$H;\$ t&Ld$ HHS1HHPHL9uHt$L޻ 11)Ld$`֔{L$HM.L;t$ L|$0HM@DT$`MGE.|$(H1LHHuxMwA~d-HI|HL9LH=L" H11RHt$LXZ@IIGHBHIEML;l$ IIL街)IGHgHH[H9RLJHt$=JL 111mh#MIHL9LHHt$=LA 811HHHH9Lr蹏1=HA1AVHt$Lƹ 1角A[A^fDHIH9tBDHA0Ht,H0HPH37H3WH uHPH@H3WH3GH H H9u~MIHL9LHHt$=ȻLd C11L|$0L$\$(tH\$ I9Ht$11L| X蝑H=tE11H1HHT$ HL$HM1H*D\$HE-HDL aL5URMIHL9Lp8=HA1AVHt$L 1אAXAYHtgL9tbLpHT$8薍HT$8=jAL 1R1ɺLAVHt$肐A^XzL =L5TL5{L rL  H5+ AL 1ɺ>1H5 W#HSH= 諑IHLLt$L# 11L荏M1ɺLf L1mH}L1HoQ mH{H|@L$HH5 %H & HL$HHt$L 11ގH$HHH9ufHH9fxuD$([Lg AH5h 1TAfL<(1ɺt 诞H\D$(;DL'1ɺ~cMIHL9LpqC=@HA1AVHt$L 1_Y^XL q8=Ht$ML 1ɻL5'l/Ht$ML 1Č蚉=iAPLD ATHt$11艌XZrH $H5*H=**胇Ht$L 11 DHܦ"L.&1ɺH5 L ASA1ATHt$A\A]Ht$L%1ɺ輋HH$HHL$ H9HBL@@H9H HH9L;@uHLb%1ɺLO%1ɺ\$ptaQMLô SHt$11 ^_t^Ht$ML 11׊譇SL ATAHt$11襊XZyL ARAATt8Ht$MLa 1AOLd ARA1ATHt$AA[A]Ht$M1ɺLe 1A݉E1H޺H%7Lt1Ht$ML) 茉D$DAWL WA1AUHt$QAXAYff.UHy1HH@t)j1HE1jE15|ZYtHG]Hyf.L"1ɺVH5 ш]f.HHyI1IH@t3jE1LE1jL{AXZEtHf.Hyf.1LZ"1ɺH5 ?HDHHzE1HAt,VE11E1j1D'{AXZEtHHzf.1L!1ɺH5y 过HDATUHSHHdH%(HD$1FHtqu_Ht$AąHL$9tKAHD$dH+%(HD[]A\f.tʋFuHHxLg IH5 1܆@L 1ɺ1H5i 识`蕉DFdu fUHSHHHthHu\EcuVHC@H Htf!H HEHH1SIL 1H5 XZH[]fAUIATIUHG@HHt%f!tLLH "H]A\A]QLu]A\A]fAUIATIUHG@HHt%f!tLLH N"H]A\A]Lu]A\A]fAUIATIUHG@HHt%f!tLLH "H]A\A]L(u]A\A]fAUIATIUHG@HHt%f!tLLH !H]A\A]1Lu]A\A]fHHH f.HHH zf.IHHց v@EEtEH ^u:LHfDtS@H LHEEt H tt H uH fEEHP11MjE10ZYHA1JL{ H5 2HLLHLf.EEtHNtEEtHZtHGH;DEEtHtH Hff.@H!USHH>tVDH5j HY}AEt H5I H=}u)1H[]D@fH5O H}t[H5 H|tZH5VT H|t'H5ET H|uTu/v1@H[]ÃETJ1IL =H5ż  AWAVAUATUHSHIt|HEHLxLpLE~IH@C|/_LDMH]1ҹ LHEHBD-A|$H](H[]A\A]A^A_fH@FkP H u=: _uw$HD@@}>K1E1Lê H5 }fH$dH+%(HĨD[]A\A]A^A_@I$pBHS(HtHD$4.fvb]AE@HD$L=YLpf.L1ɺL>I A?uA\Iu8HD$pT$t@Dž H >@ HT$LAL1ɺYH5V A|H萔HD$H|$HxDLt1ɺO1H5 AQ|LD1ɺUH5޷ A#|뉐A1ҾL@AL{@M AL$DL$8f.<,u@AGI<,tLAGIt<,uLH) HL$|HLD$HT$(Ht$ LD$HT$(Ht$ AHg 1L=ص VLY LYL+^1ɺr L1pLQ 1H5 z@AU@th;tcD$47I$pBH& L1ɺH5G zDDL$8!fDHPfDHE@HU@H9t,$t$|fDHH9t9H,u9puH(AS1H9)@H Lߦ H5 y@DL$8L^IU8DD$tDL$pHHt$LOAmHILM}EuHD$(HBHD$@H>HD$HH:HD$PH6HD$8H HD$ H$HD$H$H$+E AFH\$hALl$`IDLl$Hl$XH@VZH I$I7L茵HH1H{Ht H;Xh4H HH9ugHH=nH9MH;XutH_H$HXGH$H|$HPH8HH$f.II9Hl$XLl$`H\$hL$HD$I9Hl$HLl$XLl$H\$`kD&IG1HzHHtcIwLGI_1HzHt H;XhM?I9tL12H5vgIU8HHHL$LAIu8H9HT$H LAL 1H5; A{v\IU8DD$tDL$pHHt$L A+DSAuIUEbDL$tD$pE]H eH~HDIL$@E1HtE1f!APLE11t$L_AXAEEH~HHDHIUAuE1PLD$1L)A[A_AnCAuIUEID$@E1HtE1f!AH_E\EHHSHDwL[ 1ɺF1H5ð uHHE11IUPE1Lt$jAuzH AL1ɺ&H5I AtHD$(HmHD$ HiHD$@HeHD$HHaHD$PH]HD$8HYB@L212H5.4t}HpXHHHtjH9teH@LLHHH=¯ ÃH HD A9HHDL@H}M2L} H5H 1AzsHpXH2IGHtnHHtfH9taHBLLH!HH= ÃH HD# A9HHDLH }M:LT <…tH /@tH +H Hl$XLl$`Lc H\$h,H5tG 1A^rI$AfIHRH\$DLL襵HH1H_uHtH;XhuHpXHtHFHtpHHthH9tcHBHT$LHHrH=p ÃH\ HDA9HVHSDL2H{{L3 12H5/ 5q%HHPE1E11t$Lj讄H AEHXHHE5EH HG HEHHc뜅H 8HHEHl$Ll$XLt H\$`R H\$IGHth I?mLmLX 1ɺI1H5 A5pHl$Ll$XH\$`sL 1H5E H\$AojL x[Ar}m1ɺ>E1L Hl$XLl$`H5D H\$homAVIAUIATUHSHHYHH5 &kHAH9C@Hk8HHLLAă1L1H5 nK@IpBHuL1ɺH5E n^fDS@Hk8teHHLL(AăLX1ɺ1H5 ;nK@hHC8[D]A\A]A^@IpBHt11uAHHLLAăAHHLLkAăCH8HLLJAă"HHLL)AăH(HLLAăhIpBH 11A@AUATIUSHHEu9uH[]A\A]DvuvH[]A\A]@IH=tf jHC8Htsu/E11HLL謚H[]A\A]f.AHHrHJE1jE11jj豖H bL1ɺiH5 l1f.AWfIAAV3AUATIULSHH(Lz MqL % dH%(H$1H H$)D$0H$HD$81H$HM%)D$ H$IELl$`H$H$H$H$H$ H$ H$(H$0H$0H$8H$HL$HH$pHD$PH$HD$ `L$L$(H$0)D$)D$@HDŽ$@@H$pH$xH$H$H$H$H$H$H$H$H$H$H$H$MHLHL$HDŽ$\H$KH$$H$(H$(H$0H$`H$`H$hHHT$hMIGHD$hHHt0uDLLLH{$HK1M@tkPLIMAULAq\ZYH$HtuH$dH+%(H(D[]A\A]A^A_fLuf.H{H$Ht$*$HKL|$V@L1ɺ{H5^ AhWfDL1ɺH5. Ash'YkfIE11_ff.@IE1 ]H$dH+%(SHĨD[]A\A]A^A_EN L$T$AAL& dH5Ř 1A]6fDAN DL$HHDD$H$A D$T$EN MrA@AL rfDA^ L11H5 E1`\Ht$IHhAxtLutHt$LLH詩AILuxILLH3AILLHA…tLttLaLVU…tLPptL]]LQL 1sH5ߖ A[R^DAWAVAUATUHoHSHH_HLD$H9 AAI1E1AtQHH9tyf@-tft$HD:1f@-tH-tD tR~AuIMtHcHHHMH9uH|$HtL/H[]A\A]A^A_1Tf1L 1ɺH5 YH1[]A\A]A^A_E1fAWIAVIAUATUSHHH|$8Ht$HHT$1dH%(H$1X1ҾLCF1ҾLC /1ҾLC'1ҾLHC01ҾLC$1ҾLC(C,HCHt0A@HD$@Ht$H|$HAąHD$= = =`=T H\$81ҾH&HL$1HA0HC@H fx. H|$8k&HL$HA8fH\$; HD$8fHDŽ$)D$`H@@)D$p)$HfX*H= UHD$PHHD$ HD$H|$PHp8H{x HHD$X5L}1ɺxHD$`H HD$8D$,HHHHHHD$0HL$H9uN @1<#6HD$|$,D$,HD$HHD$H9D$0HD$fp*tft3HHD$8gD$, HD$fp*HD$HH*H<+<-?HD$H|$,@@1ҋL$, u~ ,HcD$,HL$HHHHH|$GHtf.HH9H:@uHD$@u\H\$81ҾH#HL$1HA0HC@H fx. H|$8{#HL$HA8 D@H\$81ҾHK#HL$1HA0HC@Hn fx.` H|$8#HL$HA8Lt$81ҾgL"H\$1LhHC0"1ҾiLHC8"HCHO=DH\$81ҾH"HL$1HA0HC@H fx. H|$8 ["HL$HA8DH|$81ҾW$HC@fDHD$8HHHD$0HD$8Ld$Ll$0HXHA<$I9Hl$H1HI9tf*tftH3A<$uu1@ +~uf*Hx*HcHHHHLxI9u1҉@HL$HH|$8E1Aą HD$8HX@HftHHL$HHA0Aft HD$H@ftf*u HD$H@ ft HD$H@f( H HHL$HAL _$1~L51ɺ1H5ҍ RH$dH+%( HĨD[]A\A]A^A_L1ɺR1H5 QHD$HH|$PH Hr HHD$X/HD$pHH\$HL|$XLt$PHLL/H$HtmHpLL/HD$xHtLHLLf/H$Ht(H`LLB/H$HL1ɺuH- 1HPH|$PL1ɺKH1E1PftHD$H@@$ft HD$H@(ft HD$H@,A2f.HT$XH|$Pl.HD$@HtiHcD$,uOH|`Ht$@0MHf.HfD$,HL$@HL`HD$@HHL$ H9HcD$,LlHD`ILl$HHD$DHD$ LLpLIHD$HhH9L`DLHLKuL1;_HLLLJuM1A?_ILHQtHmH9l$t"L}LLQuHUHEHBHHD$ HHD$ H9D$@;1I1H-F L HNH|$PH- 1ɺ1L_HONLK1ɺO1HD$HL$8Hy$Ht$` ,HL$HA8HH|$P-H\$81ҾHHL$1HA0HC@Hnfx.`H|$8HL$HA8aH\$81Ҿ HHL$1HA0HC@Hfx.H|$8 xHL$HA8 f.L} BH5Ȉ 1E1 MH\$HLt$81ҾǃL1ҾLHHHH AąyH\$HLt$81Ҿǃ8L1ҾLHhHH8Hp[AąH\$HLt$81Ҿǃ@L]1ҾLHGHHHAąjH\$HLt$81ҾǃL1ҾLHHHHAą6H\$HLt$81Ҿǃ(L1ҾLHXHH(H`MAąL>1ɺ:1H5ۆ !K@HD$H|$PHp8Hk HHD$X1)L1ɺnHD$hHpH-~ HJH|$PH|$8 HL$HA8eH|$8HL$HA8HH|$8HL$HA8+Ht$pQ(HL$HH HtH\$8H$H{*(Lt$HIHtXH{Ht$x (IpHt>H{H$'IHt!H{H$'I`HL1ɺL1ɺ71H5G IpH|$8HL$HA8;H|$8 HL$HA8H|$8oHL$HA8L-1ɺ61H5ʄ IL1ɺHt$h&HL$LHA81HhH-c Lx HHL1ɺL1ɺ81H5% kHNLb1ɺ91H5 EH(L<1ɺXKATUSHdH%(HD$1HxB1IH7HxBH4$1HHE@HM@H9tDPPHH9uH]PLePM(I9u_HpHt HSHdHS8C0Ht'HBLExHHHu@H@HHjPPHI9HHu@L 1ɺ?H5 PQ1LBw XH5 FHT$dH+%(upH[]A\fDڐL1ɺUH56 Ff.LȂ PH5 NF2IfAWAȹOAVIAUAATUHSHdH%(H$x1ILH4$H1HT$@DD$H0NL1ɺH@ILHH\$HHAD$ lBD$hBD$@[T$@|$HtXHLLHAŋD$@tvLHQPH$xdH+%(AHĈD[]A\A]A^A_DHHD1M|$E1E1LPHATjXH AŋD$@uHpBHzmLmu H5L AD@@HpBH 1H jLt H5 A:DLH?Of.LH%OL1ɺH5 1ACF@HG@HtfɀvfDbfHG@HtGfɁf!tfx"t% fffAW1ҾAVAUATUSHHdH%(H$1HHC@HtftHH1Ll$fXOLI1HHC@HfX D$PHtH5qHoEwD$PE1AAǀD|$ hBDlB ЈhBH=~ @IH}(HHHfH@ @LD8LxLpLxLxuHf@@ @0HUHvHLxHBHEEL$LHDŽ$LHL1j$D$TPD$XPD$\PD$XPD$hPL$H$DL$lH$ >H@L} IĺH9H$HHLxBL$L;>H;LhL\HLLH%GHBfDHQHpBHBHDHBH>HBH8HBH2HBH,HBHxBHH$dH+%(HĘ[]A\A]A^A_ÐAL= HLBXL HLB&D$ -:HtL8.u xtADILvp 11H5{ d?H5 3EhBMT$PD|$ DDhBDlB ЈhBA9H8.ILrp 1H5iy ,I\1ҾfHAą#HtH5HAD$PE1*fDMD$ ADDD$PfD!L-y L{p L#>HH}uxNL 113L=1MLD$ UD$ 1ɺE1L-jy LL=HsH}t@Lyo 1H5x G1Lo H5y G=1&L)p 1H5w {GLS릐x Lo 1H5xw ;GfHǃB'L4o L-]x 1Ll 85k([HD$@1H[]A\A]A^A_1ML$l 1ɺH5R A8HD$@HLmL9ufDMmL9tIuL:uIH5 H H-Ht MtIPM1Lk VH5 QR7H D1MLk 1ɺH5r a7HD$@HL}L9uyfM?L9thIwL:uH!QMtIHMPL 1H5 6ZYF@1ML|s 1ɺH5 6HD$@1HD$@MttH5 L@2u\Lj "H5C :6H1Lri (6vM$L|j 1HL"i (5.HHH ^r f.AWAVIAUI1ATIUSHNH/HI6HH8/Hu H;/t/H6HueLL)2I|$HuH9HFIIHB0LLHs;MtI]HL[]A\A]A^A_MLi 1E1H5 4L1ɺ1H5 E1p4fDLBq 1H5R D4eff.@ATUSHH=Dz 6IHtS1HH/HHd5Hu?Hg1H{L`LIHtLHHQ:I[L]A\fDI1Lh H5 3E1[]LA\ff.ATIUHHt}H/H4Ht(L1HIHtcHL]A\LIHuI1L2h H5 2H]A\@L1ɺ1H5 2wf.AWAVAAUATUHSHH(dH%(HD$HF`H-sXt?t:H Lg 1ɺIH5F 1A02HH9t-HHt!LbHI#T$`(H AAAAA 'L;H=;I9HEPLHHD$L9|I9HMGL$LMMHfDHBLHHM1L1LH I@IHH3FH3NH 1Ҿ9HHE`v裡HI蘡HLf ATI 1H5 0HE`A[A_II AtHE`E1HH^DHHhEuƒ(HEPHHD$dH+%(=H(D[]A\A]A^A_fDE1&HuPHHH9 IfDHH9HxHHtHO`LuDEuH;jXut4HE1H&HH5o SILe 1J/^_ HH9L$M?L9|$DHLL9{CHPHRH%o aH{H5? 1HUPHH$Ht8.t/H$HL$HD$HH ' DHHe}LY1ɺ91H5J E19.@HLH1AH IHPH| '@HA@ t AEHH9HHHH9u)BL,HHmEAŅ"LAA6HH+HL#c SI1H5] O-XZHLb 1ɺIfHȝ)Ld IH5 1E1,fHpHx==wVI11L&d H5 ,LuPHH#E`3HI9@HPHR9HLtFHH IHPHt HHHH9@ǁ HH9uL\tLH蠜Lc 1ɺNIH5% 1+gH5H9HUP H_}Df.HE`H1Lb IKLc =H5*% -+H% ǀ fDHEP!La L-fAVAUATUHSHIYte ST-_T2Lc`A A@QA@u ALKHLb 11H5T F*HCPHSHHHHzHHCcE11[H]A\A]A^}@ILIH`ILa 11H5 )IEPMEHLALHHcLc`[]A\A]A^[-S8JHH:H@L@I A%fDH؎IH"[La ]A\oA]H5w 1A^(@AUIATUHFct+HHtL`HI#D$`fDH'AątQJuA]DA\A]EctHtHhtHLi1L:1ɺiH5- (D]A\A]fDLh&LH?UL蝘HI蒘=QcHI1ATL|` H5 1'ZYAWAVAUATIUHSH "QuQQ6HHAH9L-2L=? (fPuIH{MuyHH9tXPt12LL&}PtL1ɺ1H5 E1&|HD[]A\A]A^A_fHsHHtFdt:LaLv1LE1\&>uH@X@cfD+~fDAWIAVAUMATI1UHSHcHLD$nA$2HCu HHE@Hf/1ҾH&L b Lb H5 ҃HD$XH= LE11b%HE@H9DHD$PAbH1AeH5Zb Aƅ1AbHAeH5L5-LLtIE HttML5LLt)IE Htك8uH@U$H9E$L5pLLt)IE Ht8uWH@U(H9E(H5GLJtAIE Ht,8u'H@U,H9bE,WL L H5-Lt)IE Htg8ubH@UH9EL5˯LLt=IE H8H@U0H9E0L 'L5.LLdt6IE Ht8kH@U4H9sHE4dHLHAƅt5IE H٭Htr8umH@U5H9%HE5HILHts|$H.t8IE Ht 8uH@U H9E I8HIL&J }H5 1L.HQ LHAt7|$H6 tIE Ht8uH@UH9KE@HLHtC|$Hq^IE HB89H@UH9EHLHtD|$HtIE H8uvH@U6H9HE6HLHAtX|$HIE Ht18u,H@U7H9FHE77L ߫L IH5Lt=|$@IE H8HpH}8!AƅtGH5ӫLAƅtRMLG 11YH5 L1ɺS1H5s LbMLC ]L -f.AWAVIAUIATIUSH_HHHwHdH%(H$1H\$Ht$H9Ht$fpuuH|$HH\$H;\$u݅AEPA<-IEI9ELG 1jH5 qE1fHHHt1DIfHT$p1HL$0LD$,LH$H5$ HL$)D$p)$)$)$)D$0)D$@)D$P)D$`H$HL$u9MLL\$,HA4I9cM21L# H5 yE1H$dH+%(HD[]A\A]A^A_f.1ɺ9$L-H5' D$1ҾFLHGHXHu9fH[H*L{MtH{ uH;H5 $uHl$0NfDu}HHH H1@ѤIx\MHLLYtwMMxf)E)E)E )E0IG uHHHe H1@pM^1LD H5 D$L1ɺcH5 E1afAWHOHAVAUATUSHHt$dH%(H$HGHHL$H$H9t*Ijournal_H$f(uH$HH$H;D$uH$H(Ht1HAI9sfDIL|$pLl$01fLD$,LLH5! L)D$p)$)$)$)D$0)D$@)D$P)D$`!Dt$,L9d$pHwatermarHT$pH3D$xL1H u$kOHcommit_tH9D$pHlush_intH3D$xHbitmap_fH3T$pH u$erva>Hallow_diH9D$pDHAI9D|$xsectIf|$|or<|$~s1HD$H5T LHP1MHD$@AD$A AA=UHD$H<ff|$xim |$zeHD$H5(T LHP(1>LQ1ɺUDHD$H5S LHP$1u!HD$x$dRHD$H<@L1ɺfH- 1HMLM H11L1ɺH1H$dH+%(H[]A\A]A^A_|$xscar)f|$|dsHD$H5R LHP811HD$x8;HD$H<D$lHD$H5R LHP,1LӘ1ɺ@L1ɺD1ML H5 1Lv1ɺwHD$H<(fH-M 1HLc@ )L%11H -HD$H< L1ɺfDLܗ1ɺAWHGHAVAUATUSH8H_HHt$(HL$DD$$HD$H9IcHLL,@IL,$HMPHAH@@`|$$HL$JLHL$LhHyLէHLLHHIHEPLHxTH|$t,HD$LLH@`H@Hx(A…DHH;\$:H$HDfx(tL8MtH|$(Ht1҃|$$LHH|$t|$$jHD$LM.M9uIEMM9hIIvLuI6IFHFH0DLHHD$MuL9uFf.IML;t$t/IIuLuIEIuMHFH0IL;t$uH|$:HH;\$f.A`LHuHL= ^H51.XL)Z1ɺH5 1 E1H8D[]A\A]A^A_fDHD$H@@HtHHt H9HD$HMPH- 1LD= HYL^1ɺH1xD$gHEPuHML"= efHEPuHML7 jL7 1H5 E1HB$Lޓ11H5 D$AUATUSHH*dH%(HD$1Ht`IIH/HHt9HHLHHM,$Mt|LHAu}H,$H+HXu*HT$dH+%(H[]A\A]fD1IL< H5 1DI$f.H1IAUL; H5 X1Zef.1Lz1ɺH5m _13CATSHHt)H;Ht XAątEAHD[A\@AL 11ɺH5 HD[A\ÐLܑ1ɺ1H5 ff.fATUH SHHDIHfH@@HS@H(1Ht 1f(-AD$AD$ HtjH :HBH:HBH9HBH9HBH9HBH9HB9L[]A\@HpBuH観uH{LE1S͐L: 1^H5 f.AVIAUAATUSHHHdH%(HD$1HH@I1DfHH Aą~HXH Dm ASH} L PHRcH5˻t$QqwH HEHt\InAHD$dH+%(HD[]A\A]A^fDL1ɺ1H5} oDH{HE1LU11H5F 8y1E1L8 H5  Jff.@HATUHSHFHHt H8Ht HBHBHBHBHBLBH5r7H s7LT7H=U7Hf7Hg7uH}tfEE[]A\fDLpBMt;LI|$ZL11<H5/ HxBHǃpBHt HǃxBhBfH5 hB11L7 GH5A/ (軝fAWAVAUATUSHL.H|$Ht$IMdH%(H$1H $L9D$II,$I9MuI1fIwLM?M9uL}1LoLt$ L)L$ oP)T$0(LP։T$T$H=LHHH@Ht~HH|$,uiH}Ht$P@%MHUHEHBHIM9tBI}LIHuuHEfD$@)D$ )D$0H'IM9uMM 1L5 H5 HD$H&H@ HHHHfHHHHJHHKHQfHH9fxuL5 1 H55 'IUIED$HBHL,$IEL;l$tqH$L1ɺ H5 @La5 1 H5 xD$H$dH+%(uD$HĨ[]A\A]A^A_RfAWAVIAUMATUSHHH|$0Ht$ H H$dH%(H$1HL$D$<H9H$L0ILt$HL$L9LcLH\$(MHuLIHt'I$MLL;$$HuHIuHuHEHFH0I?IGL}HEIGL(MoH\$HH;\$ tHD$NfDH$dH+%(Hĸ[]A\A]A^A_H\$(HD$0H@ @L$<4LKL3 1ɺ 1H5 Hl$0 H}lIHIH@LsLH}LhL<HLLHI?ID$IGM<$ID$IGL MgfLKAII1f.<-tqHcD4@HuD$< H|$@1ѽD$<H$L0ILt$HD$Ld$`L;4$Hl$Ll$I~@LvH{LHl$HMN1AT L%2 H5Z LIIFHBHI?XZIGHT$M>MnIFIGLHIWL`HD$0LHx覗HHtLLHpHHKm@IELML;,$I @ID$;D$<H $H5,H==1\ff.AWIAVAUL-P ATI1ULSLL&* HH$H$ L$DL$4HD$@H$H$dH%(H$H.HD$hH.HD$`H.HD$XH.HD$pH.HD$xH~.x.HD$PHG @D$1}H$0AHD$8H$8H$0H$ HD$H$(H$ H$L$L$HD$(H$H$ML}IHXH蝕IHtHLHgIIHt$L# HD$H9$ HDd$E:H5Ll LD$4 uLyLh1ɺK  1ɺV L1Ln/ 91LL$Uu} Hl$H9$ DŽ$L9$L$4y H|$(LHD$@HD$HH HD$Hht HxHs,HDŽ$DŽ$H$H],DŽ$H$HK,DŽ$H$H9,H$H2,H$H,+H$HD$H9$  H$H;D$(DŽ$DŽ$HD$ MH$@HU 1+HL$ HH+I1t$(L' & LHq+1}AZA[$t1H$HL5 HLHLH$P\$DD$L$AHHD$(^_LH$PH$PLD$ H$$٭AXAYH$Hta}#t[L;\t" Eu~[P@ H$HtP,tHx@P,HL(bH$s$ $$4D$EsH$ L|$L9IH$0HH;D$8 Htb}#t\LT[=t! ^uZ5i HL$HtA,tHy@A,HL@aH|$ $H()H%)HD$HHD$H;D$(7$[DŽ$HD$DŽ$HhL`HLkHtH$Ƅ$@HtH5LHH$@HD$ Mt@HLYaHLfDHD$8H9$01fDHt H;; H$EALt$ D$$HDHgf.L1LӨ/HISHzMIL" L1$HH9[L3A>@uA~MfL#PLILpLIHtLLHIIHt$8LuL3" @LA1L ~1ɺ/ LHD$@HD$HH|$@^HD$hH&HD$PH&HD$`H&HD$XH&HD$pH&HD$xH&H$dH+%( HĘD[]A\A]A^A_f.LIHPHHT$IHtHT$LHIIHt$Lw_L ! QLAfDM8L HL9tHsHu@HD$HXtNHt$HHL$E11LHF@貃HL$HHAQ@t DHE_MH ILHED$ H1ɺL L P1AZA[HL|$HHT$LH$LЉIGHtD@ED$$H= t$L{11Q LH=o x$9M؉$LHLOЉ$H9$ bHD$8H9$09HD$@AHD$H9L (LAH|$H*D1L{2H5{R $Lz1ɺ 1LMH=T wDŽ$Uf.H$H HL1ɺ[ LL+z#fD11Lz1 LH= vH$DŽ$hHt[}#tUL=T t G S H$HtP,sfHL0Z H${ DŽ$1ɺ9 LL%y1ɺ" LLxHD$HH11L#$ @ LHtZ}#tTLS t (uaR3jHD$@,tHL$A,Hy@HLYH|$` $@1ɺ) LL xH= uDŽ$@1ɺW LLwX1LHD$HH1ɺ LLwAHt$HLfDHL$(Ht$LLzfDD$$Lt$ AzMHD$HH@Ht $HH$D$HH$HH$HH$HH$HH$H$D9DMLv1ɺZ LAHD$@HD$HHD$8H9$0$KfDH$0HH;D$8HHD$L$H$H L$IHHD$HL fI\$I9t>M M6I9t0IvHuH$L$L$ M$$L;d$8uH$L$HD$L LL1THD$HH@@X1ɺ5 LL%u]Hx@P,7UN=1Lt1ɺA LAHD$@HD$HHL1ɺ LLtAs1L 1ɺj LAKHD$@HD$HRD$11ɺA LLtf.HHH9кHDHt GdvHHHQtE1xLAADfDHG`AH$rH%ArH0ArH-ArA uA@uAHxH1ArH A{A iA WA @EA 3HAHA H$AH%AUHi(H5 HtAtH5 H[EAD]@AvDAWIAVAUATUSHxH$Ht$8HT$@H$H$H $D$LL$pH$dH%(H$hHH$HHD$xHH$HH$HH$HUH$H$HD$0H$H$H$HD$`H$H$D$lHt 1H9 D$lHD$@D$HHt H9D$HHD$pHD$(HHD$(D@Et HxD$lD$ L$H HL$8HLHHHHwD$HL$#D$lD$LL9FL|$D"D$FImHE H]HH HE`HI|$2r Dt$HEyH7HD$H@@Htf!SLd$@I,$I9uHmI9kHuHuAQSHD$HH5 1L L1[IE^_L`HLt$@II9Hf.HmI9HuLuH+Lt$@H9\$@u;fHEHI9t-HHsLuHCHHHBHHEI9uHD$Ht$`LHxuxL 1 H5 L|$D$HjI]HC`H7l$LQ\$IEHD$ Ht$(D^EtXHFLD$ 1HL$8H|$@=uHL$(HADY@Et DPEIEHD$ HD$ 1H5 Ll LHH1HD$Hx9~HfH@IUHPBd H$HHL$0HH$HHHBfDMmL;l$L|$AHHkH$H$H;D$0 D$D$LfG Xk H$LhI]HIE HHvAEf@H$Ld$`L9uQ @HmL9@ HuHWuD$hIo(DfEfAAG\L ÃE1Ll$PMMMHl$XH݉L$HD$ @II(D9|$EIEt7IF`/JH$Hx: L IH1D$LfDH$HH$H;D$0H HD$(H @ t D$lj HD$8@, |$LL$HHD$@L L9H H-9 Dt$LHL- HHID$HMH޹aH PH HD$HL1HA9DLXZD_M$$L;d$@uDt$LH|$pH H H| Hy Ht$(L~ f11L$11L$oH$H$LؠHL$JT=pE1HB1HI@H4p"HRHf|(tHH9tHHuAHH9u|$DD$ H$H$Lp1LNb2H5QbWLEa1ɺ 1H56 (_D$hH$HD$XfE1Ll$PL D$AEH$ILH$LL$))@)@ )@0@AtSAH DtHsA@Ic1IE)LLsHIc]A9~ AAuH$H$Ƅ$_Ll$PD$HL$fLl6t$X1ɺ $IL 1H5 XZD$PH$fLT6H1ɺ $IL H5 1uHY^HDLM D$PQH$H}Lt$XfA)LA)FA)F A)F0HLf5H1ɺ AVIL 1H5ڙ AYAZHD$D$PHh(H$HHD$Xf)H)@)@ )@01LfA;5H1ɺ t$`IL 1H5L >HA[A^HDH D$PIDD$PL|$EzH$HpH$HtL$hHT$(LЅH$H1ɺ H- L HCHLHHHD$@1ZYLLt$(HsH$LH|$ptIFHt@DD$D$H= GZjLl$PHl$XMD$HHHD H HLt$XfJ|=A)LA)FA)F A)F0ĐLl3H1AVI1L H5 _AXD$Pg|$hH$H-o Hx3 L1 IdHH HHHL$XfJ|=)H)A)A )A0 L2H1ɺ t$`I1L H5 AAZA[fG D$PA11L[HH=] XD$L9M؋$\$LLc[1ɺ1HJD1LcKHDH HH 11LљtQH$Io(Lh~1H1ɺ $ILs >DLl$PHl$XMAT$sLLÅB1HcH1IHH+ L HRR H-h 1HU_AX?t$hDD$LD$Ll0H1ɺ t$`IL 0H1ɺ t$`ILC HL^D$ LY1ɺk H5 賿fDM$$L9$$D$Lv 1ɺ1H59 lD EH$Hl$0H;\$0oHsL舺HH9u31LqHD$(H4LY1ɺe H5 H= UD$LHHHH/f.K/H1ɺ t$`ILb |$LHD$8Ll$8H LHI9utI$IH9NIL$IT$LLMD$ VuHAt$MH޿L ^_.H1ɺO jILd TL 1 H5 L|$薽HH(H9H2 HmH;-lH}(HtH.uH}aIHt@atpXH=YTLH#H9HD$8HHHHD$H HL$H9L<$Ll$(H-ˑ wDVLcID$LpHHP HL5su$D$HD|$L%L5EuzH\$HH9\$'HD$tLW12H5W [LLl$ H\$0MIIIGHAHL%CL5EuEtRIEHL$81LH<$L@\IEEU@Et DPE/LcID$H1ɺ?L  HLHHHD$@1\A[L[H5H<$H$H|$ptIEHtDHEDD$D$H= RHD$@HH9kLl$ MIMH\$0IHIE8-uHxL軽tMmL9uMLl$ H\$0MLH\$0MMLMLl$ H9L$@mLLl$ MMH\$0IHIELL9l$@-IHsL9uHHCHBH1LT1ɺFHH= QD$LD$9M؉\$LEvLS1ɺM1HL<$軹L GLd H葹IE@HD$8HHL$8a,HHH|$8蠡HHD$8@,TD$LL<$HHHHHHHHD$L_D$D$LLR1ɺ%1H5 L<$蛸D$PD$PD$PTAPuHHD$H@@H#f!P1ɺ Ln sHHD$HH5+ L1ZYȵH\$8H蓒uEH$Ht P,tHx@P,蘥Ht$8H|$H $l H$WH|$XMDT$`E DL$ EuHD$0H9$N HHHD$PHHD$PH;$IH$(|$tML|$HHu$8p$ gH$H\H$ HUH$HNH$0HGr$<D$tD$9MÉD$EuL9$`VL$1#HDŽ$LL$fH3LH$HHa IH$H$H$H$H$H$H$H$H$H$H$H$H$H$H$H$H$ H$H$ H$(H$0)$H$H$H$0H$8H()$DŽ$H$H$L$H$H$ DŽ$H$H$)$H-ðH9u_fH$HUHPhH$HHPH$HHmH$HlH9N IPHuL< H5CL?1ɺHH5z 1ݥD$H$`HL93 H-R 0LJI1H5z 蔥HL9HCHt HHtH9uL fHD$0H9$L9$` kf.HHL9HpH9uL9tHBHHH9uHAHBHD$HML> 1PH5y 1辤XZLH|$HHL$(Ht$HD$hH=i Ãt(L>11H5}y tH=B v;D$D9M؉\$D@H$HH;D$0I$L$I$L$IL$I@I\$I9tNMfMmL9t7IuHۦuL$L$L$f.M$$L;d$0uL$bD$RfDRHD$8HP 1t$`H@HAwHt$8H|$H1H$D踈VH= /:D$t6fID$@HbHHVH9MLJ1L H5w ŢHD$(H@@lHMHD$L H5w 1z_AXfHMHD$L+ H5Kw 1:AYAZHMPL H5w 1A[[_@H D$`HD$8H&H5o?H覝>HT$8HF1L<2H5<茡""1Lx;1ɺ>H5kv ML|$HUH= T8H$(D$tH$8$ H$HH$ HH$HH$0HL:1ɺ1H5u 趠hL:1ɺ[1H5u 菠H=X 7D$LEHH|$XD$t>H$D$t$p$HH|$X$ D$@$LD$d+H$HD$#Ht$8H|$HH$DH) RL91ɺH5t 諟fDL HiHjD$`H$$[L]911H5St EH= D6$LD$tFHD$XHH"1LM 1ɺgH5s ՞HD$8Ht[8#tVH|$H<=t Fu5QlHD$X@,tHL$XA,Hy@谚Ht$8H|$H,H|$XzD$`L981ɺH5's HD$xHD$(HH|$H1OHD$(HL71ɺH5r ҝDL71ɺH5r 詝pL9$`HD$XHHtc>#t^H|$HD%Et -?H\$XC,tH\$XC,H{@cHH|$H3L71ɺ~H5q $HƄ$ D$@$LD$dHD$XHD$1H?Ht$(H|$H諧D$$L8 1ɺ1H5lq 1\1L-C7螐LJ61ɺHH}@HLIH6AFbt1#LHH$L$PH$H$ H$H$H$IHtsL9tnLH11L H5p 1HL$xLHD$hLЃE$+2L1L&6;+L OH|$H@H蛤L51ɺH5o A躻hH$H9D$LH$`MILIDIMHL9HHL9H;Hu @L9tHBHHH9uHFHBHHE @HYHHMH9DLHeLu 11H5o IE1HnHHH@PH)HHHHHHHT$ HL$c"HT$ IuHL$HR`H$0H$H$PHo)$o`)$HL$xHD$hLLHЃDD$D$ubH$`MmI9t|$ED$MID$9fD$uL L312H53uIEH$0HB`H$PHR H$f)$)$Lx21ɺH5fm ]D$+ DŽ$<L 1H5 m D$иHEHth H}UHMED$D$HEH}$HuHD$L11ɺhH5l z!M1IﺁLd1ll1ML H5Cl I2D$P$ D$tH $H54H=4蝔șAWIAVAUIATUHSHXH~HHL$HD$(HvHD$ HrHD$@HnHD$8HjHD$0H>8HD$HHH53HIID$ AHD$H9HSHB@HHHH9HAHHLLHHD$AHtHEHt@DD$ D$ H=L At(Lp/11/H5aj XH=& DY,E9HHHELH;\$1L/2H5/L.1ɺ'1H5i A跔H= +HD$(HjHD$HHfHD$ HbHD$@H^HD$8HZHD$0HVHXD[]A\A]A^A_@IH*H+fDHAT@HiHEH\\$ XPfDAUIATUSHHHo@H/1҉F$F9/,f `H fHC@71ҾJL+CXfthL+AąL+fC uzL[ w@HF1Ҿ9l+A1E1L _H5g 趒HD[]A\A]HHHK0H `L }1H5rg E1aHD[]A\A]HC@1ҾL WIm@CXHL*HC0C HC8HCP1ҾLhHHCPHhLL*CHIE@HHtfXtHHHAH[D]A\A]DKX/L~ 1pH5_f Q@1f(HC0w uL HHHs8H tL ofDHHHHtIHH9IE@Hfht+`L fX^PQL fDf(HC8HWH1HDfDH1IHH"DHAI}LEMjA$B>I}Hs8$AHs0HA$EM>1H,$ILv 1H5Dd ;XZHC0HC8r@IE@rHHCP"fXt PHXHCPH1ҾLdCHHC8ff.AWH2AVAUIATUHSHH(Lb0Lz(L$MLDBtt~BDHG(H5 H8=AƅrHL+c 1MATLֺL YCA^ DE1E1}@t$Hs H;sD\$HI}AA$jEM%<I}HsAA$HD$ $EM;LH= HXY1HL$m D\$ET21LH= L\Et+ u=4LHL-) LL11AxDMU1L H5 AkxfDML 11aH5d; IH5 1nf@L5 IL L8fT1f L50 L LeCatL-4LzLL-, gL-1LeDAWAVIAUAATUHHHw@Hf( ^H f/HH 1HmIH"HHWD1PHAE1AWLjxH LHAp]DA\A]A^A_f.uDD%9E|H5R] H] Aąj]DA\A]A^A_DHD1H=w ]fHA"]TL1LLH _Hl$ M^bff.AWfAVAUATUH0D%dH%(HD$(1)D$EA1HIfgIHHE@HtIf tf t.H5 Hp0@HD$HE1E1IEH1LPDHAUj"rH AHE@Htf tD$uXLHeiHD$(dH+%(hH0D]A\A]A^A_ùL< H59 ^@H5S~ HH5 HD$~L 1ɺ1]HG<@L 1ɺH5 y]@LA 1H5| AF]L 1ɺ1+]}fDL 1ɺ1 ]fDL1ɺHt$\Ht$_@AWL 1AVIAUIATUISHLH5 \IH9E1L{Ltt&IG` u@utLLAZ1HH9uEt;=EH11ALp H5 [XZH[]A\A]A^A_AWHAVAUATIUSHXdH%(HD$H1D ID$H@@HtHL16AŅXHl$Ht$ D$@I$Ao$Hl$Ao$HHl$)D$ )L$0oH)LhHHD$I9to@M}@I]@M7L9u NfDIƾ^HL$Ht!LxHHL$H(HHHHD$IML9uMmL;l$uLt$L=\I9<AtKDA@tKD@SLHL &IFHHHHH9LJH1LQLڡ >IIFI$HBH^I$_u3I$I9$L[ L1E1J>*L-HL HHD$(H9${L 1ɺL@1ɺ#1H51 E1 >L 4HDl$@E3t$8L H L G L GwL GDL GAL GHAٹLPL p1E1}=[L ]1ɺrL1^=L rG;HHL$:LhHD$LHxHL$HHtLHCHL$HHy0YH$Hl$H;\$ t HHS1HHPHH;\$ uHD$tA$0u HD$1L 1ɺL9IFI$L(1M$6IVHtrHHtjH9teLHLr YL1ɺlL1ɺYAL1L15;L ?떹L1LT j5 Ht$H|$02LM1ɺ.1L45Lʨ 1ɺ)1L5LMH;?H9L ? H j1$H5xH=/7DHD$I9$t |$8A$0M$(ML 1ɺi1La4I$(H|$O?HD$HI$HIHD$@HD$HHD$HH;\$0ECTHD$(HxHHHD$LL;\$HvHCML;\$HbISH9B@uHHHH9LJ11ɺLL L\$Pq3L\$PI$I$ICHEHUH|$E11I$ HUI$ H*H$I$ o)$oP)$Hs&Lt$@ILL;t$08HD$@D$I$I$HD$H]IH9uYHuH|$"=K\LML 1L1g2HIHH;\$t}HH}+uLMLL %2HUHEHBHI$yHD$HEI$HEI$L0M$sH$L5;HHHD$H;\$(H{nH;LSH(H9u|HmH;H9teL;UuMIHL9LH1L @H5LT$0'1HUHELT$0HBHI.L9umfHmL9t[L;UuMIHL9LH1L) @H5E0HUHEHBHHsH|$=GZLKL| 1L1c0Hl$HEHH;l$(HD$L [:gLKLL 0HHCHBHI$iHD$HI$HCI$H(I$hL 9oH|$H$H;\$ ud@HH;\$ tVHkHtEatuXH=jH8n΃lLM$(L B/DI$Lt$H- H9\$t5IF(HsI1ɺLL1.AYHAZH9\$uHD$I;$ ArL1ɺ1L.I$L5 0HEHl$HD$HID$(H$H;l$0D$A$0t EThHD$I9$t |$8fHD$(HxHD$`HIH]L. 1L1I-HD$LEH@hLD$@HD$PH@XH@HHD$hvIH6HxHH1HH)HIIIILD$@IIID$(ME@HD$@ID$0HD$pID$8HD$xAD$HD$XID$PH$AD$X$I$H oA]o`AeILa=HT$@IHtdH9mIU@HHHH9LHH1L 1t$HL,HD$PIAYAZH 8H9HT$pHT$xH9H|$h(HHdfH|$PH@ @LhHXaH|$PAH$HGXHG8LIEpHGI}`Pdt$X1ɅtbLIH݉H~`HGH@ Ht41Ht$@I$D$L$Ht$@9\$XuHLIAomH|$E11H$)$Aou)$Hu\H11ɺILALV +I}@XZ `AD$ tTI1ɺL L1*DNTI}@Eu$H=e1161ɺL1ILΐ q*H|$1L" IٺL=TL 110*H\$`I$I$LkHI$ HCI$ HI$ H\$HHT$0H\$HHH9HD$H[HV@HLHHHH9LHL1LT z)ILx L1W)HUHEHBHI$HD$H\$HEI$HEI$HI$LL$gL$ME@L 2)L L(XIٹLL 2IL L1IU@HHHt{H9tvLH L1LǍ -(s\L% IH51'ILG L1L 1녹L1L '3IU@HHHH9LHL1Lg'IU@HtxHHtpH9tkLHL 1ɺ1L+'WMtIIHtAL9t d&L`11LG&L [0IU@HtBHHt:H9t5LHL1Læ %L 0TL 0L 1ɺ?1L%kL1ɺ;1L%IL1ɺ]1L%'L{1ɺa1Lb%LKL L19%HHCHBHI$HD$HI$HCI$L0M$Lؘ L1u$L̾1ɺ1L$VL .fAWAVAUIH59 ATIH=AUSH8dH%(H$(1OL[1ɺHHt{fH HHHC8/uxuHEH{H$!H$I$;z t|Lؽ1ɺ(H5 1E1#H$(dH+%(GH8D[]A\A]A^A_@HL|1ɺ"Ll1ɺ%뒉H H )\L=5 11IL͗ *L#<$LVM-t%L1ɺ.1LE1"+HE1X H#vVHXI|$HqHt1H$HxHHHHLHLHH)H)HIEALx1ɺ11L_"E%DAUATUHH $HdH%(H$1t,H$dH+%(HĠ]A\A]h2HIL$tHh2Lzt1HhLHn xHLJvLHcL{1ɺOH5 `!?F$fDAWfAVAUIATAUHSHHO@dH%(H$1)D$`H,D!EfUf&A|fxfEtf%f Et*fL!_V@f(tfHf*t *fh,t `,fh#t EOAD ttHE(Pff| Hf-t f!@E1E1fHD$XHH) H5FP"D$1ҾHL$dHIHT$X1HBHt$hHHt$XHH誙D$nD$0D$Lt$XH$L|$pH$L H$H$H$HD$H$H$HHD$H1Lt$(L|$xL|$p9MLL}%Lt$pM9D$ ]DfH@IVH$HPH$H4$HPH$H0HH$M6M91AtIIvH)hIFHDH}HeLa1ɺHt$1FDt$0Ht$H H4$H H|$pHL9t)$HDHWHSHpHHL9u$HD$XL đ HH1ɺPL= L 1L^_L$ H|$XE1 HM@Hft"RHH $H $`A1H$HHHD$`HDHHCEE1LH%LPSj/H HHA 'H$dH+%(HĸD[]A\A]A^A_1ff&tgA@f8Dff8fxtf&Af*Afff/f(!1ffN@Ѓ!F= /f/1H=I $ѭI9\$ HDd$4ILLl$8IL|$@HIHL9HI$1HULHuL}Ad褙IHL9LI=t>RHLO 1PHt$1HUHEHBHAXAYH$HD$HEH$HEH$L0L$.fDL Qq@L\$ Dd$4Ll$8L|$@L$L;4$t/\$ H$DHIV1HHPM6I9u\$ Ht$11L~ ijL$HD$TI>L;4$S\$4LDd$8ILl$@IL|$HMLt$>f.H1IWHHI$LML;$$IILt$TMGPL$tHHIH9fHB0HLHHL3H3NL HHH@H3NH3FH uoMIHzL9qHpBHJ L &PfwHN V1L} QL1ɿFXZHH9LMIHL9LH=;LW9 1D1LIIGHBHH$HD$IH$IGH$HH$RDIGH#HHH9LJ=#;rLaL 1`IWzdHT$ HT$ H HH9LI=:LHLK 1P1IIGHBHAZA[H$MIHL9LH=O:zLK 1@L S@L y@\$4Dd$8Ll$@L|$H|$t H|$pL7L9t1\$L fDIHWHSH] HHM9u\$H$H9$H$E111HIXH|$(ttH|$(1ՔHHP0H@0H9y1fHH9uH$H;4$jH<$H1f.HH9u9Dt$0L|$XA M2fDH51@L !f@Ht$(L]Dt$0fHt$XHt=>#t8H9=tI C8u|N8LHt$XHLE1DLx 1ɺH5l AD$0}H IHHHt$Lx 11 H(Lt$pM9uM6M9I~uI~IFHH}IH`fH@INH$HHH$H4$HHH$H0HH$oHHH9uHH9fxu퀍Ht$11L @ D$q1ɺLL >Lx 1ɺL=~ 1L Dt$0rL \L8 - -L,1ɺIVI L!w AVA A%A кPHt$1 AZA[Dt$01ɺH5BL H$1H;4$/PH$E1fDH6AH9uH1QHt$1Lv P AXAYHHt$H4$HLL$XM9L^w 1ɺnH$1H;4$E1u H m$H5{H=DAVAUIATI1USHH@I4$dH%(HD$81lIm@HID$H7('t '*HCID$t*fHCAD$ tfh,C AD$iL,`,CuOL0 H5 1E1 HD$8dH+%(,H@D[]A\A]A^@H9X,HAI}E1A$jME[Lu ]I1H5U G bfHCAD$HCAD$ C AD$C1ҾLAIm@C(HID$0L5 HC0HfxHPHrLr@HC0HHt8u&L v 1ɺK1LHk0Ht#MMtLHt @1ҾL)AIE@Hf( 8H ftH@H xqw EwHC0Hk8ILS} 1ɺL1A@Ct 'fhf1ҾLC(fxeHPHUL>HC0HHVMMLH# }HIL t 1AVL5 <1LAZIm@A[*/Ls (DLIs #fIL{ L1E1a|@ID$0HC0f.fE=[5z[H|$E11H-{ Lc1H u HxCLd$(E1HHLjT$ LLD$3ZYD$ Ll$ /)zMLfDLs L1E1UpH-D ,@Im@L59 ?L5- 1ɺ?1Lyr L Im@LE1Lr f.HILq 1ATOL1AXAY9L1LJs $kLy 1ɺ1H5) H-y >McLH5tP!L1Ls  L1ɺ61H5 E1Lq H53) Hl$ MI|$ŭHLx 1ɺ1H5( H-x P Lmx 1ɺ1H5( H-`x #MueLLJq L q 1H5r( 5I|$I|$.I|$LHff.AWIAVIAUATUHSHHLo@MtQAH(fLxq H53 1E1 HD[]A\A]A^A_fDyH_MHKAHH5̂ L$ L$ t$D AAt H@ A%AJf.L$ ͙L$ Au7fA $Lp 1H5 HyMHefA(A HH5΁ L$ L$ AD AH1ɿHLp H5o @ P1`XZfLH胜AąL41ɺ1H5% fAA3yLo 1H5 LQo yff.@AWAVAUATUSHH $HT$HHILD$dH%(H$1ЃD$<ƒ!ˆT$Ht5?t0HHt$>tL$ AL$ t Ef|$|$IIH9ufHH9HPHz@uM1ɺ1L,t H5p D$ H$dH+%(D$ H[]A\A]A^A_@|$IMI9tIt$HcM$$I9uL"ZAą'Hp D$ HD$5v'up'g'UML9D$,D$$D$(&'bD5'EMgL薓uL]JID$`I$HtHHukudu]@uVHC@HtD(DDt$LD2u.AT$LH߃D$( D$$M?L9QDt$(EtE|$AD$,L Lm PHq Ht$ LD11S]A\D\$$Et|$tDXEI}pD L+Et97 %D%Eq|$,HD$HtsHPHHI3H@ I3H uTHQHAI3I3H u9u0h2H$KHh2H$4@LIU= %AHA1SHt$ 1Ll (XZL12H5D5$EzHt$L11_Ht$LĔ11D$ A$uHJXHQ`utA$PM?L9f.LHYLH\ID$`HHcWHHIH$Hf@AE`]t|$DIL/LTHAA1L5k Loj 1LLt$ [IAZA[D$ dHL$Ht$L11=fKfDM1ɺ1Lg H5xi HD$ LH`L( 1H57i D$ LH7AD$`&1LD$,Ht$L1ɺD$,Ht$I1ɺ9L_l 1sff.AWIAVIAUATUSHHo@LidH%(HD$1H'fHHj,1ҸL @HcCIn@Ht%H@Hf|(tLLHL9uŅtRLLA=RMLO 11H5g gIF@Ht5f!AMMELL!HT$dH+%((H[]A\A]A^A_Ð`LnfL܎1ɺH5f f.1L1ɺH5f afM1ɿ1H-f LMj HHLLL1ɺKHL&L1ɺ1Hft!LD$]NubIF@Hf(LLՖwL1ɺH5e SetHL$LL7JH-pe H% HH Le HDƒ=1P1ADL$Y^"L1ɺHHG(HC L H56 DH@HkFHкWP1Hff.AWAVAUATUSH8dH%(H$(1@L$HL2LILH:^I1ҾQH$  $L$HD$PHD$XHHD$`H$HE@HD$hD$pD$xLt$PHt`fh#tVL'h H5 1rH$(dH+%( H8[]A\A]A^A_@L$HT$PHLhtLHtL-11HL$D5TFfL$)D$@E@ ML-P 11Lg LLC 11L% tH.H$Hk@H:H$1KuHHW1HUIHr LHH+ %=uD EtHH$H蝎L1ɺoIHH@H@@atIEH0HIEX$L` h$Ly(Q$L):$A;EPtAEPL$Mi A?t9LqI}HPHHT$茙HH HT$LHPH1 D$IL LH5D EdA{HE@_AXHt%ftHӆuIM`LL~+ AL% IH9$tLf 1ɺ1L濄AIH9$tLf 1ɺ1L濄HE@HtTftJH]HL}HI9t=fDft%HH L! HL9uL L H$1LH,= H$Ht3>#t.HJd%AE,tI}@AE,H5g{ RH$HtD>#t?H^DEt$ &u_]D0ExH$HL%z #d1^LL$L}a #c1L} H5> L1ɺzL%tz 1LH$Ht^>#tYH2]t# <uu\GMtAE,tI}@AE,H$H$cLtLHIQL$L H5y @H$HtB>#t=HV\D%Et" ^u[iH$HL%+y ]b1L1ɺYLhfDLL H5 6D$ELd$(A.EA-C|$A2QAnT1L H5J ELd$(x1ɺLL/1ɺ]LLh`LH`LL1ɺi2\$8L5j[ LL'ڃ$HZL-SL9t*fDHHtLHL9u܃=Ljw 6H5I 1181ɺXLL1LQp cH5w cuhL\ ;H5 3L 1@H5 p~L\ 1=H5d J1L\ H51 }1DL$@Hg Et.H&Lt 1H&PIL 1PH5 + 12L] H5 31L] H5} L1L? H5Q N1L8 H5* vL}1ɺ1LrXMLn[ 1RH5 C%y1L\ H58 IDžL%t L}1ɺL1ɺLL|Lt L1H H1ɺLL|xL溤L$L= MPHILd$IIHL$HH;HLfIPt_IXL;HCIXHIXHHmH;\$uLLd$LlL{11LH :$H5HH=YL? 1ɺ1LzHR>LL)s Qff.AWLAVAUATUHSHXHdH%(HD$H1I9IAL5r fDHL9t6HC@ctLHHL[ 1L=1E1HL9uEAL-r 1LDLLZ sL1L [ ESL1L2[ F3L[ 11HLHLI9ufDHI9H{H@t tEtۃVI@L薰H11L5q M$LLJ[ }HCY^H1M(LL1[ wT@AWfAVAAUIATUHSH8dH%(H$(1Ld$@HD$0HD$(H$H\$`HD$8HD$01D$$Ld$HLd$@)$)$ )$0)$@)$P)$`)$p)$)$)$)$)$)$)$)$)$HW@H\$hH\$`)D$p)$Ht*$fx  f&$$H5H Ј$ EHf|$0EgAFMtM@)H H|$`Lx[ HT$hIHHPHHD$hM9HIu1H:IHuMM LS H5zS 1AH|$(Ht%%=ut HH$(dH+%(nH8D[]A\A]A^A_@HhSL\? 1ɺH5R 1b$DAuDLl$`I9t%fDHIU1HHPMmI9uLR 1ɺ 1H5^R L5 褤HHHkL|$`I9u@@M?I9HIWLHHuI_{dVBHHt H9L H/PLQ H5Q 1A?A]A^2fDh2L4> 1ɺL|$`I9Ld$L5Z @LpM?I9IwH4HH@PHtLhHMtɺLLytH|$xHuLH}L`L#gHLLHHD$xrLH5P A*UH$Hh2;IGHfHHZH9QLJL= AH|$xLd$7Lt$`I9HL11LIP wH5O dH衯IHDLHIHHD$`H9tL;htHH9u蛾H H|$0Lh HT$8H $HPHHHD$8H=AuXLxM6I9MnMtAEatLJL LqT1ɺ1H5N TLPT1ɺ|H5N 1A-$IFI>Hth 胷L{LN 11~H5XN Lt$0L,$L;4$t"@HIV1HHPM6M9uHH$H?11LHDHE@Hf"L"L$1H|LLZYHL$xLL$HHL$ HL$O1LL豼D$HuƄ$L|$@M9uDM?M9ILuD$DD$1LHM LYyAWD$ML}: PL9 OH5L 1AF=L蹵H}L`LbHAA.Et$AWI1ɺH$LL H52L 1ǷLd$0L4$L;$$u\fDM$$M9tMMl$MtAEatAuXH=趙LNH|$xL L UH 1ɺ1H5K LaL ,H$H1Ht$xH1tH1H HE11HD$0HPH$LL$4A[A\IH_DT$$EH@`Lt$PLt$XLt$Pt$MIH$I9|E1M$$L;$$ID$yHp@HlHtID$HP@HrHHfH9]LH=1AL8 H5,J 辵oLO1ɺ`L$HL$x1HxLVKL$HL$x1HvJ LVD$WH$HxLHHDILHLHH)A H)HL$L'7 f.HD$xLN1ɺM~1HI LUVLL$xL:6 pL LL$xLI H5H ATKLKN1ɺHDŽ$LL$xL5 H $H5QH=QLM1ɺH5@H AѳLL$xLV5 LI 19H5G 荳H5G L7 1iLHt$xHt>#tHz*UHt$xH.k H$Ht>#tHA*H$H-g AMLG LL$xH5#G 1LI5 袲LHt$xHt>#tH)Ht$xH<-tfH$Ht>#tH~)YH$H-=L(L1ɺH5vF ALK1ɺH5LF v$ECT&BT )1MLv4 H5F 蚱E@IH;<$LGHD$`Ip@HPHHH9tMH9uH$@LH L4K1ɺO1H5E fHQHPHH|$PHD$XL1HAHD$XHH?HL$XH;<$XHD$`H9HPIHHHH9LHR1Lf4 [QH5D tYLl4 ^\1H5D P6LL$x1H5D L2 Ht$xHt>#tH8'Ht$xH*t}H$Ht>#tH'H$H*LI1ɺX.1ML2 H5C uLlI1ɺH5C Q_LHI1ɺC1H5C +1LI1ɺH5nC IFHth I>[LSL :LH$tIg`ML~IL$ILLD$ILpLYH>Ht$LHL1ILJIILJMt8LLD$蝫ILpLXHHtHt$LH腴HIMH\$Hǹ 1I^L$I]LLD$1IHPHHT$LXHHT$Ht$HHCpIE$tHooPH P0I}|IUIFoH@@obIIIEIIEIL(M6ML;4$I(WIHLF1ɺy1H5A 襬LF1ɺ~1HCpH5@ wLnF1ɺH5@ SH\$II*HPAo,$*Aot$rHPHHǂ H9u$L7zLwjLHt$xHt>#tH"Ht$xHi&H$Ht>#tH"H$H-&$u tHzA#L#E1ɺp1ILJH5i? iLD1ɺjH5@? תELD1ɺH5? 質YLD1ɺH5> 菪LG H5> jvLaD1ɺ1H5> DLd$`M$$I9 ũ3LC1ɺH5 > 衩qECT&fBT LC1ɺH5= AcZWIك1AL, RH5= 1AXAYL, TH5{= 1 yL f.AWfAVAUIATIUSHHLqdH%(HD$81D$0)D$)D$ IFHHPHHH@ HI3$I3$H t0HD$8dH+%(HH[]A\A]A^A_HQHAI3$I3$H uAFH裥I}LxLRHHtLHH荮HINI$I$H9tyH@Hz@tHH9taHPtoHD$H1M$L&, H5= )\$ob4)d$(P1vZYI$HHtI$KD$ u&I$D$ HtED$ H9D$L|$HCE1LLoHHXHp@A)oPA)WuHA|$ \$H9uD$2Lu&L_+ 1ɺ^1H5< 腦LtZf.SHH $HH dH%(H$1HHhH^GxHRx^H H?x#H$dH+%(uaH[IL_; 11H5=; 败fIL7; 11H5; 茥yrfAWfAVIAUAATUHSHdH%(H$1HG@)D$HD$ H8fht fxt0HT$ Ht$HD$ q)DT$ EK11H5]HAtnH6N%=uo11ҾH1uZLfH59 XH$dH+%(HD[]A\A]A^A_@h23H/nHp1H6L. IHHD$HE11IGALDH@HH HPAWj&H AăvDL$E8H(DD$DL$EHH58 11t$(6L( ^_L$LHfD fHt$0Hh2ÅLY8 H5"8 A蘢CLy' 1ɺ1H57 Ai@Ll' H57 >fL7 *L%7 1L tHh2H6AL 1H5E7 輡gLa' 1ɺ81H57 菡pf.H;vfDHE@HEf7H*0L%6 Lk& L fDL%x6 1ɺ&1L:Lܠ84?I1PH=LPL_;1蛠XZ@L% H55 AhNff.AWHAVIAUATI1USHH_HHH9HDI9>H0HHM$HNH1I$rI$L8HHI$HI$HCPI9tNLHHT$%3AŅu.L91ɺ51H5g5 荟HCPHT$ooKHELtx1L D9]Lv`H @HHȃ8uH@HtHL9u KH?L9t@H;GuLLHT$HT$uE1 @AHD[]A\A]A^A_I$I9tH;AfH I9uE1fH7H9HDI6i9fAWAVAUATUSHdH%(H$1H5ÖIH;AH31LaD$(HD$HCHD$EHDHD$ HD$`HD$@HD$1LH0afLI16H|$LD$,蠠(L -hH\$LHx LLuLa71ɺSIHHt$LNHHfIhHt`LhMtTAvp9ppLFL kH5P1 IL# 11ɺLLYVHL{sL;tH/L61ɺvH50 1vHD$8#t>L5t{ C E,Ht$L'H7A<$#t?Lx&t AE,LLLD$(9MHD$HD$\$(H9D$ H$dH+%( D$(Hĸ[]A\A]A^A_ÐHLUHH(LL>IHHD$8#tNLD-=Et* uD%EE,tH}@E, Ht$LHL41ɺ^f.H5. 1xMLq GH5. FL<41ɺqH5. L 41ɺH5P. C@L31ɺH5(. ə@I}@AE,H}@E,ٕk@LXnHhHt1IhHt%ZpL9XpHBJHL EMIHD$8IL9>Ld$HLl$0aLJH1QH5N- LM IFIH@H HA[[L;t$8HH|$0LLHLMfL IHPHHT$'CHHtHT$LHHIFIL$pHH@@HtHHt H9"L KfDL21ɺLH5`, VLd$HLl$0HHIMHt$0H\$8H9Ll$H\$8L|$XLd$HLd$@Hl$PLIM^H9M{ fHMIIGH3Q H3A(Li H upIWIGI3UI3EH u[LfI@LLhHEH1ɺL, H5d+ LHHAT1AYAZHmH9gHD$HM6L;t$0:ILd$HLl$Hl$PL|$XH\$8L9u7I~HGPooM6OL9rI~HGPH9tH)uLX01ɺfD$(fDHfD *fD ILg IFLd$HH5'* Ll$Hl$PLHH1L|$X賕8fDL/1ɺH5) Ld$HLl$Hl$PL|$XuLl/1ɺmH5) LL H5}) D$(L /1ɺZnL.1ɺ6H5>) ߔL.1ɺyCA<$#tNL= t GuD5QEgAE,tI}@AE,跐LL7tLLW.1ɺVLD.1ɺUH5( )L#.1ɺ]H5g( SML9t$8tQHL$8Ht$0IIFHBHH HI6IFHL0LML9uI}HGLGL9t@HULJH0HHHNH1HzHJ LHHHJ HHB HGL9uHG(LG(L9t@HULJ(H0HHHNH1Hz(_HJ0LHHHJ0HHB0HG(I9uHhAL$,1HAHIHI1ɿ1LN H5& 蒒HztgHmt[H譎=!MH11L H5& 1_AXL,1ɺײ!L+1ɺH5B& ޑhIhHh聏謔ff.ATUHHHdH%(HD$8HG@HtftIH'>HEDnEu)HT$8dH+%(HH]A\HEPHUH1HHHx=HHHjE11jE1ɿjj*H 1ɺIL*HD$EHUPHHMHL J MȿHHHhPY^L諢-d 1L_*1ɺH5Y& Df.HLEguLCt1 AD%E{贰qH&t4He`%HHH9-Htg|$ u L踡:!EHxu,H\u H`uHH#E`t@H :fD̸EԯL(1ɺH5*1׎D Eb蒯XDfDHH-$ IL$ HI1v1Lp(1ɺHY:f.AUIATAUHSHu5ͷÅt?tDHLE1HEE1DHPVAZYH[]A\A]f蛮u1L'1ɺ(H5# 覍ff.@AWAVAUATUSHHuHF`HuH-ώHB@HHHIHH9LjHL511AULLL-# Y^H;1LHHLHI9uM?I9IWH9B@uH1LM1L `YH^L3HCH}@HH@HDžH8HEp蘜+L)HCHpH8HD$HHH赨]OHtHGf1HLRmML=3L H11V_AXMH|$p2f1L9! H5 H[]A\A]A^A_LH-S1LLV HŠC`t DH1LL+3 艊H[]A\A]A^A_DHML L1CA[[Mt%I_HtH{hHtHGH@PhHChH|$H5x!҄HAXAYfHD$P)D$`)D$p)$A|$LHD$H)D$P-D$E1Ll$DHl$ L|$(Lt$0f.AI$KDmHHlHHHH9HH HJHIHLMHLvME1tu HL\AFcAGc7MtxACctqHLMHAsH1L mH5! 1tAZA[LMHAwH1ɺtAvHL H51CD$ BD,`AXAY@A;\$LHl$ Ll$H1L|$0Lt$81H5uH\$ Ll {A߂^_-AL$L1Lt$I@H@I$HH|Ht/Gcu)I$HHDH@cLQ 1ɺIH51DI$Ht3H|Ht)L 1ɺIH51I$H|rI$HtH|SA;l$LLLt$1H{`L1ɺ1H5-肁^HLXL%L L]1ɺlLF)L=1ɺ<H5"L% 1ɺf1LLfHL\ 6IH5n1LH(L\$8LMHH1AvH1eH51Li 脀AGcY^L\$8t9L\$8LMHH1AwHi1ɿLP H5DXZL\$8MACcI$H|L& IH51I$H|L IH5Z1Ht$HH+BH;L7 ~IH51d=HuH{1E1L 1ɿH54XZXAWAVAUATIUHSH8dH%(HD$(1HG@D$$HD$HD EL$ @ څH.f(tL E<!I4$1H=BH5vHI[{n1H|IHHD$IFEHU@1Ht$52D$u HHL1PAE11AVHjUL$DH T$ Aɸu D$ LH脈Mf%@L H5" 1A%}HD$(dH+%(H8D[]A\A]A^A_ *E11L$ 0L @H萩f!L? 8V@=IM11ALh H5L \|f!EL L9 f.HiE1HLPIT$sAAVJ_AXA<L1ɺH5 A{yfD=QM11AL H5T d{L) 1H5) A.{~@AWfAVE1AUIATUHSHhHt$dH%(HD$X1HG@)D$)D$ HtD$ELHI9E1fDIM?AI9uEEubHHH9t1E1@HPHHHAH9uEJHt$1DH= h LM9tfHPHD$ f.ILHHPHXHD$IVHXIMHIHXLM9uHzHLAHD$XdH+%(oHhD[]A\A]A^A_HL91fDHPHHHI9uLH-y1L iHwH1L) kwL1ɺMH5 1AwE1f/Af.L1ɺ@1H5 owf.LI9Iw M?AI9uHEHIs1AVL H5vxvXZLE 1ɺ31H5 vfDL1ɺTL1ɺJH5 AvL1ɺGH5 AfvLL$L 19H5Q A2vH r$H5H=.qxfAWAVAUATUSHH $HH $H8fHYdH%(H$(!1Ƅ$II)D$`H)D$pCLstLxC1LHHHSt4H1<-tHcD4@Hu !CHH2uDgEj=T\Hd&HLHLLH$qH|$ jHT$H /+ Lc1RL + 1QH *+ AWQH * AVL5 LL|$hLE1H(LjT$0LLD$,VY^Aƅt Dt$AALD$0MtIL$UL$LyqDL$AEHH5 vuzL5d1ɺ6LL} sHp rLHau=HpHLLpHL?$ 1hsXZfDHsHL5 ݕ1ɿ1L wL0sHx[0HsHtR>#tML58t&  <E,tH}@E, oHsLPcHHt rE1H$(!dH+%(H8!D[]A\A]A^A_@LsLLML H5 Ar1H|$@AfoL$@foT$PHt$`I|$)L$`)T$pwHHLKL PMH5 1AqAYAZfL1HAąLL 1PH5̖1q@LKE1L H5s ApeDHKM$hH$ 1MHLH<$HwLC1LL$ LLT$pz$ L<$H$Lmxy$%=@ufHM11LT$LL ARLT$pD=AZA[LT$EL 1ɺ1LoLM6Lo&5   H5 LrHpL?HHLHL$H$lH|$ jHL$LcL % 1QH % QHT$H % R1QH % AWL= L膬HL$hE1LH(LjT$0LD$,HL$?QA[A_H $UD|$LD$0HLlEL1HL I$0LHsHtW>#tRLDEtr uD E(E,tH}@E,RjHsL_cL L=LL AHs11m_AX&L 1 H5-mfL5 1ɺo1L|LlmG1ɺLLMEmL 8H5 AmHsMAWL ~1AULlH LL" H5Dlo1ɺLLl1ɺLLg_lL 11H5ё6lLL 1,H5lq̌HLT$jHL7DLT$WL ARLL$LkAXAY}DxLL H5 okL|$0Ht HyLhDL$r1LQ H5Ð(kPHpLL@ H5pH1jXZbmHyL$L$!ff.fAVfAUATUSHPdH%(HD$H1)$HD$FI1HI4$U.It$1HIC.HhIgLHgA~A)IDI9LHLLmLgH}LpLHjLLHlpLH$PgH}LpLpHWLHL9pH5/bHHD$襞 AEcIM1D<-tKHcD4 Huރ -H|$ 1!9T$ ˆT$ 1H^qIHHHLAIFHE11P1HAVjs|H AD$LHsO@L 14H5jhL1ɺH5 1AehHD$HdH+%(<HPD[]A\A]A^ÐL H5 AhfDd$LLkxL$fH踔cD$LHD$ML H5 Ag$fL|1ɺH5 A[gfDLL1ɺ:H5h1g@LL =H5|hguA<$#t9Hqt  {uu 蕇DLHL1ɺH5 f@H$Lt1ɺDHD$LS1ɺL 1H5 AfiAVAUIATAUHHHG@Htf8t51Ҿ*AHD]A\A]A^Dft61L= 1ɺ3H5 AeHD]A\A]A^HHE11PE1LDjHjxH AHE@HrfXdLDHA9DLH]A\DA]A^@LT )H5 AdHD]A\A]A^fAWAVAUIATUHSHLzH4$LHL$LHAL9u [M6L9tPIvLtMOHW1L H5 0dHD[]A\A]A^A_fDH $Ht$HLAątAL9huH$LhHDžhfDLHtCHXHLE1dHOL SI1H5b cXZQLE1%L QIH5* 1NcfAWAVAUATIԺUHSfHdH%(H$1D$$HE@Hf)؃~H5M[Hȗ@CLm@MtfA) Mp)I4$1HV&It$1HIHD$?&LHHD$OegHH|$1[IHL$E11HHMDŽ$jHt$vHD$(A[A_HgHME1DŽ$1HjHt$ vY^IHqIGH@HEhHE@Hfh#:LL$L-> 1L ZLNaAHD$8#tGHDcEtP D ɊExHD$@,Ht$H}H|$HD$8#tAHADEtۛ Ik=U AG,Ht$HFL薌W@H(Lm@MfDpL@ 1H5 A `H$dH+%(HD[]A\A]A^A_ÐLL$L 1H5 A_뤐L 1H5f A_tE1Ll1ɺ"H5& AK_9fDH|$ƾD$P Ht$H Ht$HHD$HL$1E1HDŽ$HjHt$ LL$8sIXZMLL$(}IGH@HEhAD$xAH$AH$AGP$Ad$IH$HD$HD$pHE@Ht]fh#tSL 1H53 ^L- 1ɺg1LLA]LHT$pHLL$( SLL$(tLH$H|$螎$H|$赖$H|$ $iHL$;APtAPL$M!A8tELLD$0ZHPHD$HHT$(HxIHHT$(Ht$0H{cHD$HD$L3M  LLH5DDd1\_AXf.L1ɺ6H5F Ak\YfD1ɺLLME\cff*f('fhHt$LyD$PLkFJCMt$I\Ld$fDII9#I>11GILLduL|1ɺL-; ALX[ 1ɺLL=5[H\$L- 1LR QLI[;#tXHtD!Et |uD EHD$@,tHL$A,Hy@VHt$Hb H|$A誆hDI@AG,VHL$A,Hy@VHfDfDL- L 1ɺlLAYc1LH5\YfL1ɺuL-{ L1AYI[z~fDMHD$LLL|$`HD$h-HHL4<. H|$<Ld$`H{1HL7H{L{MMLt$(I$HD$`M9L|$0Ll$Hl$8M|$AGdtRIIH9u=HmH9t-HuL tH|$0HL$`LLLd$`I$HD$`M9uL|$0H\$(Hl$8IHHD$`H9tnMDHBHH`uCH r<ŀu7H%r0H$r)@u! uH0rH-IHT$`HHD$`H9uMI$HD$`HD$HL;d$(@Ll$Lt$(L|$0Hl$8Il$HE`H ĀML9uf.M?L9IwHtLHI9EHLEIAqH4vH| HB1fDHHt L;jPHH9uIHHHH9iHWBN1L9hP@Dž@Ld$`I$HD$`M9L|$0Hl$8MI$HD$`L;d$(HD$L|$0Hl$8H(@H%Ld$`I$HD$`L;d$(Il$HE`H$sLHI9ejIHHH9yjHHhHD$LL9upM6L9IvHtHtIHL$H;MP IH4HL$H;HP%HL$H9L$0HtL|$0L;}PHt$H|$0HL$`L7L- L1ɺcLL|$0Hl$8TL1ɺ{ufDLL$L 1:H5Q AqT_@Ld1ɺ^L-# fDLL$L ?H5 AT fDD9<D9yH|$0HL$`LL\L- L1ɺLL|$0Hl$8SL1ɺL1ɺzL-H LL$L JH5& AFS4LHI9gILhHD$LL9ufM6L9IvLxtIMtIUPH9T$! HHL$H;HPH9L$0MtIUPH9T$0Ht$H|$0HL$`LfL-< Lh1ɺwLL|$0Hl$8GRfGLH@L1HILH<HIP1I9@HH9xI9tHHH9H0H9ub1D9rI1L-} MNHL5 LL|$0Hl$8QHL$LLE1LM9AJLtcIH ILDD>u=HNLaMIIH9ufH H9L;auHL9uMM9uMM9Ht$HL$`L L- L1ɺLPL1ɺMMk HD$LL9uYfDM?L9GIwLtIL9u+ fDH L9 L;auMML( 1H5^QOL1ɺL- 1ɺRLLOL-r L1ɺ>LL|$0Hl$8}OLy1ɺL|$0Hl$8MI$HD$`HD$HL;d$(Lt$Ll$(L|$0Hl$8&@Ld$`I$HD$`M9=ID$HP` tHHH9cHH@HHH9cHMHhL9u@M?L9xIwHtH|$0HL$`LLKL-( LT1ɺLL|$0Hl$83NL/1ɺuHHH9bHMHhL9ufDM?L9IwH`tH|$0HL$`LLL-x L1ɺLL|$0Hl$8MKfDLHHL L-, 1LMMH1L|$0L;xPIHl$8ϽIL- H蹽H\L SI1LLXZHxH9UL|$0Hl$8IHHD$`H;L$(NL|$HE1L|$E1HD$@IHD$8Hl$XD H-H}2H4sHH9*H|$8>H|$@I/HD$8L9xPHD$@L9xP8 E1H|$HHL$`LL Ld$`I$HD$`L;d$(bI\$1H HHH9HC`HDHtH0HLqHHHH9HDH4~H|$8D$0H|$@L$0 ȈD$WMMIL9uMmL9IuLwtE1HHL$8M9~PL9yP8HL$@L9yP8HL|$HHl$XFLH;L, IPSL-@ 1LaJA\A^LY1ɺf.Ht[IMtOML9ufDMmL9(IuL菽t|$0tV|$WtOIE1fIH]CftHLH@HD$8HHD$@PM9~PL9{P8tHL|$HHl$X*LHL IPSfDHLqHhHHH9HDIHE1H9p>HhHLpHC`IH9IfDMmL9IuH?tHAM1H5ILq tHY^HD$L H5IL1=HUI1Hs8ML9H\$0LLl$8fHH9HsLxtH\$0H\$DL- L LIG;#t3H vt *quc5qmHt$HA-H1ɺELLB:G(IZD$WD$0IHHL$HI9u(DH L9L;auLt$L1ɺ H5#HFHL|$0L;xPHqLHHL-C 1Lz LHl$8]FL|$HHl$XMLt$`IEHD$`L;l$(t:Hl$0LLt$MMl$AEaLd$`I$HD$`L;d$(uHl$0Ht$LbuAHt$H|$ZhZH\$I1ɺL-x L HL1EHK`L$$1HHqL$$1ILTH|$z_H|$-:H\$H%HKAAt(LI-LLAHD$H``H-tH\$HR_HA@HL|$PH L y ALDPL = n11RDA[[f.III9u1I9t@I9uL;pP@HI9HSpHCXHt_HJPHtgL;xPuI9tLJH1L- Hl$0L; LCL1ɺHtL9xPyI9n@HLLLOL- LL1ɺLHl$00CMH\$0L9LH\$0MH\$@I M$$L9It$HztH\$0Mc L|$05ID$@Ht>HHt6H9t1LJL 1L|$0ZzL LLp1ɺH5CUBmL- LE1ɺLL|$HHl$X$BLl$0BE1"DbH|$@L|$HHl$X蚲H|$8H荲L IPSMHL|$HHl$XbLHWL IPS1ɺLL{AmA Ld1ɺ1L- L AL*AHD$L yH5Hǀ1@.L1ɺ01ɺLLA@m1ɺLLA@GL-X L1ɺLL|$HHl$Xc@LZ1ɺLG1ɺTTff.USHHBB8u 1H[]H-[Jf?;IٿIH H3HDHH VAPH5hLADQP1ոH AUATIUSHHH=H{HDhHt HcC)9%D9DM։3Hc%EHHt)HCHcCHIcLEkH[]A\A]H{A\tHJDID$IA\u:xuHL$HT$1K|&H5 7wID$ Dl$,K&W@AH$dH+%({HD[]A\A]A^A_fDH5 ,AWAVIAUATUSHXH|$H4$H5 HT$L$dH%(H$H1HD$8=H5NP L>@HELl$0Ld$8HL5N fDH LL%4HtH|$8u?BtaL|$@1HT$,LLZ5uH<$Li=uH|$L$,7H5lu f.nfDH=H|$8v7H|$tCL$t6H1t$LL$ La H5bDX1ZH$HdH+%(vHX[]A\A]A^A_D;HC88LL$HM H <IHx-H5)bA9HDHAPL=QP1H HD$HH!/L"H=/)$7Ht0uP\-~\6r\HLL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1H$I$(HD$HD$ HD$D$0HD$dH+%(uH:7f.HLD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1H$IIHD$1HD$ HD$$ D$0MHD$dH+%(uH6nul-nnff.PfH=5v@HH&&H&H & &讓H=Ht-4HHff.f1DDAWAVAUATIUSHH4$dH%(H$1D$(HH$H<$Il$84HD$HQ$Lt$E1@E.DEX;0HfDEnIE6IDA uA#!A'A"IE1LA8tHBHEuDA tNtILrI@TA@L 1GH5 Ad1H|$.D$(H$dH+%(3HD[]A\A]A^A_fIFI9HcÍSHL?YHDŽDHcHDŽ H<$H5 3H<$H5 3 H<$H5 3GL<$H5 Lf3 H$H- H$02HH$/YYLuL.HHPLELw-I|$LhLHDLLH_61ҹH=KID$Hd3HuK1ҾrLiR`$}H9gHD8-ux-uPKHH$-YH9tQHHV=u1܋XH-n'DHD XA1HL= .L諝]t`ARL~5[3D$(IH L 17H5 Af.,A1Ҿ LrLH0iAEiH1L -D WDQHH9t$I|$H5 DT$HL$H'DT$D uA HL$HNAID$@Htf(-u먋l$`LEh <$%f ft$tDl$ D l$@A<$MD$@H|$81MH$IHH8@LHD8@D$pD$XAHt$`HD$ HtLHDmHf|(t8EIzKwH5 HcH>fHHAHuHu닄$L㋬$Mԅt9$`Dl$XERD$p$fo$fo$$D$X)$$D$)$$$$pvAhA$t$H|$ HH4LH(H9D9(u LT$@LT$@KDEA}AOAAxAmAbAoWALAAAN6AD+A f.A$f IcH|$`M$L vHILI(M9E1fA$4Df{(H5@ tH3IpLT$HL\$@A#L\$@LT$H[ fAy(AF$tIQH9f{(A|tHSH9HLD\$lEo|$pD$X]HcDGD$pFvgDDH\$ EE1E1D$$%$;ED$AH(D$E9t"DLPuAAH(E9uދ$H\$ D$@ID$@H f)!Hp)H$`1ftHH$h1ftHfH$ptHH=J H$x HH$`Ld$IHHH;Ht/H$!HH9\$XuHLLd$HcHzL$HiH QfIL$(H-z $AT$0taHtIHcHHcXL,RIIfB|((t&] 1I1LID$@1fBT((IL$(9|$\$A\$\H\$PI\$`HfhH@L"ID$@HfhLoLOgA$BID$ @@ID$@1Ht fhID$(LAo$HAo$XAo$hAo$xHA$Ao$Ao$A$Ao$f|A$A$fA$HA$ A$H+H HI#$H I$AŅ A$L KA$ZWA$LgA$;&A$uEA$gg,EA$uD=V EpEu VI$Ht1ҹH=%Hu%I$(A$A$A$I$0A$@%>I\$@I$Hfh)tH@)LlA$ID$hA$ f f c 1E1Lo H5t fLb11 LIH=29HtXH=)9HtGH=@9HtV=$H8H8H9tL/L'H=TtLE$A$tHpHHuI$0HǀHHApML$11L LI|$ID$HID$PID$HHGHPHHHuH=WdUdHt&H8dH%dHdH=ccH;Hcft1AfA$IcE1L @II$t$!u<9t$x|$@9D$tDEʼn|$xD$tHp#D$l$t$D$@D$xZI$0HǀL臁nL;1ɺ 1L"LHHcH=sH4HiHH$DL0M/LwA$ID$ @@L1ɺ LLA|A$*I$ M$ I9!L=eHEHPHZH$H{HH$`H$)$x%=LK1H-L 11cLHc|$hHHM LL e jH  H jH5 H=)PCHkFHPH PH! APP1'H@HML H|$H\ALH8wQ8H|$Lȧ H1< $/% L%1ɺ LL$ LM QH5\RH= HD$lI$0Hǀ1ɺz LLA&I$8Ht!1HHHHt9t]HHHHus L1Lޣ A61ɺk LLAHHHtHJHI$8HxH@"L 1ɺE1H5 2L1ɺ} :H|$PLM=L7 cLl1ɺ H9BqH$H9`1?HLLd$QLKLH3IA9Hڶ HEHH~ APLiSP1H 1Lۡ LDff.bfAWAVL5 AUL- ATUHSHHdH%(HD$1DƒHSL:M=LH$IHLLE)H1LLH/ ƒHSL1HLDH5 H4$HHH<$/4HSHBHCL:M3cDH5LH/ƒHSL1HLDH5O x[H4$Ht1HT$dH+%(LH[]A\A]A^A_HSHBHCH5 LAHt|/w]ƒHSLM1HLDH5 םZf.HSHBHCHSHBHCf.1HH5pL|_M#1H5 Lä @H4$H5 Lʤ 1) H4$ff.fHHt$(HT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1H$H$HD$HD$ D$0HD$cHT$dH+%(uHfDATUHH=IHt5H-E1HHTLetAHL]A\fD1Lz1ɺH5 HL]A\I|$E1胢L?11H5E ff.@AWAVAUATUSHH|$D$dH%(H$1Eo$)D$ Ll$(MDAHHl$0L5 HD$ALHE1fDANjSD9HsD)IcDHHcYtnAL$'  IH1۽ E1K4.D)HcIDž~~Ã~$LcH5 Ol.LLc)؃L9MHchH>I늋T$$qHt$(H\$ EPv Ht$01HH4$HIcIH4$HL$1H L0E11ɿ1HHIcH|$HE1H |011SD9eAD$hhE1H|$(H;$ t $$HL$iY LqLiH$dH+%(HD$H[]A\A]A^A_EL 11۹bE1E1H5l tApAEL$HIŸGED$>LD$ 1Hѵ1H$(H8ÅtDLl$(M1L* 1pE11H5Ҏ  1E1 Q11L1E11mfDAUIATIS蜖HtG1LH5h HH蠴HHtXI\$L[I$ID$A\A]fL̍1ɺ1H5 1 f.L1ɺH5Ӎ H{1赝xAWE1AVAUATUSH8dH%(HD$(1L$MoE1L$HGHD$ M&fD$/ƒHT$ D$L:M=L\HHLXI~HPHHT$sHHHT$LH7HH5ê L)L{DLAC%teML! H5s 1E1DHT$HBHD$L:M-E1MAAs]%uAtuAyD$/!ƒHT$ D$HI~H0?HVH(H@H@MIT$HPID$IMMD]DD$/;ƒHT$ D$I~HHDD$ٰDD$HHH@ H@H@H@MtID$HEIl$I~ DD$袛HfI@HE HX?HT$HBHD$DAD$/ƒHT$ D$HLHLIHDE1HD$(dH+%(H8D[]A\A]A^A_HT$HBHD$DHE DD$fIoHT$HBHD$[DE1ɹL ^L 1H5 .yfHH|$ Ht$(HT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1H$H$HD$HD$ HD$ 0HD$$$$UH HT$dH+%(uH@USHHHHt +Ht6H1H)I@IHtAHL[]ÐHE1L[]N79}+AABHtD@f 9}BHtE1UHH}PteHtW 1fHH}H}H}XH}`H}hHHH]fE1HPHfFF HOPQAAADpփp pp P,Qp(P$QPQ HI(PHHPHH  ʉPDfDADfDAVIAUIHATUHSHHwZ(IHLwID$HHaID$HtNM,$I\$[L]A\A]A^fE1I1Lė SH5%[L]A\A]A^L cH5vIl$HtH1HH9HI|$LE1YL ^H5A(X1L- H5kfD=zSu H=%T[H%axAH 8L  1PHt: L@PH5S1XZATHdH%(H$1HAL"%1H$H %H%H5_~>=%w~0%AH$dH+%(u}HĐDA\LQ 1H5 fL%8LRIH5J1AE1pKff.H=h$tË b%uATAH% %%%=wntnH1DH5IeH=E H#wt`HA\@+tDH%H5dH= )HA\f.H=i#D$ D$ HQ#xH5#eS1t2t4H5 #1Htڸ#[f.%1t19[ff.AVAUATUSHH $H dH%(H$1=D$ D$ J%H\$L%1L LH H^%%%=# ADH蹮LՀ1ɺ.X@Lͭ#LA8DA 11褭EAUL%J1IUL 1;LX ZHaAվ!HAƉHH DH H%H Dz11H1b` TzAąAH$dH+%(H D[]A\A]A^ )E1fDHT$ H5 H=| t7HT$H5aH= tDl$l$ 2L 1ɺL% 1LK1LLő *JLL E1fDL~1ɺ{DLt~1ɺ9L%; 1LLO~1ɺ1LEL 1H5 kTfD+8H-IT|$ILIH HH z~ HDHBAPL1QP1H D11親.H-L%E 8|$LIIH5 HeH HDHAPLQP1L}1ɺL1H [ DHɪL|1ɺE1L"&AWIAVAUATUSHp H8dH%(H$(1IWHaIHAE'AIcH5Z HD$EIH$1PHH MoM/LrH'HPLHtL{1ɺ8[H5 HLE1f.AAQAuAH$AąD H Mc'H$EDŽ$D$xfDALJD5&%MoAwDL18MDI}LMm H\1MuA$,DH<HHH@IpI`IXIh HD$fMt4IH4$HL LU N 1zMc'Am,DH<HHH@IGpIXHD$HHI`Ih/HT$1+HT$HH@HD$H9I`HHT$HT$HD$8HpH\ Ht$0H9AFHBEtHۃsH޿IHIH4 A^ LAF8PAP@AVAFAG4xMD-zMcO0Eu Eg8EEQIcG4IANHH H%H L IF(IG=%H HHA?I~01"IHbI1A?uANAWxt,=% oH4$Ld 11tpAG(tANAtANAtAwANAt0=%wH4$L3 11ANAEEt=]%AN@EEt=<%,ANAG,AnI8AF AwDHMoMIL|$(HD$H$HD$Lt$ M@MfL\H2IH|$LDŽ$L}(H$IFH$Ƅ$MnEeE DL1H\uLHt$DPL9@Ic҉HLH9, @LA\u A\EeHID LxEeEu@HHfo$HHHUH)艄$H$fo$HE ]HMv MH@H4$1Lي H4$1L D$EA?EEwD$xD$xe@ eMc'IhH H|$$ I` HT$1HD$0DHT$HH@HD$8H9GLt$ L|$(M1H4$|Ld H4$Lit11AV 1LLH4$1L nfLt$ H4$1L|$(Lr 4^H4$1L9 3Lt$ L|$(HIwXHt HT$HIw`HtIGpHT$0H}HEIwhHt HT$8HIcAFAW| jANt AFHHut =Ҽ%vAAN @qD$|IcHIo`HD$AF D$HHH5s aHs HDIGpH5s H V AAEfAnG4EO(EWxHD$AE_|H HEAHD$`AH HDHD$XAHs HDHWs HD$PH s HDAw0HD$HHs HDHD$@Hs HDEfA~HD$8Hr HDEHD$0Hr HDEH r HD$(Hr HDEHr HEHL$ L]EtfL% f8=fA~Hq IXL2 HD$pH L $ HD$hHAH q MMn0HƐ HDHH$PD$ PHҎ Ut$8$$$$$$$$R$$ARAPL~ $VASWAQL 1ATAUQH$H$Ӌ=L1$PHDAcD\$|EA?LZADEt'H$H5+ L膗AAFW<HHAV 1L%#LQfDD$|}k8A91AAPt D\$|AfEDkU^=%AF H4$1_Lo LA?L)AV 1L2LDfIXH5 1f8=HD$pIIHD$hfA~L @ H!H= IfDAF A1AO.΃ H HcH>f.AF\DH-%HHxLLT$8HL o PHo LEPHWH5 P1LT$(AHEHEH H4$Lm110MH- P@H4$ 1Li ;fLLDT$@ DT$@K f-%Hu Aw0 fAnG4H=Xf~RL L  L4 HIcPH( ARHWQ1AQL :1VAPLz ATAUHt$PHP1A$Jf.H4$1Lс +ffDHIIIMf(MIF0 HD$?IHHlmIEPPHH0HW1PHH4HI9uLd$Hp 1L{LAG4AT1L cP1Ht$EO0AXIGAYH4$1Lq PALL k tL k Hk LEH$1L HAL H1EAN EL.} 1E1H5H$(dH+%(rH8D[]A\A]A^A_f6q%H4$L" PX%1ɺ1ANfI@IWIH1HD$0HD$8ifANH$H CA_01HDŽ$)HQH9HHVL%h H7HgH x.LhuA}tހx.uA}.uA}tLLt/LH HPLL` 1ɺH޿Lg1m@3Aw0fAnG4H=jSf~tfH={ f8=f~Li L Q L HIcPHz ARHWQAQL F1VAPLɁ ATAUHt$PHPJ% %"fD%D9 H1ɺMPLA} Ht$1$Lc %EO0AZA[AuAO0fAnG4Lf~…H=BRtfH=W f8=f~H54 L g Lb Hg H L$H MIEHASWRVQAPLz USPHHHD$P1AMc'HPfH=Å f8=f~AuH$Ht 8 AwHALIF(tJHHjH jE1E1W щHT VPjH$iH0IPHtW 1HMwPAEE 9HH MoMt-/LoH HPLH]8 IHtHi AG0HE0AG4E4LuLHP H&HHu1IHEP@A;G(cMWMMMDMnL$LL$HHPuDHrMnID8 tIIIVMjH9 IBINH9 HLLT$H$H$LT$I IzIvL$L$ALE4DM0 AULw 1ɺPH޿1AY^Ld L$1ɺH޿1MJMN1ɺLd H޿1zL$MR Mv Mt MM G HALJaAG4QAO0U@fAnG4fL 1f8=LMMf~qLLb11H5QIHtHUgAG0HE0AG4E4AGLl H51AAZYfADfL p 1f8=MMMf~@LKM+L o HHH o 跸H1L l H5v1Hf.fD 1LҿEt-A"1D LWp H5RALp 1H5|RAff. fDHFtRH<\uWу0uOAAA0uDGEAA0uAHAD@IH.AW1AVAUATUSHhI{MSICH<$ML\$1IzMZIBH|$MLT$ 1I{IKIC1H|$H_HYHqHA1H4HkL{HC1HLuLEHE1MMfMNIFML1IMl$I\$ID$M1II]I}IELT$XLL$PHT$HLD$@HL$8Ht$0L\$(HL\$(Ht$0HL$8LD$@IELHT$HLL$PLT$XtIHkHMtXL@LMl$LHtIKLIMfLMtMfDLuHMtLHYHHtHH|$IKLt L\$lLT$ H|$MZLt LT$-L\$H<$MSLt L$Hh[]A\A]A^A_HfHGHW H)H~HHHHW(H+L_m LH1RH5Ml1HDHWHHOHHH9unfDHH9thH;pu H9tHBIHH9uI@HBHHFXHNXH9u "fH9tHPHHH9uHVHPHAUATUSHH $HH $HL$P!IAL$X!t@)$`!)$p!)$!)$!)$!)$!)$!)$!dH%(H$(!1H\$ IIH$"!HHD$!H$0!$ D$0HD$荭~ILs1DL1ͺH$(!dH+%(uH![]A\A]7ATUSHH $HdH%(H$1HHH 11H1uAąx.H$dH+%(HD[]A\H-8<$IٿIH{i HHDHH APH5LLQP1HkfAW0AWAVAUATUSHH $HdH%(H$1=IIIL5HL1ɺq1LHL4$HML2j 1AUtLU1SAD$H H$dH+%(u?H[]A\A]A^A_D[IL[L5Kx3ATUHSHH)HsXIHt"HHH褴AL[]A\1L H5;L[]A\ATHWHG H)H~%H0HrHTkIHtsLA\DG(HH+L%LJPLLh 1LE1XLVGZ11ɺLA\L,G1ɺ1H5OnffATUHHr!SHWIHt5f@HtHH HHHSAD ID$L[]A\1LF1ɺH5ϯL[]A\fDATUHS>Hta WIHf@HCID$HsA$HtHID$HL[]A\f.LfL脩LHHIHuLg 1H5 )Le~ 1H5ܮtfD1ɺE1L}EH5͵FATUHSHH5: H;袃u6ALf 13H5WvD[]A\fDHHPHH0L"LH H@0@8HCHtt1LH5)u HXLHA>fDHLHCHtH@Ht HSLLMd$Mt EA"L3H!LHA1 fDL%E1L] LLQ;1ɺL1DMHEdH+%(aHeD[A\A]A^A_]fD1H5cHw~HL?EI|$1HڍHzH;x1LH5ps HnE1ɺL{:H5˪DM/f1LH5*s H+A>tnLHMvMtRA>tL1LH5r HuE1ɺL9H5ADM1LH5 H<E1ɺL9H5͢DMULH%MLi91ɺ1H5E11LH5{ HE1ɺL9H5=aDM HfJ HeA1AփH<1D9rHʨ9fL%LZ ELǨLc81ɺ E1ɺLA8H5mDM1E1ɺL8H5:^DME1ɺL7H52DME1ɺL7H5DMjE1ɺL7H5ڧDM>E1ɺL^7H5DME1ɺL27H5^DMEL711H55TDME1ɺL6H5(DM誟f.AUATU SHHHLo LgLoM9茚LHH2Dq tVI9ufDDA t!HHS I9tlH< uC(fDHSI9tSIHS H2Dq u@#uMI9t(HB@0H@t@ tHC HI9uLHSC H[]A\A]Au@t"HB@[wH=t @Hc4H>C I9u38HDq u%#t =t{tHI9tuЅtCHC H[]A\A]CtNI9tH0Dqu@.uЃ{tCHI9uDCCC C I9vCCnCbC VCI9FRH"t"t\t.HI9$QH"uI9HHI9QHtCI9uDtHI9'uff.fATUHSHdH%(HD$1@GH%t HcH>HHIHH}0H$HIHHx=}U(HEHH+ELDV RLHf1H5mE1XZHD$dH+%(HL[]A\HwHW H0H)IH(}U(HEHH+ELU RLH ffDH0 BCIHf@蠚H}1HL ZAD$}U(HEHH+ELU RLHHIHH}0H$HIH(}U(HEHH+ELT RLHffDH0 BBIHf@覙H}11HМID$te"Hu@HH=]3ID$[EHPUHu%LS 1ɺH51UDuU(HEHH+ELS RLH{LT !H5֙1E1dW(HGHH+LS RLH"fH'fD1HfHsfDH[fDL/1ɺ1H5>fL/1ɺ1H5fHgfDL_h fLah EDUHSHHHH8?Ht/H;HhtQHSHHPHSHHCH[]Lh H5=H1[]菒ff.@UHHHSHHHH9u&fDHH9tH;XuH[]fDH(tH{XHH[]fAWAVAUATUSH(DL$dH%(HD$1HHH?HIIHM>IHHxHHHǀH1H)HL=H;HPHHT$Y>HpHT$LH LID$H;HPHHT$>HHT$LHoEI$ID$D$AD$oMH{AL$(oU UfAD$pID$HID$PHID$HID$XID$`ID$XI$I$I$EHl$M|$xHH AT$8H H%LH кHD$ˎA}LH{LLP螎~LBP ;H5tH{H2H;LE1P:fID$$1E1LO H5XHD$dH+%(u]H(L[]A\A]A^A_fDID$DLiO 15H5H;LE1-PvfDATSHIHtHA$ID$@AD$|AD$,ID$0ID$8ID$HADŽ$IDŽ$ADŽ$IDŽ$HL[A\LE15L*11BH5.A;1LN H5-ؚfDAWMAVAUIATAUSHLL$HtQD`0I@8h4t|LtAąu}L*1ɺ1H5![L#&L)1ɺ1H5E1+HD[]A\A]A^A_f@|x@LLUAąH\$Ht9IFPHh0HLL`L:HLHHڕHH|$PA:IFPHH袌LLhL9HLHH茕HHD$PH@L(1ɺ1H5&HD$La HH51E1HD$PLnH뾐AWAVL5+AUIATUSHHHdH%(HD$81=:HD$tAL5k+ ;uPLQL L1E1DHD$8dH+%(wHHD[]A\A]A^A_fDHpŅFHT$1cÇHD$HLIٹAPL` AE1Y^j^mH-8蟌I1PH LPL'1XZfL=iq%AA1H H K L.111L>LD$ ljD$LLD$XDT$LD$LH 1DT$D یHILPL_ UATAAE1DT$$H DB6EHn8w1ɺLPH L Yp%PL&1AYAZ@L%$8-;ILIHE HH _ HDHAPL QP1AAEE1H L\%1ɺ1LE1Vf.Lr^ #f.;H-d8mM1PHBLPL%1_AXH8%=o%MIHD H~H5]HDHE1APLVLP1DT$$H /D@HFLH "D DFHH] HDEHH] HEȋFwFHL] QRWLNH59'16H HDuHLXH QRF8PF4P1WLNH5&H0HfQLG RF0PF,PF(PF$PF P1WLNH5&H@HQL\ RvWLN@&AWL=AVAUATL%Fm%USHXH-dH%(HD$H1H]L9wH=\ dEUHu8D]4H}@DM0DE,M(DU$Du Lm[wqiLJE@A,HUHHEHHBH蹅HL9HDuLHEjH=A\ EfuAt HUHD$H1MASLF H5#%D\$$ARDT$0AVLT$(AHD\$4H 8tEDT$ A}<LE 1;H5$L? ;Y1^H[]H1Ҿq{‰EyހH-8t@ t[~AٹLG@ Px S1H5XZ1H[]DHAٹl SL_? DHAٹr SL? DAUA ATAUS1HdH%(HD$1D$fDL$+~Ht$߉Ёx\E UL@ H5S1XZHT$dH+%(H[]A\A]fH-L-8 HAٹ ATL? H1AY1^D;L-dH-S8f|A1ɺ PL> HAT1AՉߺHt$Ԁ_AX`HEHSL? {AٹL$? P ATGZf.U1ɉ1S11H|x?HA 1SL? H5srXZH[]@+~HT8]{AH54PL? 1 UY^1H[]ff.AWIAVAUATUHSHhdH%(HD$X1‰D$At=T_%fD-A?`Ht$LfADT$LLl$RL5xD$1LDT$f|$VDD$R DT$1D1 DT$'{DT$RP L`@ ARDL$ DT$1LXAL%N Z E,fHDT$LN HN L O LO DžHD$H]< H= O LI@H5O LDH O HDIHeN HDHT$H_N HDHT$HYN HDHT$ HSN HDHT$(HMN HE@HLN HD$0H3 HD LDLDHT$8HDHN HDHDȃHDЋEH-S Hc\H>=*]%Dt %E,ADžHT$XdH+%(Hh[]A\A]A^A_D1H=ULl$R1SxAą LDptHD\$RfEtEAM D-u%f|$RtDt$HELb= P Dt$(L5D$L1|$11hxZYDT$D\$f1D1 D\$DT$9xDT$D\$PE1Lr= AR LDT$(D\$AXDAYqD\$DT$t(L1ɺ 1L΁DT$D\$DT$LE9{y8 HL5vvL; LI 1DqtL1ɺ# 1L1A1ɺs 1LL E,1fDL: L51LЀpL: D1ft$R@DT$H_x8uL; LPD$ P1DL$ELL; v 1D $8Y^%L1ɺq H5 L5LZ9 1 LwL%8t1ɺ LPDl$L; 1AUDL$ADT$EL; D$DT$jH*J Hl$ UATASAUt$8t$Ht$Xt$ht$x$AQAPEL; WVLQR P1SARH$ӸHĠHI HI |HI pH,dHm XH<LHI @HI 4HI (HI HFI H[H H-I HaI H HI H @L7 #H DT$H}D\$u8rHL8 PDL$ L1AZA[t$|$IDT$H}D\$^u8r Lv8 PD\$ ASDT$ ED\$DT$uDAW1I1AVL5sAUIATAUSHDD$LAH DL$ IRVL}ZYHD`0T$LH@8HʼnX4@|Aąt`D$ H蛏1AċtD$fRE1E11PH+ 1LjjPj?H0H'HD[]A\A]A^A_DML9 L1E1|DžNAWAVAUATIUSH(HT$Ht$DL$ AHHD$ E1ALMjDAFDt$ < v1AF<v)AFA<vH= T$rT$EHtBL9G4,IIJD=D0EA\u|$ tB|=xA\tH|$ tHL)HvmK<,1IHH %F Ku@HL$L)HHL)HvI1C,IK@HULL$(L7 1H5r AkzXZH(D[]A\A]A^A_MAL9t1C<DDDHUL"7 LL$(E1ff.AVAUAATUHSHHHdH%(H$1lHCH{lHCHlHvQI>LD 1H5z yy1H$dH+%(HĐ[]A\A]A^IAt'EH&qHCH_fH5# HAnHt\H1UH- L f L Hx^1_1ɺCHLax1:}hM_IEALLH5qf H|0AVANUH4L L%9 LE1L5 L-xLpZYHCHML5 LRw1xIHLl5 BZpIXL5 H5 w1(ff.@AWAVAUATUSHH $HH $HD/dH%(H$!1IEuUIhL<5 H5 wH$!dH+%(rH!D[]A\A]A^A_L$HLIL'jAŅtpLiHv/A?/t)IWL11:/@HH9usM~LA H5n 1E1hvDH$MHwHD$H1HHbd  H|$Ht$ hiH$HD$u H;D$H$HTiIHWH$@L$HD$LxrH/x.LxuAtހx.uA.uAtf.1MHپHc LT Ht$LhuHD$H9$hwLd$LLnLjotNlHu8#jL wv1PH;LNPH51XZLd$fD1LHAMs1L? H5tLncH5oML? 1E1Ut1Ms1L? H5)(tH$MH~uHD$H1HHu? t#H|$L.gu+H$HD$ML1 0ML? !l\kHs8h=tH" H IH]WH5MHDAPgL tQLhmP1Ht$(H Ht$jHs8hH51L jtPH&PL=1Ht$Y^Ht$Rff.AWAVAUATUSL$HH $L9uHH C |$t$ dH%(H$P1|$$H߉t$(H5a}D$,QmHHIH$0L== fDLkL HdHgH$p 1LHL$`HL$ IHT$MZbYL$=H5H߉ $f $HI $IH{AV $H$_u'HH=^AT uLt$`LL$LƄ `輱/LƄ$7eL$HJLHPLkL$PLxHLl|$;|$$t$ ;t$(HL$$LL jLj[hHp8eHL @ PHLj$PHZH5@P1Dd$LH E8fD=_H_$D|$L$p D}t$ LDPL$01HپHt; LLcHHpL=N; @HHlHx.L@uAxtހx.uAx.uAxtf.1MHLL(wH$`Lbf8xHod1MWPH1v H5PLC1Y^HifHn8cM1ɺ]PHLP1H5XZ@Lt$`fDL, H-V1HPn1ɿ1LH2nLgL1ɺ1HnDd$,EAH$PdH+%(HĘPD[]A\A]A^A_@J]LLL$L$AB|LL${L$LHt$0uL$wD$L1ɺL+ H5>PD$PPAVD$8P1DL$<.mD$hD$uMtFHB11UL# H5\cMd$XZM?|f.MMd$M\HE1QH-n\11HL(zcL11MH\cWAWAVAUATUSHH $HH $H_dH%(H$ 1HIeHW HwII)IH08Lt1ɺyIH] U(HEHH+EL/ RLH{1H5Z[E1vbXZH$ dH+%(H L[]A\A]A^A_I LLmTB4 m HA<$?M8H}0LLuIHEEU(HEHH+ELQ RLHf.kL71ɺgIHtUH=};U(HEHH+EL RLHjfL1ɺmfH5Y1E1a@ۨIHtÃ} U(HEHH+ELv RLHoBU(HEHH+EL RLHfDH}PtELHp}LHHu1ɺE1LH5YC`fDHfDL1ɺ1H5X_fHӸfDH軸I}HE@HbIHI t%ML 11H5[Xz_Mo HSHuPHELELLWHEHMHPHU H9HDHE HPH9HЀx u8}ux uEkH軷} 1E1f.IFE t$ t|HIDHHtMuIf HcEL 1ɺH-/W1HI^L1ɺ1HE1(^ HkL1ɺ롾 HH}0 6IHtf@"SV1H-VLi) H]OATfIUSHdH%(H$1H\$0HG)D$P)D$@HHHt$0Ht$HHt$P)D$`)D$pHD$`HT$8D$XL$hL$fH( HD$(H$D$D$fHHHtp|$@ uH\$1I$HDHkH{HC蟝HCHHt HfDI$H$dH+%(ubHĐ[]A\H-/UL1ɺH=\I$1L1ɺH\1H-TTDATUSH@dH%(HD$81Ht_HHI @H[HtGHf11HL)D$)$HD$)D$ HtHT$8dH+%(u H@[]A\1TATII1USHH@HzdH%(HD$8HHLHD$HtGIt$ H{H>HE HtUHD$HHT$8dH+%(u\H@[]A\1L1ɺH5SZ1fL\1ɺH5|SZ1'SATIIHUDSHAHt3H@ Ht*8tcILb11-H5S>ZMt-H11IATLB1ɿH5RZXZL[]A\@H@u8u Mt@IATAH5 UHSH`dH%(HD$X1H Ht$0H\$8HD$8Hƛ HD$@Hq% HD$HH,n H$H+HD$H HD$HG% HD$PHD$HD$ fDH3HHt4H JuHT$XdH+%(uHH`[]A\f.H\$H5m fH3HHtHIufDDVQfDSfIH1LH@dH%(HD$81H)D$H|$1)$)D$ HtFH@ E1HtuAHtH@HD$8dH+%(uH@D[f.E1PfDSfIH1LH@dH%(HD$81H)D$H|$1)$)D$ [HtFH@ E1HtuAHtH@HHD$8dH+%(uH@D[fE1PfDSfIH1LH@dH%(HD$81H)D$H|$1)$)D$ HtFH@ E1Ht8tHD$8dH+%(u*H@D[@H@AHfE1vOfDAUATUSHHL&AHH1Mt LIHLHIHC(Hs AD$(HtH蛟ID$ HtYHsHtH{ID$Ht9Et HsHtHVID$HtHL[]A\A]fDL1ɺ1H5NE1UŐ1E1LZ H5NUfDL! 1H5|NUjfDAUATUHSHIHt>1L- HtR@HDHH@H9uH3LL螰H9t'HL1ɺ1H5MUHL[]A\A]@ATH=UHtHHHHIHHxHHǀ1HH)HID$`Md$=ID$hID$`ID$pID$xID$pI,$gDID$HODID$HHL]A\fD1LH mH5J THHL]A\1E1mL H5JSHL]A\DL |H5VJSI<$E1iHL]A\fDL  H5JUSI|$ DI<$E1f.HHHIILPI9t+Hz誖I9tLLL蚖LLH˳HB`HJ`H9uqfHH9t`L;HuHzI9uISHIKHH9tHfL;PtHH9uH9t1HH9u{HIAXIqX1H9tfHH9uuzff.SHOHH DK4DC0H HHDHH 1x H[H f1Lz1ɺH5HQHC[AWAVAUATUHSHHLHdH%(H$1DHD`D@H}DHމsBHHt L`MuZMI-HLEI1M|$M)MtPT$ MLLItuD$ LH-PHIPH5G`1Lw Y^H$dH+%(HĨL[]A\A]A^A_fLl$1ҹHLIHHI)LBD$oCLD`D?H}DLOAL=(PHHt7L`Mt.LAVMPL mL=OL-2QLBLHHIIAu}N,#LBLD`D:?H}DL@HHtIL`Mt@LPHML P{1H5FAXZIL 1E1H5EAmƄ$GfDHAVAUATIUHSH]@AEt^1HvVL5PLALLHI(@t2LLH@A1EuHJ4+LL)?[]A\A]A^ff.AWfAVAUATUSH$PDD$@L$HD$ dH%(H$1)$)$)$HH:IHDLg|It$H_F1ۋ$@A$I$D$ Mt$xfAD$pH$dH+%(HL[]A\A]A^A_HHT$AIHhHT$HE1ML$LLcHHHHHxحHEHHpxD$@DI쉅At$I\$HD$XHD$`H\$hHVAL$$HD$`M|$AT$4At$0HL$xH|$XPAAWL$|A]ZAD$4I1ɺCL-BL PAD$0LP1LA[]HHEAD$0E8HE0AD$4E4^LHD$@T:DT$@ENH\$`H\$H|H=L>D HD$(ED$ Hl$0L$L$Ld$LLt$8D$D1Ll$ A@HL$DHlHL$I@HL1I LAI~A HEH LH H H$1@H‰ Љ1H9uL 1к;HH&HxHD$AD;(5Hl$0Ld$Lt$8Ll$ H)RH|$XHRD$@f.L1ɺ1LE1Jf.La H5@1E1IWHIfL-?L 15LIL1ɺ1H5?H]fL IDŽ$fDIٹLL G1HH|$XHFAPL[]A\ff.AWAVAUATUHSHHw401HLpIM0MnM#H5qL7L=u>tYH9HH55AUIL 1E1AY^LFHD[]A\A]A^A_MvHLAŅuRL1ɺ1H54=fDLt1ɺ1H5|4E1=뀐HL-=qAVL PLG 1H5<4AXAZ3@L=a=L- DAVAAUAATAUSHNHtiDp0Hx`H@8D`40H4HE`HDHOAąt[AHD[D]A\A]A^fE11LW1ɺH5a3<[D]A\A]A^Iٹ1Lj H5&3`<9|AąUL1ɺ1H52,<JHH9t H@SH;L [IH5211[ff.HHOE1H‰UUUUUUUU33333333׉HH!H %UUUUUUUUЉ%33333333‰%Љ%HHExH9+x4[1]A\A]A^DAwOD`@(=H9XtL fL`HP CHH-*1EhL$H3XLwZ1ɺ1H31DHH-`*E1hLĔH|3Y^L1f.HEhH-*Lv1H,3_1AXLJfDHEh]&ff.fAWAVIAUATIUSHHdH%(H$1Ht>HuBH;I<$HIHIٹAL FfHHH%,D$%=`IMLd H5(1E12+;1E1L H5(1H$dH+%(sHĨD[]A\A]A^A_@:H?LLLmAŅLjHHt*I<$LLAŅAuDL1ɺXH5'1E131FfDIHL# L1ɺE1H5'0L|1ɺ[1H5'0fHT$(I<$E1E1LHHH  L1ɺTIH(fAWIAVAUATAUSHD_H_dH%(H$1Et-Hu/1ɺE1LH5&/BHeHu]IٹL` H5u&A/H$dH+%(aHĨD[]A\A]A^A_DLPIH@ H$dH+%(HĨLL[]A\A]A^A_wALJL9tDLH/HLM AVIrH5%1AYAZADH\$LHAƅuaL=1ɺl1H5E%.f.L 1ɺ1H5%E1K.fDLt$IXIHMHI9IVH9A>L95D$HT$@jL%4 L- L9A{ACIcL>L\$Lt$PH @L1`L\$AS(Aw4LL\$A0 L\$=A{HA-w %L\$8#H-#1ɺP1LHL1ɺ1HE1,<DIKMC Lt$PL@L1L\$L\$7fL\$AKLt$PHp @L1lL\$fL\$AKLt$PH1 fAKECLt$P1H @LL\$L\$fDL\$Lt$PH' fA{tYML9=ALJA>H-"Ln 10H+HLL\$L\$A8Lt$IK I9uLHL$Ho+:HL$L IH5 "1QAVE1XZfD1L9LL%!+H)HSAVIz1L H5!E1A_AX7H-*L-NHB IDL% LE1{HLs AUISH5?!1ATH H-n*L- H L%uML%H-B*L- HL- H L%t _HLAkLHL UH- I?H1Y^1L\$HL GEK)L\$H1IEKL! {)Ll 11KH])ML1ɺ1H56)!ff.AWAVAUIATIUS1IHH|$dH%(H$1HGHD$,HD$HD$`HD$DMtcM?L9|$tiMtdMwMt^IFAvH$H<$11L$H50j(MuDHD$LxHL9|$uE1HH-MtbM6L9t$thMtcM~MtZAuAGIH11LH'MuHD$LpHL9t$uH$dH+%(D$,HĨ[]A\A]A^A_H=H<$LLIHB`H`H9uDHH9L9puHAv4A~01jHL$(E1E1^ZYD\$`ENDT$dE@AvDL$,E(IT$|LL$0t$xH<$DzfoD$0foL$@foT$PAFAN(AV8@I~HL'1ɺ1H5/i&@HLLR IIWHIOHHpH9HH;pHH9uH91HH9uLLLL{1ɺH5%D$,fInXIFXH9QL|$ H5DHuBL'1ɺ1H5/i%HmH9tHL}AGIuH=LL>tM9tEEuL|$ VfDL|$ D$|H5L P$P1LL$$Y^D$,EFD$,EtA~ uoLH$pL IH5@1AL 1ɺ1H5M$D$,xLLLD$,rL1ɺH5$4AWAVAUIATUS1HH|$HT$L$$dH%(H$1HGHD$ HD$@Ht[HH9\$taHt\HkHtSuLetxMO11LH5M#HuHD$HXHH9\$uH$dH+%(ED$ Hĸ[]A\A]A^A_H=}IHT$LAHL$@Hu4}0jE1E1ZYD$@ D$PD|$$EtH5MmLHHEt$\|$XDEVML W'H516"Y^D$ H}HL1ɺ 1H5!L@LMYM~XIFXL90HL$pHl$8Lt$HH\$0LILd$(6HuHL71ɺ1H5?y!HH9LcE\$I|$EuH=LLHtHAt$4E1E1A|$0jLQAYAZDD$pEt$tH\$0MHMLd$0PAF4L H5PAF0P1 H jHl$8Ld$(H\$0HtHT$LHgHEDEpLT$\t$XDH`T$DtD$Ht[`HHtHHЅFHEHUHHMHHpH9ZHH;pFHH9uH951HH9uD$$HT$LHHL:1ɺ`H5?~D$ A=H BHMPL 1VH5W-Lɮ11/H5H D$ Zf.D$\ML KPD$`PLi1ɺWH5nL<1ɺH5AD$ CLd$(H\$0L1ɺH5I|$$D$\ML <PD$`Ptt$\|$XHE t$\|$X0t$\|$XH6 x_f.D1ffDUSHHdH%(H$1HxmD$A%=@u'H$dH+%(HĨD[]Iٹ!1L: H5 E1H-8;IٿIHdHHDHH $ APH5Q LQP1E1H ?)fH6H?!HHpHHx fHHHB@8AVAUATAUSLr(1Li(IHPHx IDj(Hp `t*HHH9t_@t?H9[]A\A]A^t7@tGD[]A\A]A^fH9[]A\A]A^@HI9i1[]A\A]A^fD1DH֋Q0AWAVAUATIUSH8H^PH|$Ht$L$$DD$ HWH1IHx7I9LBEHH@HLHxPuHD$HhpH}t0H} HI9LBH H}uHH5Hl$E1L5JHD$If.E=Ht$H^pH{uUDH H{A;uL{HMLDL<M9A9t"L1ɺG1LAL ML 1LH1AL 1ɺILDHH PL 1AQZYt$$Ltc;t[H[L\$(H HI1IMLHb PAD$D)t$(L= P1L\$HALIH D$ u}HHT$HHHVHEL( PL1RRQ1uHUAMH0AEH,@IHHl$H}PHH8[]A\A]A^A_fMHֽʁt/w\Hb t!He@tH^H4( HEH5H' H c HDH5S$@H tHH' HELL$(L 11ALLL$(HL= HD$HhpH}ff.@AWAVAAUIATUSHH-0T$ H}PHE1E1DH I9LBAGH<@IHHHPuIm`H}Pt;H1E1@HO I9LBCH<@HHHHPuM9MB\$ DLHLAL11jH5 GADLH5/HL[]A\A]A^A_IfE1IAVAAUAATU0SHH?IHlfHN/@@ EHDmAl$HH‹rB Et$, AD$AD$At$(?HCpHxuvLJ1H-FL HH11LdH;LE1[L]A\A]A^H Hxt;uA ID$ HS@HC@El$(AuCHHCHI$ID$HCHL LLcH[]A\A]A^fDHS`HteI$IT$L`LLc@[]A\A]A^fD1L H5E[L]A\A]A^H: AWIAVIAUATIUHSHܴHfH@HI9ttL)LHuLI袴HteL9LLHHFdHI>HKt}IFL3HCIFHI^H[]A\A]A^A_DH uHC1L 0 H5CH1[]A\A]A^A_DAWAVIAUATIULSLH(LnH$L$ dH%(HD$1HD$M}Mu^fDM}IMtKL[H9uHHLuHD$dH+%(+H(L[]A\A]A^A_fDA$H$HLPHDl$ ILL$D;1LIDH0A҉Ņ~D;L|$yDA$KDmL LHIF`HH LDʃtGH> PL 1H5pBAD;XZuE1DMT$:HH58B9 PLQ 1AD;Y^>p ATIUHSHH>{1LHHHu.uHHHADHuI$1H9E[HD]A\fDUHSHHHHtHH[]DH= T$ T$ HHCHu1LE H5KAH1[]DAWIAVAUIATUH,SHHu HI,LL5$ L9w<\tHH9ts<"uI}L9vHLL)AąII}LvAąuL 1H5@JI9rAHD[]A\A]A^A_I}HLL)AąuLX 1H5@L1 1H5?fAWAVAUATL%T UHLSHHH?t4HEHn(H,uHS`@H;H@HHt1Qu=#1E1L H5b?%HD[]A\A]A^A_H;LtH;H5^J tHMHQ(taH;Ht H@8LADžL 1-H5>Uf.Ht H@8.H;LNADžHHuHt H@81HADžHHt H@8H;LADž#AfHu1HADžLS1ɺ21H5= kL 1nH5=k AfDL1ɺy1H5{=> fHuA(>HK HDH5ADžHE8LHU HRHRLlAEHD$H)IE1lIUAuHHuADžH;LADžsH;IL9t$H5"IOADžH;L4ADžyLz 1UH5A< H;LADžL5 15H5; L 1}H5; kH;H5|ADžc1L H5;N $HE@(^>L 1?H5N; HMLT 1]H5; Lu1ɺZ1H5: L 1OH5: cAW11L AVAUATUH-:SHHHJ 11L H, 11L H 11L H 11L H 11L? H 11Li H 11L Hx 11L HZ 1L 1H< 1L1H HBL 1ɺ1HE11L 1ɺHHDH$IE$MnI}Ht!E1I}IM|HuM9MBEF I EuLd$L<$L- H; MwMΜII>M9wtH;H5tM&L!H;LHuH1L Lp 1ɺ1HHL% 11LT H1LL 1ɺHfH L fDHCHH1HPM1)L Y^MuLʾ1ɺ1HHL% 11L( HH* L 9 DHCHHMP11HL XZMuHHL31[]A\1A]A^A_%cH;LS(HLAHPHH0L2LH @8AH@0H7t3H t!HLS@tH HLHDHLi 1PHAw1I AVDL$(AH;LH ޹A?.L>1ɺ1HuH! tH  HHDhLE H%됹H1L /ff.fAWAVAUATUHSHHLn8 >u:AL 1|H54HD[]A\A]A^A_úH5I H|u@L%qL 1H54AHE0E1E81LH+L%$t1H5 HL%tH5H HL%pHEHU0L%L(LHHE0E8M@HC(L=3DH Et@HCHLH LX @ Q1DH1AHC(L%`_AXHSHx(Dr tJHx8tCHHAN1LPEN1L AHCL%H DqDp Y^LH1ɺAUE L L1AHCLHA@ XZAWAVAUATUSHH $HH $H(Dg(dH%(H$ 1HHAHFHPH,U@H@HLdLUHPH<Lu H5>21E1H$ dH+%(H( D[]A\A]A^A_H;H5 AąDc(Au'H;H5 AąDc(@AHED@Dp(A@HcALl$MHAAAt AAM9LAfDHW`Ll$L LHsH;1Aą L 1H50A`>Ll$MHQLMD1H= LD$5D$H;IcL;>L 1H5K0fDE1M9LHuH;1AąC(tE1HLDHHPuH;1LAąL 1H5/QP@Ll$MHLMD1H- LD$D$H;IcLDc(@L9 1H5/fDHDD$ H4$7H4$DD$ HINVLa 1H5.k^fDHDD$ H4$H4$DD$ HIL fDLl H55.LA 1H5.fDH;H5 E1Ll$L 1H5-wjfL 1H5-K>fDH;H5 ,fHDD$ H4$H4$DD$ HIDLA 1H5-QAUATUSHdH%(H$1?u/H$dH+%("HĨ[]A\A]DHIuD$%=@tL- M11LE .L!L HHH/H{/HH}tھHy8 HuLI1ɺ=LH1L#1ɺfLk1@L3xHWf 8tbH-t3}HIIHH ϤHDHPAPLQPL1H AL*sL^1ɺMH}HIIHBH FHDH@APLQPrLU L125ATUSHHH@HHtSx.HPu ztx.tHE1u=D[]A\z.uzuHlHuHAtiH-8Iٺz1PHALʉPH5 1XDZ[]A\"H-KE18Q1IٺqPHVAH5 PLx1Y^5AWAVAUATUHSHhH<$Ht$ HL$DD$HH/HL}HD$L97E1fM?EAL9uH$H8HD$HrEAODH4@HD$(HHH?IL9Dt$0E11Dl$8EIHDDI|$AH@LtI>3M$$IFHM9uDt$0Dl$8HDHD$0HD$HЋT$HHHD$8AFHHD$PL|H$LH8HHHT$8HL$(IE1Dl$LMLt$HDHl$@HD$XLxHHPHD$0H@LdDIuAmHtIUHqAoEIAGAmM9uYHD$ADl$LB Hl$@HD$HXHD$HL$XHHHD$ AHXH\$HX HHt$LDHIVfL}H2 HD$HD$L9H$H8͖HD$HOHT$HL$ HAHHAHBHQ HhD[]A\A]A^A_LuL9I~:Hp!HH$H8WHHHSIvHAL,I]HD$I]H\$ IEIEHkH(LhHC fH$Ht$PH8HT$HBHBHt$(H HOHD$Ht$0HUHHHD$8HHAHAD)HL1 @o HHHH9u1fDL ) 11L9 E1H5'% f.Ht$(H DHfL L 1KH5$H$Ht$E1H8L L 1H5$O1PeL E L H5T$놃+1L  L H5($Wff.HwHtHW H9tfHw HG@( tL{81ɺ1H5#%AVAUIATUHSHH?输lLm HHcUIHH;脓IH} H iLZxLLL[]A\A]A^H;LLd 1H5"[1]A\A]A^DLLH5[]A\A]A^H;L赦yL fUHHHtH8$HHxHtHHtH}H]ff.ATUHSLMt3M`It$Ht% $@c1[]A\ @t*uHH:AEt1HtLc|H]~  \fTf/w1HtHC1\fTf/gHHAEDI<$H[]A\XHUH91HHCH9H HUH9rH;M1I;$HEH9!E~  f(f/\fT)q f/bA$f/w\fTf/Bf/1\1fTf/ef/wYf(~  \fTf/w7A$\fTf/\E1fTf/@Mf/\~  fTf/vyf]f/Mf/I\~ - 5 fTf/'1HHSf/wf(\fTf/]f/\1fTf/fDH HUH9rH;M1HHKH H91H;M@f(~ d l \fTf/3Df/ĸA9 f/*f.HUH9t1I;$ 1H;@7E1@HЁUUUU%UUUUЉ%33333333‰%Љ%IH9sLfDAWAVIAUIATUHSH(dH%(HD$F<thЃdu1E1L H5HD$dH+%( H(D[]A\A]A^A_DL~H^I9LLLIAtM?I9ufEtEAEI]AI9uHL9tL}HCI9ux,LS H uIN`PHHRHLDMDH(AWA~AA_LLLLSnfDE1`L~H^L9LLLAAąM?I9ufASA PA@qIGAHHD$H x IHL$M@T$$衞$T$f/f(\fT T f/=DAA.IGMHHLLT$HL    wIHL$MLL$L$͝L$LL$41M9AIGH0 `ML} H51a@H21APH5qE1L8 *Y^IGLH8AG @EQI:KIGMHHLLT$HL `1IHL$M LL$L$bL$LL$1M9@AL 1E1$H5]%HO1APH59L XZV IHL$M L\$L$蒛L$L\$1M9`IHL$ML\$L$(L$L\$1M9tf. |M91M9!I OIHL$M LL$L$襚L$LL$ 1M9E1+A `Df(f/~} \fTw { f/f/\ [ fTf/pIHL$M@L$$0$L$f/f(\fT s f/\@IHL$ML\$L$JL$L\$1M9 t `M91M9!mIHL$M L\$L$՘EL$L\$1M9! T`'1M9L:L-U1M9 ML S`IHL$M@L$$$L$Zf/P\  fT f/2 ` AIHL$ML\$L${L$L\$1M9D C\ fTx 1f/.  IHL$M@L$$$L$Sf/f(\fT )@IHL$M L\$L$薖L$L\$1M9MvL̾ M9M9 IHL$ML\$L$'L$L\$1M9sML IHL$M@L$$̕<$L$f/'f/~ w*f(~ \fTf(% f/f(f/\fT<1M9IHL$M L\$L$(L$L\$1M9t\ N fT6 1f/RIHL$M@T$$返$T$$f/\ fT f/_IHL$MLL$L$]L$LL$1M9ff.@HG(u LGPLOPM9tHG@H@H9t.fDP(uс t P(HH9uM9tI@IHH9t>fDHPHt':t"HpV(tV(f.HH9uMH1 Lt H5Z1HAWAVIAUAATIUHSHHtZH H]HtCDX uM<$Mt<Et DA#D$tL LHHHXt,IM<$Mu1MtI.H[]A\A]A^A_fDMtHIAD$H[]A\A]A^A_fAWAVAUATUSHH(HHHnEHCPL{PHD$I9C(D$D$HHdHFC( UAvE1 HCPH$I9: HCXHt Hx8< HD$H$HHD$H$L|$IHx8I?X EH$HXHhL+H91L%1L. I?1H5̔ IHLHtH@a4aAG(@IELL9IHC@)utI?EgIw01蔪uLLٲ .H5 jf.HE1H@0@8H(D[]A\A]A^A_fD] EuL%N 11ɺqLL'HE F0tHSPH9SPHnH8L1L \f.C( Hk@Lk@L9hE)BDE,L%gEuLc`H;ɨ C(tHUH;HRHIIT$I0HID1  Hs0H;1  LcPfDM9teMt$MtIID$I9t?HLHHtH@NIIFHBHM9<$MM9uH;H5 z HLhLMH5 HPHH0L LH 1ɺH@0@81AHmI9HsHtH;KHC@HCL{XL{PI9tPPHI9uK(HHtN0AwfHs0H;1貧uM$$fDHGPLPHD$I9tC(D$LHt$A%AHL9L|$AH$fL}LeM9uYfDI?IO;A~AEt(I_CH<@H$HHx`H;C~CM?M9BEtIG@) t HM(@LLOH;+HH9C){,HuIF`SAN(HRHHHPH0HDЃIiI>1LܠuLL& D4$H5H|$HH@0@8LL|$C(@HL)1L H5FL%leL 1H5MH$HH@HBH%H;t:HH0L U1ɺ1LLL%LCa1ɺL8fDH=Iv0I>1juLL D4$1H5r:DH-[1ɺ1L`H L`11HE1L%L 1ELLd H5LD4$H;H5 uL H5J$L6 H5\D $$L H5-D $H 1LL{XL{PHLH5HPHH0H*HIH 1ɺH@0@81|H;H豃H|$wL H5w?LLï IH5QLc H5$Lp 1H5]LL D4$H5LL D4$1H5bHD$H1L H5Z"HD$f@LLY H5'HsHt H;C(HS@HK@HCL{XL{PH9trrHH9uC(!LL >H5uHCPAWL AVAUATUSH8T$(H $Ht$Ht-D$(HH<$D$/uCt?L 1H5'1H8[]A\A]A^A_fE)uH}@mIHf@@ @0H}InE)OIFAF0IFH]@HD$IF HE@HD$ H9CH6H5{ L @HT$IN, MeLuM~8I_H5K L'LLExHuLHAUPzI~HD$IIF IGIF L8HM~ H;\$ &H}(kIHfH@ @S,&Le`H|$HXHC Ld$PHthKL IIO, AMHADDm8H}ILlkHL1HfIF(~DHEbCH|$H@HLdM1L* H5H $1HtAV0H}L$~$HHtfHpHt]HT$H.uLIV8AF0Ht5HBLExLHHu@H@HHPPIF8H@@)tE(@t7D$(t/H}PHEPIHEXIFHEXL0LuXE(H<$HtAF0|$/L f.La 1H5kfDCH|$L H5rH@HLL1&yIF(L) 1H50FH8H[]A\A]A^A_X3AWAVAUATUSHXH|$Hl$ HHHL$H1LD$dH%(HD$H1JHD$Lp L葻L-bL`I}PL1B@LLLuK<'Ht/CH<@HHLHPLHLuHD$AHD$HD$HdH+%(HXD[]A\A]A^A_ÐALYW11%H5fHD$Lx`IPH@h1HD$1>DLLLʿuK|%H)t.CH@HHI|Pt?HL$HL,LuHD$AHD$f.E1sAWAVIAUATIUSHxT$ dH%(HD$h1DL<,u!AFI<,tLAFIt<,uLH)H$H$HL$8HLLD$: H|*H'H'LȹdHHHHHLȹ'IHHIIe I<B H<*A$H|$D$D$HHuHFHtDB uHIDBH~A+AA- $Ht$ L\$PL$@H|$0迲H|$0L$@H$`L\$PI>:#HH)H)HLdHHIH<IMiHHH)IEDHtH|$H HFHtDB uA>fo$H$fo$fo$H$P)$ )$0)$@xH HcH>H,$H$1LHuN+IHH$ HH H$H0H$HubMt*IIGkI$IG ID$IG L Mg MH$dH+%(>HL[]A\A]A^A_MIIGIW I$IT$IG L H$Mg HD$fDIHDŽ$HDŽ$cA]AE1LHl$H-r苢Lq11%HML &H1A]L\$L H1Mٹ̹H1L H$H\$E1HH$L$HLH(HH,$H$1LH)IHtHm LH߁HHH$H$H0IL\$LU HDŽ$H-1H̸L\$fI(H8XIHXfH@@HH@@HIG IGfDHaHD$(@A]AE1LHl$H-l腠Lo112HML 3AA~ ABp L$ME1E1#H$HD$8fDIL1 H5DD$ A4LHl$جML TLL~ 1H5M`E\MHDŽ$ HDŽ$`M4AE<"}L<'rH$ H$`DDT$PA HDT$PHIT$HHl$Pl$@Ll$XEHD$`"9*IT$(I HA$tAtL$ L$`1L+$ LLoHtIH$ L\$`EH$H$`H$D$ %D$At|$ %A EljD$D T$D$ jA]LHl$ML ZH-1HVL\$\@L) 1H5`#sDD$0AEEW <"<'11A H$L$ H$RIHD$ E1E1D$DL$It$H|$HfDICItDB uH$DL$|l$xL-`LH$HD$(H$HD$ EuMn`IV@fIF@)$H9u@HH9D;J,uJ9uHIHIDHD$D$#B((ILD$@HT$0H8TIHfH@IH8SIH fMHT$0IE.A$LD$@ILL$HLD$@H8HT$0SHT$0LD$@HLL$H fIAD$IUAEA$M\$uM[L$` t/IL$`LH0AӅ( L$`D$HT$(H+T$ %AV=Ht$L H-1HZ_AXILH8fLA1ɺu1H'wILc H59L1H$AHDHD$8Hl$LoA1ɺ&H-1HL\$H19L\$Ly L\$HDŽ$L\$L A11oHOL\$UDL$`L$ L+$ L\$IppDʹLLD$WLD$HHJH@HADA FLL$L5 H-1HDEHl$PLl$XL$v|$IUA}FI}DD$%=D$IUE1AE\LHl$莥MLג =H|$ HT$(L\$0HT$(H9HrHFHD$(IH8 PHMLD$(Ht$ HBLʫDL$L\$0IAA#A ) A@IUMAA$tACHBILH8bcI(H8^OIHt6H$fMd$AD$ID$ Ml$H0M$$AD$H-1HL LD>11yHAL IEMLA$,ISH@HAI A MIEIHA$ISH@HH|$8 H|$H0HDŽ$HDŽ$ NIH HfLH@H@@ H$`HL$HD$6AE<" 1<' H$ L$A LHLØHH$ H|$HLHD$H$hL\$ Hl$M1MH-)c L<HݬHD$(L\$HXH|$HLL\$L$`L\$L\$IٹL H1L\$HDŽ$H$H$LDT$tDT$HI 8%RH|$8H$ L1DT$0H$`HL\$FH|$8L\$HDT$0H5L$`A@ D T$ ADT$L$MIH-7LL$L LH@HEHeLHH-L 1HAHzHT$HT$HHHt$ HHT$>HT$IH$H$DMe_HI$IEH8LL$L H-1H1HAYAZHl$L1ɺ L%H-1HƕL\$Lh L\${LȿdHH1II L\$@MIH-~ L\$Ly HUHD$(L\$HXsML\$@I$(8$($$:Ճ$$$ :ك$ |$PL$`AD$(g I$AD$(I91IE1MmAM9uDHDD$PHT$@H5|$0*H<L\$0Ht$Ht$L\$0HHT$@DD$PH1 HHL9uH wL\$0DD$(H|$M,$L\$01H|$DD$(Ml$I<$H%IL$HL*HJIL$HIT$A9wL\$輆L\$_L\$@MILx L\$H-HWMSL t$H7Hl$L Ly I*1E1IA$0 $0Hc$0D$,$4HփHpD;L}AA$,o1IHNHt$ L\$`HLL$XDD$PHL$@興HL$@H$`IDD$PLL$XHL\$`H)H)HD$0HЀ>:HD$0trHL)IuHuA1LcШLпdHHHA)Hl$L1ɺ Lo!HFHt$ L\$hHLT$`LL$XDD$PHD$@訇1DD$PH$`HLL$XLT$`HL\$hHH+T$@H)HD$0LпHHHGAz5L 1ɺz{MUL t$5H~Ht$ L\$PL$@LD$0LD$0L$@HH$`L\$PHX*LL$Ly HƒfHH H*XcMHl$M܃L5u MHl$M܃LLu fAWIAVL5rAUIATUHSHHdH%(HD$11HHLH$IHH3HLxu\Mt*IIGI$IG ID$IG L Mg MHD$dH+%(HL[]A\A]A^A_Mt3IIGIW I$H,$IT$IG L Mg 4I(H8l/IHuL|L+ 1ɺ1Lq|L5L 1ɺKLI|L5rL1m 1NLA{pff.USHHHoHH}HGH9ttvE1wWE0<HE(HUHMHQH HUHtM HǂJ(Ht@ H{H/AHD[]ÐLm 1H5K{HE1D[]fDH}8tAHUHH5$3LB B HDH1J 1ɺVH5*z^_HE(Hx8tLHx(tEHUHH5CC LB B HDH1J 1ɺVH5תzHE(ZYe0AULoATUHSHHGHI9u=]DHxHtڛAąH7AątPHHL9t%HHx(u@ HHL9ufEvuHA[D]A\A]Ð1L 1ɺH5 yHD[]A\A]1LZ 1ɺH5۩yHD[]A\A]ËE L%u"L1ɺq1LdyE LA 1ɺ1LBym 4fHHu2HHAIHtP-u߄tHH-tHff.G<wH€ HcH>DHD11L o H5xUH@DfFf.Rf.Sf.Af.Uf.AWAVAUATUSHXH|$D$$HD$HxH|$HD$ HD$LXMcD$MKAM/E1IIH1LyM1MoAME1ImH1LeMtmE1I|$HtJDD$LT$Ht$DHL$8DT$@LL$0L\$(DD$LT$Ht$DHL$8DT$@LL$0L\$(Md$AMuA@HmHvMmAMOAMDM%HIHMIAMAM[DT$MD$H|$D$ HH|$HkD$ H|$D$$HH|$H%D$$HX[]A\A]A^A_AWAVAUATUSHX?H|$ D$HD$ H@HD$H8D$HD$LPMA:PD$MBM{A8&E1IHHE9E1HYH;1LcMA<$E1Mt$MA>E1InHt{}t1H}HtQD\$LDL$HHL$@T$iAEMd$MtA<$2ADH[Ht ;AHIHt 9AEM@MtA8AD\$MRMtA:eD$|$|$HD$H@HD$Ht8D$|$|$HD$ H@HD$ Ht8D$D$HX[]A\A]A^A_AAA,A;D$KD$gD$@AWIAVAUATIUSH(A:~MJM=A9FMAMA8IHH9LqMA>InH}iL}MA?1MoMtjA}I]HtM;H{Ht2LLT$HL$LD$L $LT$HL$LD$L $@H[HuMmMuMMvHmHRMvM.HIH M@MMIMMRMH([]A\A]A^A_@A$MmPA$C M rA$MPA$AE MVA$HmPA$AG H;A$MvPA$E M[(A$HIPA$AF H$A$M@PA$A MA$MIPA$A@ MA$MRPA$AA M}A$PA$AB H([]A\A]A^A_fDL{ rE1MMH9t:HD:uHIAH9tuAIAt!A uICD 1ff.fL ez HoMH9tED:uHIAH9t;uH wIIcL>LfI\$IfDHI9tHHu1H[]A\A]ÐHNHEHH[1]1A\A]DH^11HH UtHsffHv[H^E13Lct#DHHLwAD9+wH[]A\A]@H^ tLcE1DHHL/AD9+wfH^tLE1DHHLAD9+wx@GE1;G sHWpAwH DfHHT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1H$IIHD$HD$ $D$0HD$^HD$dH+%(uHmdff.fATUHSLgHMtID$I+$H9}?H7]IHt9H@LI$Il$HCID$LcL[]A\f.HGILa 1!H5Ro @kff.ATUHSH9tCIH^1H0fD0HHHHPI9tH HDNu[1]A\1[HU]A\ff.fAWAVAUATIUSH(H?LD$H9LL$H|$IHI6^H|$HIHfDHH9t HDB tH9toLHAADŽt?H9tIU @HH9t HDB uI$H(D[]A\A]A^A_fDHT$H|$H57n 1PfDHT$H|$1E1H5m -ff.ATUHSD&HHvAtIHuPHuHtHHcCHSHKH,AuHcC HS(HK H,[]A\@HtH}t HH t XH5m H=_ Yff.SHHHL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1H$IIHD$HD$ HH$D$0HD$[x'HcH9ںCHT$dH+%(uH[ø`AWAVAUIATIUSHH8H|$dH%(HD$(1YHHD$IƽL|$8f.LZCIHcHCYIHD$Ao$HMMID$HLAIGZ9s|$-HD$L0CHT$(dH+%(u=H8[]A\A]A^A_L _HL$LHHt+Z$Z_HHT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1H$H$HD$HD$ D$0HD$(HT$dH+%(uH^ff.HGuoHt]HH\u"t\u߈QHqHyu;HHH~t$\uN"t\uHԐ@LGHE1E1Ʉu,TfD<:udMɸ:LLDɈHLGt*<\uG<:t<\t<@t\LfDHHtLHtLD<@uMtLIʸ@AUIATAUHSHH(dH%(HD$1HD$HtH;XHMHHDHunEtu5fɸAUuV2w"H l HcH>}t1HT$dH+%(.H([]A\A]fHt$H`H9l$t1 HD$7^L$HxLfH*\fT7Z fHl$5Z f8EwHU'HHfHH H*XfAufHtHH+Y f(fTY f/HDHƤ~@@B뱐fʚ;fHd @HqHaVfDFfD@6fDH!HfH*Y p f/s H,\H,H?D}}ufDZUwUfSHdH%(HD$1FF F0Ht^HH5Vf H WHt'K8HT$dH+%(H[]H5!f HVHtO@wfDHvID$HIt$LHID$HH0L|$Lt$I|$ALLtLA<$!ID$8HPIT$HPHPIT$HPID$AEIt$I|$E1LLA<$%Lt$HHL|$I^H9fL`IH@@@ @0IWHXoAoZA_ob Ag oj0Ao0HR@IW@IVo2A6ozA~oR AV oZ0A^0HR@IV@fDL|$HHH\$MwHfL`IH@@@ @0IWLpo AoRAWoZ A_ ob0Ag0HR@IW@HSo*+orsoz { oJ0K0HR@HS@aD1ɺ0E1L}H5D LL\1ɺD1H5qD E1LfD1ɺ3E1LH5;D mL1ɺAE1LH5 D =LID$8HPIT$HPHPIT$HPID$jfDL1ɺ1H5C E1K:YDfATUSH_HtHCHH]H[Hu[LSC ]H5`O 1A\%JKf.L#H][]A\@AUATUSHHI IHVHHt~fHHHLL@H5O @1W;PH5O L\CH5O LECMH+H[]A\A]fDLB 1H5[J1H[]A\A]fDLiB DMf.Eƒ ЈEpfH5'O LBu MK@HL1MLB 0H5I1MfDAWAVAUATUHSH8H$dH%(HD$(1H>IHHx O@Hu H4@Ht&L`HT$$1H5: L9AŃL%=1ɺn1LLHL N H1ULA LHXZH$E1HHD$(dH+%(H8D[]A\A]A^A_þ Lt?HD$H]HLIHH@@fHI)@@ @07;LLIID$L9LHFHT$EHHHT$HD$HHL`C LIG(>HD$HHcT$$H+D$H9 D$$HcLHT$:HT$LHD$HrHHT$LT$LHL9IGxCH|$IOIWIG0D$$H5zL HAG 17IALJA L=HHuLy1ɺL%1LFL ? |LD1ɺiL%ޒ1LFL L1ɺrIG0L1ɺL%1L:FL > HLL5? 1U FYL^L@VL1ɺIG(L1ɺvLϾ HT$LL$L-E1L:ZDL5 15H5:E1eH4@HHID$HT$4IcH j@ E1HL$L4;uZfHcD$,AID9|$4vEID$DHt$MLHRH1HJH*tL1ɺKy1IT$MLH5> L|*tL1ɺOB@HcD$,LH5? M<HD$0HD$HL16*t/LM1ɺSfDL\? DHcD$,1INjD$4t-IL$T$A<H4@L4sT$A9T$4wӋD$0Mt-Pu 7Lxr- LT$&0T$HuL1ɺZXL H5> f*HT$LH5> AIG ELD1L?)AtLS1ɺbHcD$,Iǃ|$0 LDL$/IHILLL)HD$|+Ht$HHD$DL$HHHT$HD$LDL$HH9HGC4D|$0DL$ID$ HAvH5DL$0DL$t}D$4AD$H$L ~Lh1ɺmLHDL$DL$HID$ uL1 hL1 qID$ h/AHE|$(Ik ID$0HE1H= A|$(DL$HD$u?HcD$,AIAD$(D9vjDHt$MLH@ID$0DL$D\$HHHHP1V'D\$DL$tLc1ɺL< z1ۉIT$0DL$A<H @H,蕽A9\$(DL$EwATUSGH( H{)IuoHMC+&fH;HSHfH@@@@ L`I@0HDL0 1=H5n- 5E1L[]A\H/HHIHH@@fH@@ @0LIE1HtƒHuAEt,IDxHt1@Hu9BHsA6@DAWZ'H-/8$I1PHt LPH5^* 1XZxfD'H-;uމ\$Hl$DAL$ ID$$t"I{HtLBM[MtAuދD$$AC LHID$HAt$ LHID$(HHLE1`ET$ECHl$HH1SI|$0D8E|$ HC0DH,HHHHH1 I|$0D8E|$ HC8DH,HrHHH1HD8HAD$AHK@A9IT$E|$ DI|$0HDH,HH]HHC0L1ɺmH-;, 1H'Ls11H'L@HC8LD1ɺoHC@L$1ɺq HYD8E|$ HC0DH,Hs HzD8E|$ HC8DH,H@ HHdD8@AE;|$YHl$Lt$AD$ Ml$0LXHfH@E1At$ I|$0LhI$Hz-I$PHRLHl$MI1fL1HHKL@II9A_ I0DAAAILHtfQHuMLc1ɺKD@LH-,* 1H%Ld1ɺ1H%=DHHtI\$Hl$DIELT! (HT${HT$HtL´1ɺj1H5+ %L1IDŽ$HDL|1ɺ|1H5 $(Hl$Hl$E1L- AD$Lt$f.IT$DH‹LsHk IcL>fDIv0HC0HxHHW Iv8HC8HxHH6 C$L(- {AL$ I|$(Hs81A;L$ D#tLK0HHP@f.ED HufDIN0EN$H{0EkHu0 HuDE$HU8HK8EIv8fD< <& HSHHHcH>@H[Hm;Etf1H[]HuH{tHuH{H[]HSBuHMf.9uHuL1ɺ1H5 'bf1ff.fAWAVIAUIHATUHSH(dH%(HD$1Ht$(L|Mt)LIH-fH@ @IHL9a,HH@HI9CHEB uHl$I9,HfHI9t HB tH9HHL$H)MLUHL$I$HI9t"HfHI9t HDB uHl$IL$MLLw! H.HH\$u51M"HT$dH+%(H([]A\A]A^A_IL$ MLHLH臯tIL$MLHL HWbtIL$MLHL H=XHMLHIL$L H,IL$ MHLL HL9|$MD1H53 L׬1I<$D$s Lk D$HHL$I$HCH5 L1腬Hl$H5, L1jhH5 L1TRzf.AVAUATUSHH $HdH%(H$1HH1I )ʼnHT$1rLuuB8IŃtHHal M1ɺPHy LPH5~ 1E1_AXHt$ HD$@HD$L$LK HHdmvdo001H9$MLG 1E1H5 WH$dH+%(HİD[]A\A]A^D3H\8e M1ɺPH E1PLH5t 1AYAZfH8 M1ɺPHoLQPfDD$$$At4L} H5 1E1tjHA1RH5 E1LU ZY^A}HEP M1ɺPHd LPL$L$L+$I HD$IH9vSHPL 1H5 E1XZ!L$L$fD1LΉHx_LH'L$A)wjL$H$M9tkH"AVL Z H$8- M1ɺ PH;DLaPL_ -HA< H8 M1ɺPH)L Pf3 UHSHHDAA1A L* H5[ P1DKAQv5h1LK h%H5 AY1AZDKAQ?v1h?LM 1j.H5 _1AXDK A?v3h@H5 1h7L$ Y1^DKAQv3h@1L/ hH5I CX1ZDKAQv1h1L jIH5  A[X1DKAdv1H1QjdL  H5 AY1AZDKAQcv.jdL  1jYH5 _1AXDK AQv0hH5g 1jbL LY1^DK$AQcv-jdk1L jH5 X1ZDK(Adv0H1sjdL H5 A[X1DK,AILfXAo$HAo$XI$GAo$hAo$xI$GAo$Ao$I$GAo$A$A$A$A$A$A$A$A$L_H-8L[ HKH1L +>fD1IHI9F I$GH11u8 E11/#L-TH5L YI}I$G8HL *PH/ LPUH51H /L H5fDA$)2H|H#H=#HL[]A\A]L1ɺH5e1Ou8 1+L- H5%x LI}I$GHK88WHL PH LSPU@L谶H1B1H=##H#HzHHfHH9uH /d߃薶;uH H#;H1#Hr"H+#HL[]A\A]H-1L H11L~HA$f.LhEL~1ɺ 1H5E1HL[]A\A]LO 1ɺkH5:WoLN~1ɺH53FL H5 L~1ɺH5LDL}1ɺ .L cH5LE1 L}1ɺH5ZwLn}1ɺH56SfLJ}1ɺH5/BL&}1ɺH5 L}1ɺH5L|1ɺH5H5L|1ɺqHt$Ht$L|1ɺ1{Lr|1ɺH5:WjLN|1ɺ1H51DL(|1ɺH5 L|1ɺH5L{1ɺ1H5L{1ɺ H5L{1ɺH5^{Lr{1ɺH5:WjH5)r1L H5$wH=,,HxL H5Lz1ɺH5Lz1ɺ1H5yff.AUATUSHH $HdH%(H$HG@HIHt]ftSh2HL$1HhLHT DHLxdLH;AąAH$dH+%(HĨD[]A\A]fHh2LAhALty1ɺu1H5t E1TfLLy1ɺ1H5t /`DAWAVIAUATI USH8dH%(H$(1hMHHI$ADžiI]PHl$ CH1H;u}L 1ɺ0H5P AHL$HT$11LD$Hl$ADžXL|$LLHCH1ҹHHs HuLx1ɺ91H5_P Ƅ$E1LH$(dH+%(H8D[]A\A]A^A_f.HAM1t$L H5O XACZ@A|f.L\w1ɺ'1H5O ?Lf.L,w1ɺ#1H5uO E1 !Lv1ɺ>1H5EO DAWAVAUATUSHH $HfHt$HIH$HL$ HT$LD$(dH%(H$1I)$HH=g\ HD$H&DH|$>Hex.tL`H +\1L$MHL3}H5GLHĸD[]A\A]A^A_HL X11ATL0 H5A[[%I1ɺ`PHK LPLPs1AYAZHD$8M1PH?sLPLs1NXZMLW11H5.B8{L X1LrPHp*PH51]A\E1f.ATH1IUHH~HSH)HHdžHLc1A?fDH|H0HD~@ADA HI9uL[]A\fDAWfAVAUATUSHt$0HT$HL$LD$PdH%(H$1HG@)$HDŽ$HD$pHNt$@!t$$ t$88 D$Zt$<h t$DD$\Ht$D$4HHHT$H9=HXT$8D$LI T$$ T$@ E` HD$t$@tHHL(YL$Hp D$D D$$D$hD$lHL11L|$lLt$hL H5dWLLHHH1H9t@HH9uf D|$lLLt$pAEw ZHtHHt H9L AW=L= AV11ɺH5_AXD$LD$8M D$tI}\uHsLd1ɺ1H5A HtHHt H9 L w=L H5=11,DT$DE DL$LEL$Ld$(M9DH I~:I1ɺ$IH51M6M9uf.MMA?HEHHLzHH' H9 LHAW1ɺaLI AVH5H14ZYA HH. H9% HXc=HA1SL H51AZA[2f.H-H9$HXY=THA1SLX H51r[A\f.Hy@L i@AHHHH9LH=L H511HHAHH9LH=rLQ iH511D$DD$<D$8D$$D$@D$ZD$\*=A11L H5)\HHHH9HX=HA1S1L H5XZHL D$lLALt$pWHtHHt H9gL {=H5PH11AVL *Y^XHHHH9HXAV=SA1H5L4 <1Y^)D$0t$L@t$[HL$HH91HH9uH-H#D$LHXLHHA Ht H9{L P=L SH511hHH9HXi=HA1SL H51AXAYLHHhdL 1ɺ1H5vHL$lHLHT$hLD$pD$LjAHHHH9Lp=HA1AVLM H51AYAZD$8 D$<Lt$pM |$DjIE@HfhLH5 1躾D$LuHtHHt H9H;HH5XSAL 1/^_HUD$4Ht H9<H#޿=DHA1S1L_ H5XZ,M>L 1ɺ1H5HtHHt H9HHT$(N='L HA1AWH5N1AVHT$@R2H D$L6HtHHt H9"L=$߾AV=AWA1L 1H5XZLCI}LxLclIHtLLH-II}Ht$PLD$8 D$üATUSHHH HxH$L $H$pHD$H$HD$H$HD$H$HD$8dH%(H$h1HT$ )$`HH$`IHD$(L  E1AHLABELONEH9$`H;$hH$tϦÃ;$p$t xHLVM2 001H9$xMt EtA1ۅE$H$1D<-tHcD4@HuL=9 L 1ɺ1LѸD$4H$HD$ HXH L$1L%fDIHD}I>"DEtHAL 1S@L1UYA6AL 1ɺB1L1^AvL A1LD1 _AXl@L=;1ɺ1L Lٷ\@L= A11LLc 覷$t  fDL=˰A11LL fE$HMfHH+D$ HD$(I9t$ALH 11]H5bE1I~L=IEL$ZH|$IHIH=H=@„tHHIHAI<$Eu)I$ID$EtH|$Ht$HHfL$HA1SL aL1GAXA4$AL 1ɺc1L!AYAt$AL 1ɺe1LAZA[L$TDEHD$8Mt$DEH|$(HH+D$ HDI9t!L 1ɺ1H5藵HI|$Il$AL5HAHH}t}EtHELR 1SL13_uELm 1ɺ1LAXuELx 1ɺ1LAYAZqEH$hdH+%(-D$4Hx[]A\A]A^A_f.L$HLPAL 1ɺu1w^_L$@1H|$@Lf\$4L={F@HL%gE1SL NL1XA6EL 1ɺP1LXAvR1EL 1L軳XZ`@HD$ L=1ɺ-L/ LLH 1胳Ht$` H$H  1ɺ.LIL 1E1L 1L$/L $HL=?A1SL L1ܲA[A4$AL\ 1ɺ1L趲XAt$A1ɺ1LLR Hk茲HH+D$0HD$8ZYI9tLY 1ɺ1L[I1L1L7 ;EL$1L1L EL$1LL 1[fHL-'E1SL L1ıXuEL 1ɺ1L蠱Zu1LEL 1|Y^DL=1ɺ1L LZ LEL=s1ɺ1LE1L Lr HL=;LL$ 11L LװHl$`H|$(H H1LIL 1虰1L1L$hL t1L1D$pL OL 11D$tL*H$xHH x N1ɺLILl 1fLL$ L 1ɺ H5輯D$4L$E16~ff.AWAVAUATUSH8D~\dH%(HD$(1H:HD$HD$HD$HD$ $D$}HD$MIHPHH11LHD$(PHD$(PHD$(PLL$(LD$ @Dd$ H E^Dd$ECh<H-LK 18 H芮H1L 9 jf.HD$(dH+%(&H8D[]A\A]A^A_f.AtAtDABAfLD$MRLL$LHLAątǐLD$1MpLL$ LHLhAA AEBfL E1$ H5Ǧ{fDH-1, HLy IH1L - )@H{dH{YL 1ɺ3 1H55A~fDLD$MLD$M1DH-L 1> H艬? L H1E1fH-L 1D H9E Lx LL$LHLAą4LD$MfDAWIEAVMAUIATIUHSHH_@dH%(H$1D$HD$ HD$(HD$0HD$8H f$H$HT$HHt$@HLT$`E\$\EHD$D\$E11PLLLHD$@PHD$@PHD$@PLL$@MT$H LVM2 x[H3$,H3$$H  I LLL$(H%H-HHD$ LH)HHD$踝LL$(H HT$Ht$ HHLL$0HD$(KL\$( H5A%r0N*>I3C H LVM2 x[I3SH  A{LL$0f HD$ I;C HC1HHD$H  L|$(IDd$LILl$0MH\$8LHl$@fEHL9 LL ooo o0o@)$ oPo`)$0opo)$@o)$Po)$`o)$po)$o)$o)$o)$)$)$)$)$)$)$aHL|$(Ll$0H1H\$0Hl$Hp1H\$@t$ L Ld$0H5ȘM~HD$(H|$8Ld$xH$ҜD$`AYAZLHAoN^_1LT$I1ɺ L H5_ARAWAVAT IE@H HfX-TL1ɺ 1H5AŘLLrLyH5>gvL V kL 1 H5>2 L 3AoN@MLl$@IGI?Hth LH$fDHt H{AL WD$P;HHEHH9LHL 1 H5DL\$L߿ 1ɺYH51͖L\$L0HD$hHD$pDD$PEf/t^HL$(Ht$HA19Lɶ ^Lt$`Ld$XX^HtHEHtvH9tqHpH=\1E1H)H9t9H@HIL< P[ H5 1辕AXAYHΟH5şLkIGH I?LL$L 1H5MBL$L 1H5hL 1H5cxL.1ɺB1H5͔L.1ɺ&H5詔LL$L wh HL$0h L\$Lͽ 1ɺ^IL|$(Dd$LLl$0H\$8Hl$@L\$La 1ɺyML$.1ɺI1H5STAhA~t}AWIAVAUATUSHHYHUILH1HILkE1H)L%JILJHDIcLHH1H AI9uoEoMHoU o]0oe@omPAou`o}pAOooAW A_0ooAg@oAoPoAw`oApoAAAAAAAAݏHL[]A\A]A^A_L $ 1ɺl1L% H53ĐAWAVAUATAHUDSLHL6LnNDVK.L$L9#*HKDT$ EPH֮ 1APL=1L RLj裑H 11AVAL Lj{_AXAUj11AL LTAYAZ1ɋD$A!LL P1j)A[XDT$ EAD\$ oAR1L1jA$Lؿ MY^D\$ vfHȭ EAMt AEuCHI9FH|$PtHD$PL0H|$XtHD$XL(H|$`t HD$`\$H[]A\A]A^A_PHK 1APLk 1H5lRjH 11AVAjL` H53Y^AUj11ALh H5 _AXAD$1ɺ!H5LV P1j蔏AYAZH5ˈDT$ AARALV 1j$1YA[[HALҾ 1AT7H5t1I#]A\L=SD\$ HL1jALG 1ɺ+A_XD\$ .fAR&1AjL 1ɿ诎XZAR11ɺ&ATAL L|MXZD\$ [USHHdH%(HD$1HWtH$8tkHhH,$8%t!1HT$dH+%(H[]@H5AH1tH5Hu"C$H9Cc@H5VHqH5 H҈ZH5VH軈MH5oH褈6H5g H荈H5T HvH5? H_H5٨HHH50b H1H5UHH5aHAEI?1H-^L H舌1L&1ɺ.Hk1E@AL+ 11H5M^6QG=.AWAVAUAATUSHH(dH%(HD$1^L#C$HHHHDA$<+<-IC E4$Ly cAFը{IIIDBuA.t D:uzuL|$LLIHT$:.~E>I9EH*@fA*Yf/ A, u f/CH,C HCHCAD1 }.xH5 D$_Ht)ALLXH5EDD$1HT$D$E>I9(f.EHDHD PH5\1QL? E1|Y^C@IEf.L hH5[1E1詉HD$dH+%(H(D[]A\A]A^A_DA>HT${H sK?@D$轌D$1H= H49t6HsLj 1H5[Ntr *SAt YsXfD\H,HCH{?Lϥ 1H5Z|  f/s"L,L%u'Y WfDf(\L,I?I)HILm PH5 Z1XZI݊H AAWAVIAUIATUSHHDbEHHxHhHu.HS`Ht D#E AHD[]A\A]A^A_ÐL{`Mt7 {MtHk`LH2Ht HxHH@HH)xMtIF@H}f+oL) @fHeb1jAfA'H5' _AXHHxHhHDcL{`EMtoMLL31HHxH  tuGe uoL6XIH50Y1fDD#EsL 1LH5X؅P;Gd 1eL)]IH5X1莅fHLH(L R"1H5nXSXZ@H{L. 7H56X1E1L 1ɺ1H5 Xgf.L8AąrL1ɺ-1H5W謄$H{ SHAI1H5W0E1L% [Y^@HC`HCPHMAL޵ Sff.ATUSHHHT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1Hl$ H$$HD$E1L%D$0Hl$ $Ht$1E1f/AHHcHS@HtH@HHfz(tƒz u@tHt$Et $HH_#ATLH1LH5TՂXAZYHHHckHD$dH+%(uHD[]A\t@AVAUATIUSHHT$0HL$8LD$@LL$Ht7)D$P)L$`)T$p)$)$)$)$)$dH%(HD$1Ll$ H$$HD$E1H-3D$0Ll$$H|$E1E1D/AL0ID$@HtHcHIHf|(tEtH|$Et$1LuHHN^#$ULKALHH5CS1XZOf.HAH0bHD$dH+%(uHD[]A\A]A^ЃAWIAVLAUATMUSHHHHT$HW@dH%(HD$81ADLLǁH/f*$s *HD$L-MLLHH H@H @EHAL1jAhH5 hhhjfjejbhhhhhhj\jUhhjRjKj=j8j4hj&j%hhhhj jhH  CH@HA L1jAhH5 hhhhhhhhjMhhhhhhhj\jUhhjRjKj=j8j4hj&j%hhhH1LbAúIG@S$H fD\$1ALjAhH5 hhLH D\$ C$ H@AOL1H5 L1ɺ"H@cjA LhA1hH5= hhhhhjjjkjihhjNjDjMhhjZhhhhhhj\jUhhjRjKj=j8j4hj&j%hhheH@1L.0HH@3 DE H)<Ą H; HDHPEuHH u D[EF DEH@ H@XH1HLЅHH@ tLtJ@tL%9t) 'LkH5sN1V{E1fDHAL1jAhH5 hhhhhhhjfjejbjMhhhhhhhj\jUhhjRjKj=j8j4hj&j%hhhhj jh:H@1L}7DH5rM1UzE1HD$8dH+%(HHHD[]A\A]A^A_@f8R LMB C$LH5||1@DžHG|$LDDHǁHǁtLHT$L-nD$ZLELHT$#Lk#DD$L-@L1H5 mL 1ɺH@-jA LhA1hH5 hhhhjMhhjZjOhhhhhhhj\jUhhjRjKj=j8j4hj&j%hhhH1L/H@HAL1jNDAhH5 jjjkji6 H01ɺ2L$OjALhA1H5* ZL}Y1Ʌ;DLIO@CHVf/HL$CLHL$C f)AHp)HCPLCHHSPLLLD$~LD$ IG@1HtHft HHu2ft HHufHHS`LHS`LLD$|LD$[HHPH l H{`UL H{H,LC`LKPHH@HC Mt=LLHL$(LD$ LL$xLL$LD$ HL$(LK`HCPLKHLLL$9LL$L HADL1jAhH5hhhhjN3H@jAA1hLhH5ThH AÅ IG@H f.H.fX'IT$'z f'L̬ LG1LL\$tL\$f.LLi11StE1Mo1L H5L3tCIO@C H1L1H5z L1ɺ6fD\$H1'jALAcH5 AYAZD\$ HH@DjA LhA1hH5b hhhj!jhhhhhjMhhhhhhhj\jUhhjRjKj=j8j4hj&j%hhh$H 1LgAúIG@Hf'cfD\$LU D\$LZ DL1ɺ=D36XH)HD$1LH00/HHD$0HD$mLD$H L DL\1ɺL\?L޿1L\$7lL\$fX']D\$1ALjAfebhH5Z j*j'hhhh-H@D\$y IG@H^C@Dk$EwL>1 `L޿L\$L< gkH5LHL\$HH H@f.X=H{H LC`1HtHCIW@Hf8)). (D; IW@H1fKtHH~ f8,,C|H@ HH L$t {p[ u I<$IG@Hf8#{#PCxw PhD\$LfL :D\$JL ID$HH΅AL D$rL I<'T'HAD$NHD$1LLD$ H0**/HHD$0HD$gLL$LD$ HLKXHSXLL]lHS`LKXHLHLL$ HT$hHT$LL$ ?HCXHD$H{HLC`M&HIG@Htf.HD$HSXLLHHCXkLZ1ɺVH{H HHD$LC`HQHHsxLD\$HLLGHD\$HASfX'D\$1ALjA!hH5 hhhhH0D\$D\$Lg1ɺ3D\$LO1ɺzL0HH  H{HH LI(LH L 71LL\$cL\$kHD$1LLD$H0'/HHD$0HD$ eLD$HHT$0LLiL1ɺHS`LD$0Ht'HLHT$ LD$VfLD$HT$ H{HLC`HHD$HQD\$\L D\$L1ɺL.HHL1ɺzH{HL }HH pSpD9[D1APLΛ q(ALX51LL\$3bXZL\$LHL1ɺ]A1, LL$ 7LHL1ɺLC`LHL1ɺcHHEAxA/LǗ L0-HHHCHHQ6D\$L:1ɺVD;Kp%L Vq(HA(APAQL IL31LL\$`XZL\$VCxLD\$Lp 1ɺIH531`D\$1ҾLD\$D\$ǃIG@HfD\$Lӛ L 1ɺL 3L DLK`C ǃIG@HtfI_HIOHH9t]D\$LMl$IHft(LMI|$LL;UHH9uƋl$MHD$Al$ AID$L1ɺbCC|LD\$_D\$C|H@4IW@H0OLD\$*D\$CL tJ L z1L| 1ɺH5r1D\$R^HD\$L=1ɺL=1L1ɺbL ^E1LD\$ LT$"Ls 1ɺIH501]D\$ LT$HǃIG@Hf.LG WRfSpe VcpHHt {tIW@Hsf8)tt 0 ,C|1ҾiLD\$oD\$UǃIO@H>ft)1ҾjLD\$ HL$(HL$D\$ f8t2HHD\$覿D\$7IO@Hf(HLD\$jYD\$L)1ɺlL)/LL\$\L\$L1ɺY=L D\$ H5.11DL$[DL$D\$ HHAHOLD\$ ɉL$L$D\$ CL u*1LD.Ld LL\$[Ht$11L[L\$]ML– H5-ZE1tD\$L{D\$mLp&HHuH{HEL[ HLH(RAPLi _L% Lٓ Wq(D\$L?HHDLH(1Lx 1ɺ3H5,D\$YCpD\$HIHCHL L,LL\$mYL\$LH(LF ALP,1LL\$+YL\$ LI(L  L oALc18D\$H5'XD\$E1F Hǃst9s|AID\$A$APjMEAs|A$I$IEMHAZL A[=ҁH5+LJ(AU[P11WCtC|A]XD\$f 艃f ꉓ9=ULfVD\$H5*11ɃoWD\$LH(F1Lu 1ɺH5B*D\$"WCpD\$HLH(L (L ;1NL1ɺTLH(uZ1L.u 1ɺ;H5)D\$uVCpD\$H LC`&LP1ɺOL 71zǃ1f_ǃ[Lk L /1ҾL#IH|f8)n)af&tv|&ƙ1L#D$I:LH(L I f.L [$L.1ɺhAWLAVEAUIHATIUHSH8HL$LL$dH%(HD$(1L9HDFa蒭A|$hD$b$AL$`HEPuUpE1L脤Lp1ɺRHD$ BDT$ HHU`ƀ7<$9|$HHT$DT$ 螙H%HT$DT$ @HL$EHLLDT$ 4DT$ HtHLDT$ ݧDT$ T$H+T$EA$AL$pjHͨLPED$tt$0CH AÅLHtHM`@AD$\f1H1AtfDH$ЫD$LLq 1H5!RL1ɺkfDH5̠1RE1HD$(dH+%(H8D[]A\A]A^A_@HUL IH5p19RE1@D<$D+|$E#A$_E\$EHMPI\$@HT$$D\$HHH $D\$T$$H $H L qH5L ҹSLD1QY^D\$D\$Ls1ɺfH51MQD\$HLA 1ɺIIH5K1QAwfT$E$ED$tAL$pD EHHLAVAQEt$0H IE@HU`Ht f"uAD$\DD;t$ULHL$EHLLƩ.D$LF1ɺHI9HI9uLD$DDHLD1A|$h>HxLߌ IcLD$E1DHH c%AÅHU`f.L xH51LOE1@HL ID$L1ɺL DHD\$[D\$taHL$DHHD\$/L1ɺH5ND\$ D\$L1ɺHL IH51BND\$Ly1H5\NSD$L1ɺHD\$I9bHHL`L/D\$tzHD\$ǫD\$t!LD\$LLHVeD\$tCLD\$MD\$t-H}PD\$5D\$tH}P'D\$LD\$H-fL HI1MH1Lʊ LD\$WD$LN 1H5LD\$%OL1ɺ?ff.@AWAVIAUATUSHHH$L$LLD$@H ;L$H$dH%(H$HHL$xH HL$pH HL$hH$H$HݎHT$`HHT$XHW R$HL$0H$H$H$HL$H$H$H$HL$H$H$H$ HL$(H$(H$ H$0HL$8H$8H$0D$HL=CHDH$H HD$%DH$@HL8/I /HDLHH D$@EG L/HI~L`LOIHtLLHQII~Ht$L&-LGHD HHD$ GHT$ I~HtHt$ Ht$ HMHD$ HI1LLQ-I~HT$ Ht$V&HH9$qDŽ$@H+}@} LeLR L"GI~LhLBIHtLLH PII~Ht$0L%rHt$LO@ID$HHt$1L-1ɺ8IHD$@HD$PH|$@ H$HċHD$hHHD$xHHD$`HHD$pHHD$XHH$dH+%(VD$HHĨ[]A\A]A^A_L9 3HDŽ$@L+LEI~L`LHH(LLHN}@/HIHHH$@HLgL1ɺPHHIF@L-b IܺM} HtaHRHHfx(tOH(HtG/H IHt5H1LHHoMHLhJIM9tIF@IcUHuIM9uMLDI~LhLIHtLLHMII~Ht$LV#qLLUDH$@HEDI~HlHdIHPHL$@1LH?H)I~Ht$L"H mHL$HD$@HD$PH] HD$PDPEt Hx HD$0H9$u1HD$H9$n $uHD$PXt$H5Lz`L\ Ht$1ɺm1L EHt$(11L L|$L9$ HT$(LLQOЉ$L9$u  Ht$(H|$8cBHHDŽ$DŽ$H$HDŽ$H$HԇDŽ$H$H‡H$HH$HH$H$0H;D$8HD$ L4$Ll$n"nD$HT DŽ$HD$ DŽ$L`H@LHHD$]HtHDH<$LH$m$ $~DT$HEHHAHt$11LHt$L}?D$HqfHt$I1L{?fDL8 HHLIHL Ht$1Lt)?D$H.H$@2IL|H=WzDŽ$H$$H,H$H%H$HH$HH$HH$H $9MH|$@D$HHt$PLHHt$11L=H=yH$DŽ$MtXA<$#tQH<$D=lEtx  gD5gEH$Ht P,?H<$LH$FiDŽ$H0iD$HHHHD$ HHD$ H;D$8FL4$KDL|$0fDH$L|$0H$@L%lHD$(H$HH$@HTHML9ML*12H5&,<H<$H$H_\L! Ht$L1ɺ;$HE1L$LL$`HT$8H|$}c^_H=qwÃt&Ht$11L~;H=Lw$9M؉$MtXA<$#tQH<$ȯ vjtdv du dHtE,tH}@E,A7H<$L迵Ht$L1ɺ:Ht$L1ɺ:Ht$L1ɺ:H=JvDŽ$DŽ$HD$(H9$ L$LHL$8HT$(LHt$IHt$L 1ɺd9D$H1L2BHD$PHHt$L1ɺ=9D$Hf.1Ht$L1ɺq|9D$H`|$H'#ZdHLBHt$L-1ɺC9D$HHt$L11L4$8VI|Ht$L18D$HuLuIHaL$@lLw }LmLL5I~L`LIHtLLH>II~Ht$0LxH  HL$LuCH5 7D$HHD$0H9$mHt$L11{7D$HHt$L1ɺy7QHt$Lk1ɺ[W7D$H;X#Ht$L/u 7D$HLǵ8Hx@P,.3Ht$L1ɺ6Wg蘪MI>L2H HD$H16D$H?Ht HD$ Ht$Lt11G6D$H+Ht$L)t6D$HL 1ɺ\H HD$H15D$HLs}H5 5D$HpsVUHHAT`L |T LDHt LIt HHD$ 1Z5[]D$H68fDAVAUATIUHSHFPH@HpHG@HtbfvXL1H5 4L1ɺ-1H51E14[D]A\A]A^@HHU|L2tu`HE`d$HE1HE`#1Lt 6IH51O41Hu.[]A\ADA]A^H8Hs2LHKAŅHM`HL5O薤DM|1ɺNPLLs P13X1ZH-AŅtCHI1ɺVLILs 1y3HLiAŅA[]DA\A]A^@ID$@Hf$fHȣ1Lr I1E1H5W2[D]A\A]A^fH舣LQ JIH5!12[D]A\A]A^Df/ffH8H=Yr H1H YD)DHHL$LLD)B,0a-yDuA9~Lcd$f.@D<-1HD$x"(AwIH s'HL$LlHD$@LH8IH HMOHǺt$L}L1H.MgA[[LLcd$:|$ KHcL$ L=DŽ$HHL$xHiIHL$ fAGD$tfA_I/fAAIcD$(AL$HD$D$DOdDJ,A<$-D$t$Lf ^A<$OA|$OA|$_HH\$ LfK fD$Zv HH *HD$HHx HD$HL$ H$ H$HxIP1AQEUH fAOD$pN1ML:e \$(HHl$8H5fAOIL6a H51CML` ȃ1Le H5iD$TAWfAVAUATUSHHHL$(dH%(H$1)D$@)D$P)D$`)D$p)$H>#IH@HJe}x}1E1L4H5N?GHL%1?11IL`  L}eu }xuAH$dH+%(u HĨD[]A\A]A^A_fD{Hu}n}HD$ HD$8HD$HD$H-NxL l1ɺ 1Ll\ H5;Aa@HD$(AD$8}uu}nu}fILc 1L( 1}LL_ 11 A_H; A&HHDEuu}nu }'s}}hs}iHIL` 1R L1UY^ILZ 1ɺ L1A(Euu}nu }s}h}HILZ 1AU jEuu}nu }Es}h}IL_ 1ɺ E}s}h}ILza 1ɺ Euu}nu }s}h}ILF_ 1ɺ }sE}h;}1IL:` 1ɺ }s*}h }IL_ 1ɺ ]}s}h}IL2` 1ɺ )fDHD$(Euu}nu }s}h}IL`] 1ɺ Euu}nu }{su EhuEDL$@L%]Et,"L%"LLHIL^ 1AT E$H1E1L 8 H56AIٹ L\ L1E1HIٹRL\ 1LE1XZIٹ L_ Iٹ L^ Iٹ L/^ rIٹ L] YIٹ L\ @Et.L%"LY1L"5HIٹ ATL\ HIٹ AULV Iٹ LV fAT>USHHdH%(H$1HHHHD$HD$HD$HHHD$PHD$4D$pH$HDŽ$DŽ$t )ȍTHcL%4L] HL HD1H‰$HP11RIѺ1IH$H;H$H$Y^H5h薏H$HtAHH.5HtYHpH$dH+%(urH[]A\fD1ɺ7LLE=1fH;L 'L\ LX1Z{ATIHHT$PHL$XLD$`LL$ht=)D$p)$)$)$)$)$)$)$dH%(HD$81HH$D$ HD$(HD$@HT$ HD$,0H5[ HD$8$$$foD$ foL$0H A$AL$HD$8dH+%(u HLA\f.AVfAUATIUHSH˹H@dH%(H$81H$xH,$)D$@HD$PH\$LD$LL$ I)D$0LEH|$`HHD$`HD$HH$pHD$HHT$(Ht/HHt#L5ͩHLtPMI}IMH1HH$8dH+%(H@[]A\A]A^fDH1,H$HtHC`LHH+}uHyH23H$HC`H+^fDHt6HHD$(H HC`Ht H@ HD$@HC@Ht2HD$HHD$0HD$(fDH1ɺLH o oS$$ HIE11L$LGIwNI:LAI9tt<_uIAAI9uHHtD@H1LYQ H5D1HE1AVAUIATUSHH>uW/EL5*@u(I]H[]A\A]A^D@ tkH@t1DHL4tʄu>1LP H5D[1]A\A]A^tHH8uHIM[]A\A]A^ff.Hu'u[HHGH9\HG HH\H(\HDH5\H[HD]HH[HWHG H9uHG@( tLW1ɺ1H5-Cvff.ATSHHHHƋ@vA v>{1E1L;W H5O HD[A\fDvH;11AątAHD[A\L1ɺ1H5&@1E1L1ɺeH5HD[A\AWAVAUATUSHH $HH $Ht$Ll$0IHHT$1ҾL$dH%(H$"HGPLH(1HHLh\ML$HLLHD$0ID$PH"D$(L1MHT$(LHhCAąD%60EX IHHD$[DL$Hh"AH$HM HD$H1艧D$(IH5UHL$L$PLHcHt0PH5UHcHL0PD$(HcHHt0HU Lt01L5,SjLL$ L$L\$ Y^1LL$L1LV H|$LQL HL 8$H>IHpHDH APL SPLL$8L1$H Lte?8x1LPHПLPLL$(1XZ*fL̞1ɺ1H5+H$"dH+%("H"D[]A\A]A^A_ID$PAt$HMLK E1H5A+1F_AX뒐kHK 8$HIH/HDH APLSPLL$8DL)S 1ɺ1H5*A @HT$,LH{AąxL1ɺ1L{Va1LR H5H*Of.AUATUHHH dH%(HD$1ILl$L,$t~H}P8AątFLH#AątAHD$dH+%(H D]A\A]L1ɺ_1H5:DAL11[H5dfL\1ɺd1H5?a%DAWIAVAUATE1USHHHL0H9HPHhEl$IVHL2zLE`D1HHILE`kAątILM9tqIE뫐HH-GQrLI HI1~Lz11HaHD[]A\A]A^A_AAWHAVAUATUSH(LI9AHHAA͉D$ IGH@@]jC@`uHHAąEIGH 9HHPH#H IHLDHDI5qAV L5ATIL#R LY1WH}PY^5AąAHH5=HAąL8AąL ?AąEDDl$ HI_OU1EAą,U1HHWLIVL0l$ HPIVHIF"f.EIHxgHI$J|(gAWL> 1SHt$0I1D)^_H5I|$HHI$J|(sI|$H5.QHHI$J|(snI$H [H4BoJD*HD2I$Bo  JL(HL0AL$L?DM;$$tHD$8H@PHD$XHI98HfHL$(HHH|tfH1ɺ! UHt$0ILaI 1A_X DHt$ A1LbI kLI 3 Ht$ 1ID$@HHL$(I,$L|I9ufHmI9HuLhtbfDHt$ Lߎ11YH1HI9uH5HHE1fDH H9uVL}G 1RDL$ Ht$0\_AXD$HD$xdH+%(tD$HĈ[]A\A]A^A_HL1ɺ HD$ Hƿ1Ht$ L11 댋T$ D$xL"H ? YH|$8D$UdLHKDmIHx9dHL.; UHt$0I, 1_[]Ht$ LO1ɺ ;D$D$ 7H5h1Ht$ L{1Ht$ LT1[L?E HOHD$ H1HHL$ M,$HlM9ufDMmM9IuHetl$(L E xHt$ L$1ɺ D$HM,$HhM9uzf.MmM9IuHWetLC HUbH|$8HHbHLD SH\$0I 1HkXLD Z H1ID$HM,$HhM9uMmM9IuHdt;H $H5H=H|$8aHEz@AWAVIAUIATIUSH8D$,H@HHHt$HDD$(H@HT$H@PHxHHHD$1L=H HHD$ EfHHL$H9HH9tYL1L X LD 1L܉1ɺ L1H8[]A\A]A^A_@I$HLhH@IT$HB H!HHLHD$L`H1Lt$I1L D ;HD$0I!E`LZYXLL-H5%= LHH%L=l=D$(I>LkL3IFHHCHI^HH;l$vT$,A;T$LHH9T$%IDŽ$H8[]A\A]A^A_fHB(HD$fI$HLhH@fD1ɺLL &Lx1ɺLL݇L̇1ɺ1LfD1ɺLL1Lz1ɺH5 _1IDŽ$H $H5ފH=HAWAVAUATUHSHHT$@HL$HLD$PLL$Xt:)D$`)L$p)$)$)$)$)$)$dH%(HD$(1HD$ E13oH\$HHT$0D$0IH$ HT$ LjHD$D$ Ht6HB(Lr D$0Ht!H$ HAą51HAąH}P1LBAąHL-\LA LIo1Ht$ HHAąHtLHAąH=\L@ LIz1jA1H&AąA$L<1ɺd1H5ʇHD$(dH+%(XHD[]A\A]A^A_fDHEPLH8lAąH~[LZIH5T1DD$ 4DL1ɺ}1LkGfDLI? 1OH5<L,1ɺ`1H5f.L1ɺq1LfDuL1L1 ff.AWHAVAUATL%ULSHLH$I9ŸLd$LDE1HEIUMI DHH#BtAFLM9v9v~HEHuLEMLd$IEAHԢH-6LHDIEHp( HIEHP HHHLIM1L9<$LD1 @t`AILH#EtIGLH#puIEPHHHH9uCH@H9t7LH#PtA@ufHEHIVf.La1/H53OLx(L{XHUILZ= 1SH5DAWIUH 1H fDIH#BtAELAL$9t$v9vID$HuH1[]A\A]A^A_M1L9<$Ll$HLD1@AILI#D$tIGLH#xuIFPHLHˆL9u~fDMmL9toIEItHHHtMM(Lg1H5.I ]@gID$Ll$HHIU@L1/H54LVHIEHP Ht@HHt8LIH1SLg; H5XZLH(ʐAUIATUHSHH^IHI$HHID$H9u>t@HSI<$HRHPIT$L HPIT$HHID$H9t8I}HuLE1亚H5XHL[]A\A]L- 1H5&H e$H5sH=ff.fHHIH9LBA@a IML9H1t>uHIHIL;Q@t'HL9tPH1uHIHIL;Q@uLHAHHH9)HH@H@L9P@t͐HH9RE1LDH% ff.ATUHHLgPI$Ht u(I<$HZAąt5AHD]A\@I<$HH]A\Xc1LJ}1ɺH5w/HD]A\@AWAVAUATUHSHH(LoL~MMMWLLMg(LT$Mu(LL$Ld$fLLHHULL$M;MLT$AuM;u(t1HHt@H55LT$jLT$u!AH(D[]A\A]A^A_fM;WuHD$I;G(DEfDAWAVAUATUHSHH(<{ADA9"DED$HCHUH@H9BHHHL$HD$H9HLHD$HD$H@LxHHD$I9IfDM6M9IFLHpHTuME1L;8 NH5_AXH(D[]A\A]A^A_A91L$7 H581AYAZDHD$HHD$H;D$LLM9F5M}&IG@HHx8?I@H{IEHH@@HHHyH9pLIHL77 RZHL5 P)H5.1H f"1E1LLs5 H5rTLE1L9|$HCHUH@H9BfHLL6 A1H5 XZ@LHLHD$M9pE1f.ItM?AM9uLL9|$t'E1ItM?AL9|$uED9l$9DL4 MmM9LHL9uMmI9 MutIF@HtHx8tI~@HtIEHHP@HtCHHt;H9t6LHHL4 cQxL AfL fDAWAVAUATIUSHHHLoHHLLpL߇HLHHM$I$I$HD$L9BL=\fDLHHbHEpIFH@@HHHH9LJH]1 SLbLIFH@H XZM6L;t$InHupHt HEtHLL`LچHAIFHEpH@@Ht HHtH9ugL Ly3 W1H5OH1[]A\A]A^A_L @H[]A\A]A^A_@LJfIٹMIDŽ$L`nff.AWAVAUIATUSHhHn`H<$HT$@dH%(HD$X1Hntu2^hFpt<H$L@d H@PHD$(1H<$LAąE]pEtH$LH@PHD$(HD$(MeHHHD$8H$HXp1I9\$ HDL}MdM9I\$(LLHbLtH5HHLMg(AGu&LL#tH5nLEUTEH<$JSFAT=IL1 H511AXAYH$D$TE11HI9tOGLt7HH @HBH H:u HRArHH9uH?I9uEtt$TH<$1HL$TH CD$TD$4AElDd$ 1ADžAEhAD9H$HI9E1Ll$HE1DMAHCDcLDkPD{$LXELHEHAT$HRH|HH98uHPHHH9HQHRH%`tDaLI81@!EE9 EEHI93Ll$HM1EUhIMXEeTA}PED9T$ AmTD9T$ A}SAEH<$DT$A6HH1ɺ{ID$<L3 H5PD$PDT$(1ARMH HD$XdH+%(HhD[]A\A]A^A_HELxAA}PLF/ aH-1HLp1ɺVH1E1pfA&1E1ApK8HDL$0DT$$t$ LD$L$DL$0t$ 1DT$$LD$AċL$@4L[ACa L߉L$0DL$$DT$ t$LD$ft$L$0DL$$DT$ LD$fEE9EEfHHRHHH9>H5HQHRhH% fDHQADd$ AElDEd$4RAEhEA)A9WH<$EL/ IH_PH1ҋHIHtu~ltHHHH)HDL$Hxjc=|A^IA_1LT, H51H;DH#vAEhH-Lln1ɺHULQn1ɺ@rL>n1ɺH5L#M}HXAET H<$dAEPkMA I11I9u-t 9tAuTtYωHI9HPHRutt tՋH8MEHPLA+P9AAEttI}XuL+ MAD$IٹBL + H->1H (H<$DAąLl1ɺL1H5EEEAmTDT$MeXDDT$ I9_HD$(I9v L1H1Aԅ\$ D9E}pED)H\$(D)9nDпED)Ll- QHH5%1P1EUhE)EUh_AX,H $A]HL9HG@MHAPAuhHD$(AuhHA}H$AEHI9 H@@AEH$HH`H$@a:A]PB=Aٺ^LL 11H5,HEA]P@ EL1]8I]XAETvI}XL* A}lA]htD)H$Hx`AtSHUHB"uGMLR)օ9މ1҉1؋D$ 9BD$ H4$DHHV`EUhHt H$H'&H<$fHHH4$HVXHFPHjH|$8K薔H|$(AUh틏HHHсHH9t$ 9rAuhHH|$8H~;tHHCL) H5eHH`=ADž11EUhD+\$ 1ALb )Ll$HDDM)EUhAETAuTI}XHD$8HDL$@t$HxHj|=A[IA_1Ll' H5T1)I]XbDDMLl$HAD)˅t1FEUhH<$H- >jHSIL' 1XZHH|fn4fo  Ht$(fr f8?frf~9D1A9HD$8HDL$@t$ADHxHjAAD{IHD$HDL$@t$ Ht$8Hx$HD_{=xL<$I11H5™L& ^_9yA HLPIAU=jHLi( 1ɋD$PAiLf1ɺF1H5'mfDH<$$ IA*ED)L& KHH51P1AmhAE)EUhAYA[L<$AuhIPH|$(1ɃIGPHD$(HD$8HLDL$\$HxjyLfIXZ9=.HL% 1ɋD$PAH5Η1A}Y^uAEHD$@A2DEapTHxX^EUhD9wHt$(HHHDL$Hxjx=,$I1ɺL# H51AmhAA[A\H$LM9IPBt9uHB HHHLILa" I tHEѹ[D$L$ PH-O1HY^7HEѹcD$L$ PA111E1H\$81ҾHDLH4HHcHx\$IuX$j-w=FAXIAZ1L 1ɺH5[AETsH-o1ɺ1L>bH.KH-FLb1ɺH$LJ(yHD11HIHAEhIHDL$HxjQv=jL! I11H5D$$AYAEhAAZHPXMAWAVIAUATIUHSHH^`dH%(H$1ILH HHL1۾H=L9HDHD$@HD$8HcHALLI9HDL$tC|$HH$7HL|PDL$X1H5HFXZH|$8zp1H$dH+%(HĘ[]A\A]A^A_H)1H sLHL+1L_1ɺH51xHD$PH|$8HIoYH86L<IH5e1a@LH5361f.AWAVAUATUSHH $H@H|$HHHt$0dH%(H$HGPH$H|$(HD$L 1HH"HD$hHHD$H91@HH9uHT$HHH9#HD$H9HPHLHH#BL$l D$lD$`1D$@D$DHD$ D$<D$dLd$Ht$H[HHLhIIH9H H@H@H HD$H$LHH$HxH$v& L$I9Ll$PL|$|MLt$xH\$XDd$D\$`6=AċD$x=tX=MmI9tPIELLD$xD$|Hx@tЋD$|=uD$xD$<=uMmD$@I9uDd$DLl$P\$`H\$XL\$E1MMHfH$Lй>HA1L$HIEh>L$L)$IH)$)$)$)$L$`H$)$)$)$$ILHƄ$DIHDŽ$H$HIDŽ$(DŽ$4DŽ$pH$HDŽ$DŽ$Mt/1LH LbHD$IHD$0DDH$HL$PH-!DHH D#1H IHD$LH$HD$HLDL$L$XHxjSoM1ɺH$L^ H51H$H59H$H$AXAYHD$H8KAH$H:H|$LIH%HD$(H|$LD$dL46 j1LE1jE11#^_ LAH|$H|H9\$ HH@H-1ɺ11LYH菿H1L3 oDD$dEt]H\$(L$L5! HI9t7H;Ht2uM%HHI9uH|$NtH|$萙1*HLr! Ⱦ1'@1LX1ɺH5蟾1H$dH+%(uH[]A\A]A^A_@1ɺHL UDŽ$UDL  H5 11xDL X1ɺH5LW1ɺx1HԽ@H-L) 1{H訽뵋L$hLd$uIHt$HL4L1t u?1u D$DmD$|L D$<Å AHD$0Dx E%|$<<Il$H5~AHHD$0H-ƶ@ Dl$hEcT$ls Hl$ L|$01H9\$l[HL$H[HHLhHD$(L4MtH53LE=HH!Ht$ MMH1ɺ1L &1LLH $ 2HIIIM`H9AHhLIN`HD$axHD$IUhLHǀ AoAoWAo_ Aog0uƀJu ǀDEu ǀHH  HL# $L 1H5AtAht$<AEy1H-L H耺Dt$hEqLnT1ɺ1HUL*L IH5%1!H- LF 1>HaIl$H5zHܼCD$`E11D$@HH5H-詼Ht$HL$I$hH)LHFPLNHL1Z11Ht$|LD$|HL$0DI Ec|$hA =AP=HPHD$@L 1DH 1͸AYAZ@Il$H5yH謻D$@D$`H-uEHD$0@ D$dL4 tH-;1H4DT$hHl$ EH\$H1H1L LKH1H輖OHD$H1ɺHL> LHH1辷HD$L$lHH IHPHt HHHH9ǁ HH9uH|$踟H|$L'RLIH-1H~L'L IH51޶JLLd$|'H5IL 1襶LLHRL2'L IH5_1[H|$H謴LHrL$lHD$H1ɿHL LHH1H|$M1H|$苐H\$H1H1L LKH轵HLB,HD$H1ɺHL LHH1脵DL$lEH|$H&L5eI%Hl$ LDO1ɺH-Hl$ LO11HrH|$HWLHr1ɺHLNɴRLN1ɺ1H觴LN1ɺ1H腴H1L.eXD$h D$`D$DD$dD$<D$@Dl$@HL$0EDI EEA92APL H-ĭRH1諳Y^$Dt$DEEuHD$0A@ =8EH-\11L HNHD$0D$|@ D$d=L$d© ‰Il$H5tHD$dE1D$`D$@H|$Hm#LbHI1蚲H1LuH|$H#L/_HI1Cl$`EtsAtp|$@%(HD$0A@ P=H-֫RL  1ɺH1±A[[A|$@%AHL$0ҁDI 딄LDAEgHD$0A@ HH\$H1H1L LKH1HڏmHD$H1ɺHL\ LHH1ܰeD|$dD$dFA9=uAWHPL 11蕰XZHL HL$0=w8A H-JPL H11Ƀ-D$|'A H-L5 WPDb|$QA<$萣AVPH L PHLPH1H A<$K8DM{VLLPHPHїPH1衣H L=1ɺ1H耣뚿蔝A<$ӢAUPH6 L ,PHbLƧP>H]A<$蕢AWPHɛL \PLSN)L-8HXHQL MLTPH:jP1AU跢|$8H ʜ; HRL L PHY P1AUjH A<$H:\IٺLͦQPH PS1H%H D9tA<$H[lIL}RPHPS멋|$tk|$H;HH襜A<$ L Hv[HvIHA9ARHDAPLSPhA<$ƠSL 0PHLǥPHOP2A<$萠L LASPH PHPfAWAVAUATUSH8T$LD$DL$(MHHL$HQ HD$p8HHHHHD$ HL$H9&D$D$,fDHD$\$UpHAH|$\$HGu0wAݸA)9DFDl$fDDT$HE1HjjDjjjQD$HDPjD$pPL$H|$hɗHPIHHD$\$E1LpII I9II>ELKAvL$AUPA$bID$HuH-l1ɺ1LT9HDL@911H'L#91ɺ41HE1L911HH8D[]A\A]A^A_D$HHIEHHt$IEHL(HD$LpupSHD$HHD$H9D$ HD$HP(HEPHxHGH@H@HHtHAąaA3DHE1HjjjjjQjjD$pPL$H|$hؕHPIHH-jL 1H豝@ ED$,D$xH-jL71ɺ!HnBHH9LV H5aj1E1.?HqAąLo 1H5 jL L L61ɺ1H5i覜H *$H58:H=I:袗fAU1ҹATUHSHHwHLoPdH%(H$1ILHH5L跛H1LLHt LH5YLQHZLbI}HXHFH W$ATfTfDD$H+ LD1ɺIH5?1WH$dH+%(HĘ[]A\A]fH$HxLHHILHLHH) H)։HHHAuL41ɺH5ΚrfL41ɺ1H5蟚Cf.LMH1ɺLH5Nm$ۉATTO6fDAVAUATUSHdH%(HD$1H$HHHIIL%)f.H<$JH[HtaH 1HLL=xrHsH<$LHuHHuL31ɺH5ޣH<$1HT$dH+%(u^H[]A\A]A^fD1LB31ɺH5g1L31ɺH5>bAWAVAUIATIUHSHHXHdH%(HD$H1~QwMHtI@LLqiu}DHD$HdH+%(HX[]A\A]A^A_DyHD$HdH+%(HX1[L]A\H5A]A^A_fDH{(BIHnH@ fL@[H{LxL{BHHAAYEt$A[It$L H{LpL)BHLLHHID$ՔH{LhLAHLHH辝HID$ HI$HID$HL LK,bf.ID$JfH$HNHHDITHTHH)AI)AAA1ƒI<H<D9rhID$fID$ $ECD>BD>ECD>fBD>fAWAVAUIH5(ATUHSHHLyT$dH%(H$1kHt!HHT$ HQKHHUHT$HHuB}L5bI11LLvH{mMIHHH~HƒH{HPHHT$?HT$HHH訛LH]D$Ml$`11LAD$tHxID$hAD$pAD$x;IGH@H@HHtLLЅrHCH@@atHHH0HID$X0@Lt.1ɺ1L[H{LE1RH$dH+%(%HĸL[]A\A]A^A_ËD$IHML9HH5aHDºE1P1דZY1ɺLL-赓UL-1ɺ1L蓓BfD1ɺLLu-m 1E1LBH5g`9@1ɺLL-ff.AVAAUATIUSHHt FdeI9HKP@H=IHhpH@PH5uH8LOHH\AMpHE1E1j1LjjjjQjjj:HPHHIIHEILHEIH(IDuTH]XLepNI$H߃ (uHK`HEHHH`HHEx5HUxHHHHH[]A\A]A^LNH1LH5`,:[1]A\A]A^LH-,,1H1L*1ɺ$H1\D1LrH5+贐[1]A\A]A^f1L*1ɺH5+[1]A\A]A^/ff.@AVLAUATIUHSHBL9tHHtL9t H;PHUpE1E1jHLjjjjSjjjهHPHHM`HgHL0HPHHH]pHjAąA[D]A\A]A^DL9HUpE1E1jHLjjjjSjjj4HPIHHM` HL0HIEHL(L]pHŒAą'IH@HDHHH9HwHHH91HHHQ$H9u;ddf.LM9MI;UAuPAu$AML$(LLE1 H5D[[D]A\A]A^f.pPp$ND1L'1ɺ H5Zύ[D]A\A]A^L'1ɺ 1H5Z蟍f.ML$(1E1L H5Zdf.ATIUHSHHH9uEDHH9t8HxXt1LFq H5#Z[1]A\fDHI$HHHH9tfDHhHH9uH1 I#D$`[H E`HI!D$`AD$pEpID$hHEh]AD$pID$hA\ff.fAWIAVAUMATEUSLHHHH$T$HL$L$HD$dH%(HD$81AHHD$0g1A6IIDILP?IL=I9Hc A6I91LHHHP1H@H HDHHH|$0HuHD$0HHAULL$ t$LD$@$9Y^AuHH{$jHDL91LIL-X1ZߊAHD$8dH+%(cHHD[]A\A]A^A_LHHLT$(L\$ `L\$ LT$(AL\$(DLLT$ H{$I9Hj8Ht$0$$H{IDL8=L.IXZL\$(11ASAWL=ƂLʼnLT$0EDY_H`D$L#1ɺ@D$L#1ɺ L1gDL$DHL=Fj7AZLA[ILk11"A6_f.HH{$DjL7L8LH$HD$(LH(1貈_E1AXLT$HH{LL\$$DjL7Ht$ $$H{HDL6A6$$H{IDL6L\$LwILL$1UATH 1LL蝇E1DA AEAD)AIMff.fAVE1IDAUH r IATUSHH8dH%(H$1Hl$0HLHIfDH[HHf11HL)D$)$HD$)D$ +HtžDLLTHHHE$H$dH+%(H[]A\A]A^I8E1HIH p BzHusH[HfHf11HL)D$)$HD$)D$ *HtžB31L"oH5~贅,蕈DATUHH@t)L%~LH,H]A\L%}1ɺL:uH]A\ff.AWAVAUIATUSHH5yHHdH%(H$1H5"HA躀Dh"AEuAL$1ҹHLUHD Et=Dh"E=h"5qh"Et+x"tx"Ax"!AH$dH+%(HĘD[]A\A]A^A_fDIٹE1Ƅ$LQH5M|踃fDg" g"g"tD;L<1H5|gE1>A@t  Ѭu9HH44HH޿訂fL1DLAŅtNDLs uk_AAE8SL11H5 {otqEDL)A11LH5zE͝?D8LHL PHLHPHuH5P1蜁H@LA1H5zlLx1H5yCi8袀HL ޾PHLPH&uH5P1H ԃ@AUL-GI1ATLI LUASHHdH%(H$1蒀@HGH踇11Gtb蔂8t};ILIH):HYtH ]4HDHE1APLQP1 H H$dH+%(ueHĨD[]A\A];u+ILL1E1HHU}xƋD$%=@tzf.AWAVAUATUSHH $H|$t$ HT$dH%(H$1=LyuZ{1E1LmRH5srH$dH+%(HD[]A\A]A^A_fDHx1L$HHW LvLh|IHLd$ L蘅Hx.Hhu}t߀x.u}.u }tDIHHL1|AŃ1ɿ1IL1H5gkLH{f.E1L腂H18:}M1PHVLnPH51_AXT$ t$LALLMcBƄ, {D$8%=@LzIHL|$L(Hx.LxuAtD`A.uA.u AtDH5z LtH5LtH5=LtH5wLpH5_LYH5LjBH5LS+AmH5L2 H5Ȣ LH5 LH5& L~H5L~H5| L~H5k L~1MIHHP L2T$ t$L@M1ҹL|$LLd$L~HLA0DL|$Lg.}L%W8`zI1PH|LPH5 1AXZ"fDH|$1ҹHT~HsHD$E1ƀAdt(Am5Aq*A@A-6}L' AQ1IAWH51}AZA[?|H-h8qyM1ɺPHvLPH511]A]?{H#8,y$MIH3HmAWHDH APQL ~E1PH51H R{H8x1IPHH5PL1Y^AƄ$fAWAVAUIATMUHSLHxDyT$4$DdH%(HD$h1D$8A VH  HcH>DAED$<L5yD$(D$<A1AEhHT$A1A}4EE@1Ep1@Ip1E@ƍp1E@ƍp1E@ƍp1A @ƍpDtFIAFAHT$EL5xEM0AH AtDHH HǼHH$EL1HΞ D$D$L 1LLx D$<1HD$HD$(H|$D$(cL * LL EH|$ A Au 6%HcD$ ILt$MI8L̻ I@H H|$[D$Z 襻 ELL1H$LL$ZHD L5^r~L2 1ɺ 1Lx{t$<$LLL$L5r读$L 1ɺ bIHuIIIH5FH MLrFM[ IRH WLP1VH$H 1ɺ LX H5aq1zAsfD5T"D$<bIUhS"DS"=S"D$E1Au` I}pAE1D=AƉЉUUUU%UUUUȉ%33333333%ȉ%AHA E6IuXHH|$ZL$(] L$(D\$Ic1HL$ZDD$(H$HH)LDD$(ADD$ ATL͛ AWAu3D$,P1DL$0ALH0fL1ɺH5  vL1ɺu L1vE1f.HE HE$Ly1ɺb L1uD $fDL|$MI0LlL5HlL)1ɺy Lqu3@L|$ZIL$AHЃHEHEHEHEу у@y A(AIHEуHEI8tAMLEH5-PDEH JdMHD1RH$Hl T AYLAZA1ɺ AHD   @IAIaI8L5jH*H$McM@1K< 1L%]^H$IcDD$Hz I<H)1DD$ADD$<L}1ɺ Lj1ɺ 1L\Hiz 1}ADž#L.1ɺ H%z 1QADžL1ɺ H$IcHy I<H)1zAIEhuIH\$Hl$1ɺL L1L[-HcD$H$HCy H)I<1D$D$HHt H9 L 6UHD$(HA ARE)Ӻ9I,H51L{ DT$HASD\$HUJHL$81jHLjH|$8PAGTPRHD$XHDL$hHt$HL躶H0H|$ Hk{H-d{H<LHEH|$LLPI}kI/H谩L- I$HHHH9LJH' LUL{ s0HC(ID$P1IHC HS0H H-HH-H9}ID$HX[]A\A]A^A_H9^H-М[L qSa@I$IL$HtHHt H9"L BSH1QLRy H5| HAOdAZA[AGd|$ tN=rLr H5. 11HI$H=؃pX@8D$ HD$HHL NFL NATUHHH5lHdH%(HD$1H`tI3GH LVM2 x[H3UH tTHHKHUHHIH9@LJHLu L1Q1ɿBA $ AXAYDMALMHCI9A$DE1!AA$HD[]A\A]A^A_f.HHKHtHHt H9HLLQDMLt 1PL1 BAZA $A[HHtH Ht H9/HKP11L$u RLAA$XYʀ-HHtHHt H9HKsL1PLt 1gALMHC^A $@_I9Rf.LJHHKHt HHtH9uGL 0KHL}s 1LQ@A$[E1]jf.LJf.HB/HQHBkL J@foaATIUHHrSHz(HBHjBtHB(fHH8uϦW HHA$$ILHHEtE C9KXt []A\"[H]A\@Ht HHtH9u6L I1L)s H5{?[1]A\@LHf.AUIATUHSHHHIHt_H@ H@H@H@Ht HCID$LcI} Ht+f@ID$ HhHL[]A\A]ID$ E1f.AWfAVIHAUATUHSHHH$Ld$0dH%(H$81)D$)D$ ft$y@2;LA?LyvfD?/?HHuCL=5h D$ 9\$ HLLESMH1ZYHﺶ1<=H$8x1HT$>WH$87t?8<}IH 1IFH>H5sHEHH ) APLAQP1*=H 9\$ !@1H$8dH+%(HH[]A\A]A^A_D1Lp 7H5<1>8$ff.AWIAVL5s AUATAUSH(H|$dH%(HD$1HD$tL5r Ht LDHD$IL- Hl$IFH}It:HI!E9fu.MFMt%H HHIDH|$1ts1IIHuAMu*HD$dH+%(uyH(D[]A\A]A^A_L1n 1ɺH5QDT$:DT$DD$L11H5 9DT$wR1hL i U1L濄h4XZLH=7ff.fUHSHHHvuH[]f.Ht HHtH9uFH>H RIyPLh 11H53XZH[]HRfAWAVAUATUSHdH%(H$1?/tS=<]H$dH+%(TLh 1ɺH5H1[]A\A]A^A_03IH5HI~8IH1HDLH/Htc$<#tI-YL1ɺAfH51E1Z-'DM?I9|E1@Ll$Ld$ 1Hl$(HȟHD$MtbID$HtHHt H9H7H1ɺPHL]f ATHLT$hARLL$8HD$(1,H Mt|IGIO0HhHtHH?H96HRfHEHtH9t LH @L 6QL c 1ɿR1AWLT$hARHt$(7,H HHCHK HhsHt"HHH9HRfHEH9tHt LH @L 5HLb 1Q1VRSLT$xARHt$8+H0MtIFIN(HgHtHH:H91HRDHEH9tHt LH @L i5QLb 1ɿR1AVLT$hARHt$(+H MIWH9IG H HHDH OU HtH H;H92HIfDHUH9tHt LJ @L 4HPL#b 1Q1LT$hARHt$(}*H HHCH9HH$HT$@HH"VHsHT$HAH$HVAuuHD$HH9D$@HCHHHH9HRHEIMH9HLHRLOb Q1Ht$1)AXAYMID$I$HBHHEHt H9tLxHE1LT$PfDL=y3HE1LT$PLLT$&HELT$H9tHt LH @L 93LT$1LKb 1AWSHt$(Y^LT$I|$ LT$L&I|$(B&I|$08&AEI}fAD$+LT$ID$ HEH9HHxLT$*Il$H|$ID$("xHIt$ID$0OI|$ HI|$(I|$0H $H$HD$AI$HID$HL LH 2HD$sH=1<@H<$DHfDd$2A萂HD$8IHXD$MH4I1E1HL] 91i'fDd$2fD$I|$($I|$0$L$L31ɺ Ht$1E1'MyAGfA;EH<$HȁIIw HtMCL)3IIGLT$PMH۞MHBHTfDE1ILl$H\$ dfDHB{L#(I}(IlHi0@HY0@HI04@L 90M@H)0@L1ɺ?1H5%f.ILf[ 1E1&H5S%sH /@H$L"IuAEH"HfwHHHEH9tuHtpLHH11VL7^ RLT$hARHt$(LT$8%H 8(LT$HIL1ɺ@L .L=`HEIUH9t`Ht[LHHL\ 1RM}LH H;kH HCIE1H8LT$PHAHL h.HEHH9H@HIٹ5PLZ H51$A]A^1H=\ )f0ILIHHMuMcIEHL_E IEHH5,IE(1AE N,Dc0IwHHHtEl$McC H~HHCHLV HC(H51HCpJEx@=iLbHLtLM_LHp1LxL$HI2HAF IHIFHjIF(IF0A A0EtAV0A2IFMc1L`C cH5N4DcMcqLR 13H5L-(EHcùLHLR 1ILctKLd$HHHPI9uL1ɺ&1L1=0DIH\HAHcAE L`B IEHWIEHH5IE(1HL,A\$(L51ɺ>1I$LLL1LU M4$MtIVAvLL=L5LT 1ɺ71H5LAU91McLZQ H5qJLXQ L-/1IL?.f.;1LzR IH5gL-L1LvR JLcDAHLILAHLDHN1McL@ H5{JLR DL- LkO L3@L-LqO L L%P 1ɺO1H5JJLP 1ɺI1H5LcJEAV0CT8BT8ECT8fBT8S1LQ H5AwLuP 1LcNH5fJV1L,Q H5LPL-1ɺ 1ḼLA\$Lc1tLP H5IcH1Lb> H5y[IcHHY1LN H5)1IJA\$L-LN LLcc1LTN H5FL0LO 1INH51LP H5#rff.fAVIAUIATUSHGHOH@0HWXHHHQ`H H$HQ`HtHHAą'HLAąAMtOL9tHLAą3HCHK0H{IM`I@Hg`A[D]A\A]A^H0HHQ`AFfJHCHh`>;DHFPHcE1LO H55LqH1XDZ[]A\A]A^Ð1L1ɺH55[D]A\A]A^L̪1ɺ}1H5f5#f.LkhA!@L1ɺ1H55gfSfH1HH@dH%(HD$81H)D$H|$1)$)D$ Ht5H@ Ht,8tC1IL"1ɺ-H5'F1HT$8dH+%(uH@[fDH@1Ҁ8HD@SAIA AHHAAHA 1RH諰AXZEx [f.I1L N 1ɺH5,1[ATUHSHdH%(H$1IL .D$%=@tV=`t/H$dH+%(\HĠ[]A\Ht$(HfLHxqD$%=HHH9$u yH$iILLM H5j1 5@+8d I1PH]LPH5#1 X1ZfD8 I1ɺyPH1LKPH51 L1DIL\L ;BfAUf1ҾATUS1H8dH%(HD$(1I)$LHk L-1t$FALt$LzL 1U HT$ H H9wPHD$H9tFHD$A1ɺUHD$LzL LPP1 HT$ L1-ZYx_HD$(dH+%(H8[]A\A]{HA1ɋLK BH5P1 LCAك8t+LdL 1ɺ]1L rfLK 1ɺ[1L GfATUSHH dH%(HD$1wIHH-EHD$H$ExD$ HD$HtTH11HD$I\$AD$AD$HD$I$HtC HD$dH+%(u;H L[]A\ùLK OH5' LE12 I1L66 H5 AWAVAUATUSHH $HH $HhHt$HH5H=)HT$dH%(H$X!1D$LHD$hD$PD$\D$`gHIH-11L5 H H$HD$pL=O!HD$xIhints_veHDŽ$HDŽ$D$$HD$LLgHH|$1A?#HtҾ L HtM97Hglobal_fI9PA?filtKHscan_lvsI9Hdevices_I9EHdevs_hasI9A?scanN=b!:AHT$pLD$(^nH$HL$pLD$xL$HD$(Ht0HϺLD$8H5t4 HL$0DHL$0LD$8:Mt&LǺLD$0H5E4 LD$0GH|$(Hth1HL$`HT$\H54 uKT$\D$`HHH HH!H H H HH!H H$Mt6L(Hv(A}-t!1IuH$ 3 H H HD$(Ht$HǹHAUD$hL]3 [HPD$lPH$@!P1L$HD$8H LT$(H8HL$D$$HAI IBLLQU@=f!iltef=[!r:HT$h!HLl$hMtH54!L vLG 1ɺ1HiLHD$L. ET$$AdHD$U1nIHD$AϦL$@LHmIIHQt&HHH9u HH9tL;xuLHtIHL9Hp1ҹL+ HuƄ$LDLD$AT@IGHIVH@8H9M6L9t$Ld$HD$L9E1fDM$$AL9uL!1 1ɺ1HAH$X!dH+%(ZHh!D[]A\A]A^A_@=.!rsioUf=#!n:F1HL$XHT$TH5<0 H=!BDL$TAH1ɿjL!E HjD$pP1 HD$0LH ,1ɺaHDL30 1f=[!er=P!:HT$h HLl$hMtH5(!LqLD 1ɺfD=!:S1HT$dH5 WD$dH=!u;D$dLD 1ɺ1HHD$f=!h:1HL$PHT$LH5'H=a!2LD 1ɺ0fH5  @ID$Hth I<$LDL$LEt E9HD$L 2L9HLd$MHIMnI9t(M@I(HtLM?L9uMLD 1ɺ1HAHD$f=>!file=5!:1ҾHItuHtpL !HLaH1H1AU&L !L$C /HD$ Y^E1EDLx|=!.o1L !1ɺ!LB HHD$lHLC 1ɺD$PAUD$hP1HAHD$0H MLC 1ɺAU %AсALC AQ1P % кPtHq1ҹLD$0H$LD$0HƄ$ Y1Ip!H$(!xHƄ$H!+HLo@ 1HD$`PDL$d1HD$ _AXE1yƄ$'!JLE1*%m1ɺaHDLt+ 1HAWAVAUATUSHH $HH $H8H HAQLF8EA dH%(H$(!1AAHAL$ A HA1LL1HHE1L-&H`Hx.L@uAxtހx.uA@.9u AxtL$ 1HhLL7xH$LuH$H;z dH⹁  ??1<$LVM-HAH0Hu41EH$(!dH+%(H8![]A\A]A^A_[8M1PHOL×PH5x1XZHEHt7H9t2LH1LG]H5x1WL 1?ff.AUfATUSH8L-%dH%(HD$(1D$ )$)D$HMooWHHH) $)T$HD`DDHLHHH@HHtHPhHtH9uHT$(dH+%(u}H8[]A\A]ÐHHtPH9tKHHHHtOH9tJLHU1L> QH5@xXZfD1@H L q:f.AWAVIιAUATUHSHH|$H|$0H$Ht$L$LD$(LL$dH%(H$1H|$ HMtIHt L9HHIL-A@PL ' L1AZ1A[HIH.ID$hI9(HtHHt H9HkMtIHt L9UL NUL= @LR 1HJfAƆAAo]AoeH-AAXAYH9HfDHH9L;puMtIHt L9L 1@ LL[= aME1C}9HMHUHH3H3H HH H9LJU@1VL< L ID$X^_HL$H@H9H@HQHH(ID$hHr(HL VL< LQ11jM|$XZYILHP LH|$4ID$XHL` D$DH@XHMHUH3NH3VH IT$XHRH9T$HL$HRHIHq(HJ(HH+H9"LJ f1IHdMt$HxHI$ID$L L%MAE1H$dH+%(HĸL[]A\A]A^A_fDD$HL5v HDxDDHLbHID$hHHt L;b7fF HFID$hoMoULHLPZHD$`HD$HD$0Ht ;HT$ H|$L路D$HH=HPID$hƀI|$XcLE1XLHHR|HHVH3MH3UH HNHVH3MH3UH !fDHHt$(Ht$(LPSID$hL5H1IHH|$IHPIHHD$(MwLIGHD$Mt$hMt$ H@ID$`Mg M|$XMd$M$$1I|$ Ht*L?L9t"HGIGL8LM?L9uI|$0Mt$(Mt$ Mt$0Ht'L?L9t@HGIGL8LM?L9uMt$8Mt$0D$&fDo+osl$8t$HI LLv f.LHVL LǍ1ɺ 1LL1ɺ 1LE1?L1LE1 kQIL6 L1 ;ILHP LsL1ɺ 1Lf.H5 HB!H# H H H H H H H HHt9~HHt#}HHH@1HfAWL @1AV< AUIATUSHt$ H5H=HtHoL%PM1DIT$ L4MuAnfDHUhHEPƂL}XILHR LHMt/LM6HjHUH9tHMHJHHmHmA;\$rH=VHH=Ht:HH-X L%Q H]L9t|HEH}HHCHLH@H4H(HHHL9uL9t$L 5 1T H5|H= H H- H H HH9tHGHCHHHH9uH=n HW H-` HQ HB HH9t%f.HGHCH`HHH9uH H H D$ uH[]A\A]A^A_tiI]xImxH9tL%@HS81IMHLAuLy1ɺc H5^HH9uH[]A\A]A^A_LC1ɺ_ H5(sAVIAUATUSHI~LI1HI1E1IdžH)HfD<_tAALD%H9s AD-t։ڍKAt͐[L]A\A]A^[]A\A]A^SH.HH{HI1HHHǃH)HAtJ11'fD΃31t,BHAt<_uۃt#vэBHAuƃL["fȃ_[AWAVAUATUHSHdH%(H$HH9L5 AHtLpDE@ExnEDE`ut?AEDH$dH+%(:HĨD[]A\A]A^A_HEDZAąw=(E`@F DADLDD1DE@LE`EDƒH@D‰ƒU` EumH< MH5- H  HDL" HDH H HEHVH5fQP1U`H AU`LO8Lp0 H5eDAA % Ѓ=m9HA1P1E1AYAZQ@ E`AA@Ld1ɺN1H5ceGfkINjE`A?s@twAE+H1H5 eMPL30 ~1Y^M`E1ML/ 11UH5dDL1E@fe`MLY 1xH5ydbD}@H}xHE8H9D$(M1L-6dLu/ LHxAąE1DHMPL/ 1H5cXZDAALE`D1 E@ywE`RD1MGL2. H5mcQEDQfU`L,1ɺ1LMm1L H5cVff.fH#It mtAL 1H5+~ +HDL- 1H5s#BAWfAVAUATUSHdH%(H$1 )D$P)D$@D$P)D$`u3AH$dH+%(HĸD[]A\A]A^A_ÐD-IHEIHL5KXLIL 1 xH}u EcRH DEt1HT$@HLLH5F LYHEPHH8HHfHT$pHHǹ)D$p)$)$ADžH;EdAH=  t6HL$HE1E1j1HLjjH t D$HVL, LI 1-f.HHtHH9t @3 @HL$HE1E1j1HLjj>H DT$Ep@LHI9HD$HD$D IwEuPLd1ɺ 1LAESL<1ɺ L1E1 .HE1E11jLjjHL$(yH tDD$E M?I9_Ec@= 2L~1ɺ 1LADH8UL 1ɺ IH5~1dlEcLL~1ɺ 1L3fD11L ~+H5GL~11LH;"GDEc@1HHH\$LxH9l1fDIpIGxLxH9D$u݅9HTHLL( SI1 =A[L7}[1ɺ L1+L }1ɺ1LE1UHWADž9H}SLLI 1DL|1ɺ [DHL$HE1E1jHLjj H t$t L$C!AWAVIAUATIUHSH8dH%(HD$(1uH0H#B`wAT$D-k AL$HEfL=  HLDtHE`H H%HDRHL IAW5 H SL=u{PL1[AD$H LMH1HtHLAD$LHAD$$ 7AŅH= #LHL@FAHD$(dH+%(JH8D[]A\A]A^A_@ AT$Lz1ɺ@ 1LxfDF1fL% H  HLDAHDPAT. 1SIL 1H5*zXZ8f.H$H HHM HEDHHE1E1jHLjjB H !D$EDT$EQAT$HLL9uf.HL9H{1 u1ɺd LLy8L y1ɺ_ 1LfDEL$EtEd uVDD$E=At$/1H 1HlHAŅG@Ed tH=& _ff.@AWAVAUATUSHD T dH%(H$1D$<Eu4AH$dH+%( HĨD[]A\A]A^A_fDyIHVEtSHH~ LHDoNH1ɺ6SIH5wLj 1Y^kIHL$pHE1jE1LIjjH AŅT$pD$tt"t.H5' LA!P@fD1L^DmIF`EtaH0HuRAt EEu;LML" OIH5v1EIF`@AGa@L4BHD$HHHL$IHH= HD$(HIH\$@IH\$HH\$@HD$HL$ H9I@HD$H@HHHHL$Ht AdI9tSHD$LhHM?I9t8IGLHxH(uHD$HHD$H;D$ L|$@DH|$(衂IH6HD$I~PHpH裂HH@IEHH|$@tHD$HI]IEHD$HL(Ll$Hj(H@XHD$HD$IPHpH0HHxHHT$pMOHHEH)1LPOyLH1ɺ H51J A@fHc;L1HH)LO6LG1ɺ fDAHD$(dH+%(uzH8D[]A\A]A^A_É$1ɺ LmGH5~ D $LSG1ɺ F$1ɺ L1GH5B D $vAWAVAUATUHSHHw40dH%(H$1wHLhL5# IMM}MH5sGL蛯M}L-11LML'A1HL譚eL}H$E1PAƀ@HELd1RLjP1I H EAH$H86H$)oL=HL-cHLAWI1LAL蛽XZLeE1ɺ1LE1 H$dH+%(HD[]A\A]A^A_@HELa1RLjP1F H Et:HeH Ou4}0HD1wAąEHHH 4u4}0HD1wAąLnD1ɺ1L yH$E1PAfDL-<1ɺ1LDLc fDE11ɺLLC4 L^LC1ɺ1L 般AUATUS1H(dH%(HD$1D$f\$u/AHD$dH+%( H(D[]A\A]H)tHt$ )AąDDl$ Et)11 D=eDl$ D*AąHL% FA1AUL L  Y^H\$fD諪8HDpxD+Af.L1ɺ^1H56 i1ۋD$0u  AA8Ht$$H={^_"Hg^HD$ E1I$ D|$,I@MM6L;t$MMnMt{M9tEEIuEtEHI$H uLILD|$,HtDD$0~fDH5]HD$LpHL;t$sLM$D|$,H1ɺAD$pL`H5fD$4I$HD$@AD$4AUPAD$0P1LL$@ H IHH|$ /趡H=Ht$ HPL5LL$ L&H5 L LAD$4HA$LtPAD$0H5ˣP1LL$@ D$TH LٿLA讴EtI$IDŽ$ID$AD$A L$$HAT$4At$0ML$E$A$I|$PAD$pPI$HPhH 2Dt$4EA$E$ElHD$Ht$\D$\H$AEu"L;1ɺ 1H5 HD$D$4E1HǀMt;MmL9l$t@Mt;MeMt2E$EADŽ$MuHD$LhHL9l$uT$4L;1ɺ1H5B uDHt$$)\YID$HD$ H0L:1ɺf1H5 L|:1ɺ1H5 fED$I|$Et1Hu3L8:1ɺ1H5@z DH=YHt$$Z[I$Mt$AT$4At$0I|$MDh#AD$4ML$L-x PAD$0PH51 Y^D$4Z /LD$@ɠHlM1LgH5< L$91ɺ!1H5,f L.fژ Ht$ L=/LL-& VLwIH51AD$4'LL$ L|1H5 ufEl$D$4EUE\$ EGHt$$L%xD$4$L81ɺH5 I |L\HH3A}L 1H5; rAD$HME$A$AT$4At$0I|$PA$PI$HPDdH AD$4ML$L0+PAD$0PD$41|$@,L$@I~XbL:IFXHHt$8AF|LAdžT$,H!LѮM1LqH59Ԧ GHkLT$`DL$@ALLH5pLT$H*LT$H1|$@AR'H!L PLLDH5L91LT$HAUG XZLl$@H5>3LHD$HWHT$HHJH1H-8AUL HL"< ^L5_1ɺH1ĥ 7M"1LH58 M/LH5j8n @UHSH/HHSHt^1ҹHH|HtH[]ƅI1 LH57 H1[]1IH D HH;yf.AVAUAATIU1SHuKtH;@u[]A\A]A^I$L3Et.HfL3EtHHBDp tID9u[]A\A]A^ff.AUIATIHUSHHHH}HLHlHDIH;H5oH4SHDHHSL \LLtPH1AUH HL[]A\A]HLHRHCIHt HDS1IAUE1LH5ߧ XZff.AUIATAUSHHdH%(HD$81HtYHHH[HtAHf11LH)D$)$HD$)D$ =HtHP tNH1MATLo1ɿH5/S XDZHT$8dH+%(uJHH[]A\A]HD$8dH+%(u,HzHHD[]A\A]*Hf.1Hzff.@H YQHL@ LDH@HDH@HDL X@LDL@LD@tH :H5HDHARRHkP108H(ff.AWAVAUIATAUSHC9IHHx(YAHHfH@ @AtAt AD$waI~ AHHf@Mt3L“I~LxL@HLLH諜HEHkD#I^HL[]A\A]A^A_f.Li1yH5A̕I~E1@fDLI1H5 蔕fHEL1H5dfATUHSHHdH%(H$1OIH#HHȒuC>8EH$dH+%( HĠL[]A\ÐH-41ɿ1IL2H詔L&uIٹHL|af.ۓ;IٿIH:NHoHDHH ץ APH5LQP1H I|$E1L>LW1H5Qܓ–fAWAVIAUATMUSHHH$H|$HT$L $HD$dH%(H$HGtstnPvfH@HL L1E1H58H$dH+%(AHĸD[]A\A]A^A_@C`t H<$H$J,0Hu聖IHu,1E1LH5'貒uHt$LLHE1GH<$C`H|$O$7DLLt$ϦAL$L%A9$HHt H9L @ HL濄1t$L;1^_E1L^Iv{IHE11MGMK,/M)fD{@LHbHcЅ“8tۃ tHHoH90LJA9H wHE1PHL•PH51Q"H L膎-IM9AE9HD$(LhLօDE1HDHLH;Pu90LHuD\$ L$HT$L$D\$ HT$DDDD؃D9vEGHD$(HHD$(H9i @HEL#HD$MeL9 A/t[Ml$ALH AD9r7DHLH;Pu0LHt$HT$CHT$uDM$$L9ufHEHD$MAED$(jHD$HD$ fDHl$ H9RDt$IMMfHmH9+L}LGL9uA6LHt$L菂u˃D$D$;D$(vL?H9C HH9uHH9HP:uL9u@M$$L9ID$8ux{IF8k`HD$(H@8K1M9MT+ATUSH1HPdH%(HD$H1HH$x0Ld$HLHtLH3 H褋u HD$HdH+%(uIHP[]A\@HT$ )HHcH<HcHiMb1H&)HZ&yff.@AWAVIAUATIUSH(Ht$^HItHźIFI9rDHH9t<( tHIL$E1E11HL$1Yf.x?T$ 胂T$ IHMAD@@t "t_ DHD$AB AGIH9s,At#AL;d$sEu uAGE1IH9rH([]A\A]A^A_fDAWIHAVIAUATIUDSHHLD$H8IHHL$fIWL IELpHHH@H@0@ HIUAE H9u HH9tHPL;"uAE LjH;HCH|$PI]IEL(LktHt$PL.H[]A\A]A^A_LUZH5KEԂL<11LH5E覂1]ff.fATUS?/Ht0I}Ll[H5]1A\% @HIHپL|/L <L'MDHHVLE1N#x []A\DIٹL${AWAVAUATUSHhLT$L$LL$dH%(HD$X1HHD$I9IELt$ IHLt$(DLt$ @ucAąuWLLxIH518HD$XdH+%(u HhD[]A\A]A^A_f1ɉHLAPAąVIEAuLHH ub@IPD$0CAąL1ɺ1H52臀Jf1AtLHm(IUHHB HHHLIULS\DHEH'r 5&H|$0HH RHDH1 !L1ɺIP;Aą1LvlAąIEH@@ -D$HE 'D$A;ELLIH9T$HJAAtDJLH PDd$L1LLoE)~HL$E1DLM$Uw^L^_AD$AELHMHH'u  AE$1ADžAuLAAEPIGPHHHˆH9ufDH@H9@tIE@L1LKAąHM|$\H'r f.LHm(tIUHHB HHHLIULS@AH@IED$1L1LA1Aą?L$HEtHtLlAą,1LǹAąd1L[AąHEA@1ɺHLp{ApL1ɺ1H5*|Bf.Ll1/AH5MF|IE1L8H51E1|DLHm(IUHHB HHHLIULrSH5c1E1{AXAYrf.L蘺Aą L1ɺ1H5l{/AE8LJ(kLJ(H5LD$LHIEHP HHHLIHSLf.L1ɺ1H5Jzbf.LHm(4IUHHB HhHH\LIUL"S{@L 1 LLszLRL AL1ɺ1LοyIGPHHHˆH9tfDHHBH@H9uLi1/AH5JmyIE1L_"fHT$L1LޑAą#L/1ɺ1H5yDLJ(LJ(SL1ɺ1H5rxfHEL1ɺ1LֿxVfDL0IUHHB HtfHHt^LIH1SL H57xXZL,1ɺ1H5xLJ(LH(L1ɺ 1H5wL1ɺ1H5_wwzf.AWAVAUATUSHhLH$T$DD$HD$dH%(HD$X1HHD$I9ID$L|$@AL|$HH$L|$@A9H$HVHHHEH@HtA@E9L$LXt.A|$LAEDD$DHHEH}P1H[cCID$H@H'DH$@t C@xD$EuA$$EuEt$8A$D$ AD$$D$$ID$H@@u :HEPHHHˆH9u;H@H9+@tI$ID$AD$LHRJpAL$$MpAL$PADŽ$ADŽ$A9HHH9T$HrFtJLHE麢PHA)L\Hƹ HD$81uHL$E1HE1D$vm_AX[H$H@H's1LH H}PLۋ1L$Ht$(1qtD $+L 1GH5DtE1ɐHD$XdH+%(/ HhD[]A\A]A^A_f.E1ɩAAE9L$L c$L 1ɺwH5y1sD $fDHLk(dIT$HHB HtsHHtkLIeH$H[(H@ HHHD $LD $SWPLJH516mL21ɺ11LH豅XH$H@4@T$1LHkt$L1ɺfD$L1ɺ L1lD $OH[(H3HLSIMHLT$ LIHHHD$(1)lAD$LHL$8LHT$0pObLT$gLT$HH9D$H4$|$ Dp8Hp$|$$xPx$}pH;Al$L1HHt$Yj\Ll$0H5I}H kH5HLT$8IzHL$jHL$HHS(LT$Ij`"Im`!AD$LH$H LHT$I1RHt$8jAD$LLpt$Y^k'ME`4$1LLIME`\fLT$LtGAD$LLL$Dh+'L$1DLMB`LIMB`fL$ LHt$(LI1AjHt$(11L4"jD$L1ɺ[L1ɺ1LֿiE1$L1ɺE$L1ɺ $L1ɺHt$(L1ɺ~ivH\$(11LlHWiLS11H޿:i2Ht$(L,1ɺi$L 1ɺVk~HHL VLH5\H ЋHćHH‹ PWH=n55]H8AWfAE1AVL5AUIATIUSHHH(HL$L$ HDD$ LdH%(H$ 1)L$8HD$HHfD$fDOIѺAPL/VLS4r 1ҾH iG1H$LŹlNkHnL6h>IL1L21q l$0H|$P1H1H5t$Ht$Ht$HDYH$D|$pL$HD$(H E L\$H1IAW6LL;>q AZA[`E1L\$AE1E1^Ƅ$ ML1L)(E1p `E1AŅHD$E1E1E1L\$Hp LT$th8eHL PH PLPH5ZLjP1L\$8LT$0H MtI{LT$#H|$IcLT$LI]IE1f.HS3LHAH9uL>P[D]A\A]A^fHGHt H L[D]A\A]A^fHGIuHtH IUAuL=LD`O[D]A\A]A^DIUAuLAO[D]A\A]A^@EeEUE11ۉLHIDHP0AA;]r&@EeEE11ۉLHIDHP0AA;]r@EeEE11ۉLHIHP0GAA;]rE1AWAVAUATUHSH6H9IHHcH>LuA$E|EA/@H[]A\A]A^A_@A$LmHHAttHIT$It\ A$HATuA]SAU0wHLD$XD$@LmLIuE]ESIUELD$HUMD$3fDLmHL)EMA9AFK1DHH93A\A8tfLuAA$1H9AA8T6uHMnIT$L5DHELExAD9?A[LuAIA$1 HH93AA8T6uHMnIT$LtiDHFD2EAD9pAHLD$VD$DLA9LHGKuGH1[]A\A]A^A_fDHULD$RLD$AEnfEUESELD$KD$;fDAIIT$HHeDHB2A$IAD0IV /w A8s HH9uADH߈D$VAPAHLYUD$I~DD$VADLVAD$[LD$JED$2I~DD$HVADL5VAD$AWIAVIAUATIUSH_HHGIAnHtHX;(rv^HXHHuM,I(MHthfH@ @(HM9u;L` H[]A\A]A^A_HXH@HtpfDIHXAnfHH11[L]XA\H5\A]A^A_%YV fAWEAVIAUIATUHDSHH8DHA8A9wfHSEHDSAHD9tH;uD9w2@HUEHDUHD9t)}u1H[]A\A]A^A_uADEu,֐EtHEHSEHDSHDEHHAtu'EuEH{HuHE{HEu@8u uuIImfff.@ATUSLgHHO I9A$Il$<^&<#~*P܀:w"H5cHcH>fD<|H{C1HkHHDA $Hs []A\H9L1H5$LQT C[]A\DHkC[]A\Ho1GHHHnCHCH[]A\HHHA|$^1:C1LS L9z1ҿfAD!IiL9[M]\-AIAHHKuD HoGHHHBHC`[]A\Ho1GHHHhBHCH[]A\ULMrtn}AAHFLMM9|M8|ЉʉLCI,A EAD#]AEÃE8}DA A I-A A  I9HCHkID$G1HGHHH AAL$rtFtt!nt,Hs 2HCH"HCHHCH @Il$@HC`O[LǕ]H5H1A\%P ff.AUIATIUHSHH?Htwf@Hþ1fCH}LYHHtJ1LH(H߾PxTLeIm I]H[]A\A]L1H5h+P H1[]A\A]fDM1LH5-O H1[]A\A]AUI ATLcUHSHH? HtwHH@@ H}LHHtL1DHH߾ BxVLeIm I]H[]A\A]fLa1H5XO H1[]A\A]fDE1LJH5N H1[]A\A]AUI ATAUHSHH?HtwHH@H}LHHtP1DHH߾ 6xZDHEIm I]H[]A\A]L1H5H~ N H1[]A\A]fDE1LH5 ~M H1[]A\A]AUI ATLcUHSHH?HtwHH@@ H}LKHHtL1DH|H߾ "xVLeIm I]H[]A\A]fL1H58}L H1[]A\A]fDE1LH5|L H1[]A\A]AUIHATUHSHH?LL`LHt-LHHHHCHC H[]A\A]1LRZH5h|+L H1[]A\A]ff.HAVAAUMATIUSHwHHubf9.tL@Hs(H HtKuƒtDtMLDYt[]A\A]A^@Hvf.[1]A\A]A^1fATIUHSH?H HtEfL`HS H{ HhtWHHS(HPHS(HHC(C[]A\1L:$H5AJ [1]A\7>ATIUHHH=LHHIHt!H@H@ HL]A\fDL?1H5@E1I1LRH59>LE1L%11H5}>@ff.HHtHff.ATUSHH $HdH%(H$1H$HH荢uIL1ɺMH5G H$dH+%( HĠ[]A\fDHHu@xȅuMH-|H^9t E?8ufILHH1ZJG |D[H-*tIL1HQ1G DL%G uOD$%==`Mw1LH5E ]L=gEpLHAH1IAVLL +E XZ@EuSLL=6y<8M1LH5D DtLH=y{<8HIL1AVH5z1wD AY1AZH9F@+<8HLIAUL1(D Y^H$L`7uP$%HHLI1AVL1C _AXT;HC 88$ MIHHH-HDHH JpAPH5aL=QP1H 2;ff.ATAUSHH=<>!dH%(HD$1H$>!JHH=Zs HIHDH6HL%1It$LLsB XZH<$:P:H-yB 87;H(,H HDHIPHwLPLd<1RH|$ H 3HD$dH+%(ZH[]A\L%1LޙLA H<$:H<$^3@ fDI1LH5> $L="赴IL1L-1l> HY> d3$HIIH'H \HDH)APLF8QPL1H L%= 2LIPL51SAԋ|$9X1Z1u{5H= 82$HIIHA'H ӂHDH>APL7QPD5AWAVAUATUHSHH8D$pLl$xT$L$D$$$DD$D$($DL$ D$,$D$$D$0LI/LHD$ r!t L=Y L%Y M7M9DfDH|$HR.IHXLxPD$HAD$ D$AD$$D$AD$(D$ AD$,D$$AD$0D$(AD$4D$,AD$8D$AD$LDD$AD$H6/HLLpL48M|$LM/LLHP8H!M|$@H= Y HY LH=+I$HX ID$L L%X H8[]A\A]A^A_٦fIwH4\IMM9IAuѐwL=X L%yX M7M9IwL3t'DIMM9qIwLI3uLH=V7AGILH !,IGHBH-먋! ! !L=W L%W M7M9uDIMM9IIwH 3uLH=觥AGILH 6!,IGHBHB-H ! ! !DLH=pQAWH!L,IIGHBH,?L$1DED$L$D$ -H8L 1[!]A\H5~A]A^A_%|9 ff.HHHtIHH֋HPLQR! !DH13H@SHdH%(HD$1t_,fuHD$dH+%(H[tHt$M *u&LB1ɺ H58 @t$uH AٹSLH5BF8 XZZ0f.AUATIUx5L-A1ɿ1LL7 'u]LA\A]*fD/H-7 8,HLPH,}PH_!L }PL11LH ]A\A]*ff.AWIIAVIAUATUSH8dH%(HD$(1HtHMtILE1ML-HÃf.&4IcDL>f.ItAFdMtoHI 'u_؃HT$(dH+%(H8[]A\A]A^A_A1ft7Ht-DHH 'tLA܍MHÃ:DMif.Ht$ LHT$LD$L$ L$ LD$HT$DIHHfDqDLHT$LD$L$ zL$ LD$HT$'LHT$LD$L$ L$ LD$HT$LHT$LD$L$ L$ LD$HT$LHT$LD$L$ 蚎HT$LD$L$ LHT$LD$L$ wL$ LD$HT$gMIL9L1@HH9uHT$LD$L$ L9?ICH5pgHx(-L$ LD$HT$fDMIL9qL1@HH9uTHT$LD$L$ L9i?ICH5fHx({AFdIH IH9HxXHAFdIIH9HpL;vXHH9uIF`H!IF`H"IF`HIF`HIF`H/IF`H.IF`H'IF`H&pIF`H `IFPH@`H L@IF`H68IF`H  IF`H3IF`H2IF`HIF`HE1E@IF`HAFcMI?H,fIF`HpAFbcAFcSIF`HCA**f.AWIHAVAUIATIUSH(MtIHtHE1ME1AL5CMLHIL9IDIc4L>H@H5cLL$HT$Hx(D\$L$y)L$D\$AHT$LL$E1D:MLAHI t_NfDH@H5pcLL$HT$Hx(L$D\$(L$HT$ALL$AGMuAH(D[]A\A]A^A_DH@H@H$T@IE`H?@IE`H0IE`H IE`H&IE`H%IE`H$HH@H#xH@H@HH@H@H@H@H@H@H@H@Hl@H@H@ ^HeAEd4@IE`H1 H@H@H% @IE`H-AEfIt0AEdu)AuMAH@@uvHDLHH HpFxLIlAEdaAMDD\$HuI^AEdSAb?Aff.1AT(‰1Ҩ0AƒE‰ƒ@E‰ u E\t IcAAA~IHtULuEuAE1fDMcLB<IL1LHfDEu3H$dH+%(u@H[]A\A]A^A_fDE1bMcHH5:o1B<b"ff.ATAH5bvUHS"uPHAtHcH  HH)HTHtQ[H5]1A\f.H5H!u5AuH HH)HTfDH5HY!u5HApAt Ae>HQfH5H!u-HA(HAH5|H HqAH+Aiff.AWAVAUATIUSHhH|$L$dH%(HD$X1AHLl$ f1L=LmHL1L)D$0LLD$)D$ )D$@HD$8LD$fHtHH@ Ht?8H5 M11Ht$-L.$' Ht$ DH5H1ɺ1H~L lPL 1& A_XMLsl1E1H5AVHD$XdH+%(HhD[]A\A]A^A_H@8OuxKuDxEuH11H8lL)D$0LD$HD$8)D$ )D$@HtH@ HtLD$ɉL$HL k11hLD^LH5% A]A^M1LkH5AjDHIE1RL/H5@3XZ@H@HD$=tD$AHttHL=;kf11LL)D$0)D$ HD$8)D$@軿Ht>H@ Ht58ML,11-H5$ MHf11HkL)D$0)D$ HD$8)D$@AHtH@ Ht (H1L j1jL\LH5[z$ AZ1A[AHf11HjL)D$0)D$ HD$8)D$@þHtH@ Ht DE9HLV\11jL AjLH5# _AXD$f11L)D$0AFHHjH)D$ HD$8)D$@>HH@ H8H5nI11Ht$-L;+u# Ht$HH11S1L iLhA<# Y^HD$LHxyHHtLHHCHINHM1ɋD$L?iH5>AP1yXZfH5T@HXHtHLhlfDLxMH5rhLHtMH5hhLHtMH5YhLHtMH5GhLlHtMH59hLTHtMH51hL<H M f.@D$@@dcATUSH@5ldH%(HD$81t lu HD$8dH+%(H@[]A\HHHtH)tH56HtL1ɺN 1LgH5e<Dc(HH'H|$jATL%{gLc1RLL 1UH THl$HLE1HjT$ HH;LD$Ld$0XZHt H}HD$8dH+%(uH@L[]A\DATUSH@DqkdH%(HD$81Et 5RkuHD$8dH+%(H@[]A\ÐHL%fH|$E11LcH 2L13SHl$(E1LHHjT$ HLD$ZYtD$ y$LVf1}H5:LLd$ Ht H}yL6H-:1LzHHD$8dH+%(u(H@HL7z1[]A\AVAUATUSH@D jdH%(HD$81D$Et DiEu(HD$8dH+%(H@[]A\A]A^LLHHLHH|$jAVLc1L RHH AUL-RL1ATQLd$XLHH(jT$ LLL$LD$@Y^D$ ty4Pi1L {{LVH5+9XZHl$ Mt I|$躽HD$8dH+%(uH@H[]A\A]A^AHtHHtH9tH@fHI AVf1AUL-cATLUSHH@dH%(HD$8HI1)D$L)$)D$ HD$謷Ht?H@ Ht68H-M11L$-H H-HHZ1HPL {b1L1 A^XHf11LL)D$)$HD$)D$ HtGH@ Ht>8H-<1ɺ-1L bL$HA H-HHH1PL a11L+ A[]HH-f11HL)D$)$HD$)D$ MHH@ H8IH-z11LY#-H HL5x1HAVL1L 1T _AXHf11LL)D$)$HD$)D$ 訵HH@ H8 H-1ɺ-1L `L"H HHCx1HSL w`11L׭ YI^H1AVH-L~HXZHxH5{fWHH11HL)D$)$HD$)D$ 訴HH@ H8H-I11L!-H HHGw1HSL Z11L۬ AYIAZL|~HxH5 fHH11HL)D$)$HD$)D$ ȳHtCH@ Ht:8H-I11L -H  H-HH_v1HSL r11L A\IA]L{{H-1H:=7 HD$8dH+%(H@HL1[]1A\A]A^ LHf.H-S@H-@H-7@LH^LHPLprfAWAVAUATUHSHD=G H|$ L$t$(dH%(H$1AHG8AAEt=ȉ$HmG L$Ht L$HxLLII96DEEj jAE1%jA1D 1L PHD$XH H? D$Eu>E1H|$8H$dH+%(HĨD[]A\A]A^A_DHD$8H@PHH0HL$XL$(ʃtD$Eb tD$E DHt$XH|$ IEHL$4DD$0$BHD$8D$,L5aH@HD$HfHD$HHHHhLhH@ HL$HD$MD$(L$4T$0 ЉD$D$(tH5LALL.D${tH5_LHD$ E111 11HP8jjAj A%A 1PHD$0H HuSI M1HL$pHT$lLLL$xLD$tH5prbYIH HuHD$HhHLeL}Hm MtLL0 xH5^L uM,1HL$pHT$lLH5ot$p|$l1QHwH|$ fDLL AąuVH=quHHHt$HT$xHHD$xHX艳 H5_qL 4H5L Aą|$,t.H5VFL tH5>FL D$,H|$(D$(t t$,A'E H@HHHP(HpDLt$ EIALw!ADžEv8cAĉD$0ÉD$4gt$p|$l蛦t$x|$t1脦f.H=pHHHt$HT$xHHD$xHx8HtH5U Hϱff.H=o_HHWHD$ E111 HP8jjAj A%A 1PcH IHH@Ht*HxHt!1HL$pHT$tH5DMH1AHD$(L5LvLHP8A A%A кlP1LH踰A[[HD$ HHH;D$ LHt$XdL5nAUL1/AXAYfDDa/ E? H$1H|$PHH=mHD$@HHt$H|$@HT$x7HT$x1E1L=zH\$HDLd$ DLHH1SL tLgXZHT$x;ZHrH@H8AtI$HtL9uL G DHD$ HL t1HP8A A%A кAP1H5A_XH|$f.H\$HHD$ E111 HP8jjAj A%A 1P裊HD$hH Hm L`MLl$PL=B+I MID$I$I|$Il$I9Md$ H9!H„tHtH5"LHcHt@tH5*HIHt@zH\$ HH H9 LHL5L.t1 LeH|$HH|$@葭H@LD1ɺH5d)Ha@L1ɺH54H1L1ɺ1H5 LjE11j11 j$PD$ՈH IHHpHtHvHT$xHHD$xDP0E$@8LoHw(L.1ɺ1H5QL5;1ɺd1LLEkHD$ HLq1HP8A A%A кHPB(HB08AgHL$ HHt H9L L&p1H5IEL=1ɺhL5b1LHUH\$ AHC8 % H HH9LIRL51ɺPL,q1LHHD$0ZYHHt H;D$ L t$X\LpAU*Ld1ɺ7H5ILl$PH|$HeH|$@kL5UL1ɺLHD$ HHH;D$ wLHHLnLt$`3L L1ɺ1H5֚H|$@̩NL1ɺL51LcH|$@虩P1ɺE1LAH5m2H\$ DMAHHt H9vL ' L561ɺ{1LoLL HYELǘ1ɺtH\$ HHVH9MLHHt$`LlH51n]A\H\$ EHHH9LHt$XWLmAUH\$ HHH9LHHt$`L5lH5$1AYAZSH|$H\$ HHH9LHt$XQLeAULHLHL  %LHL  DL5M1ɺxLAǿLB18L`HhH$HDŽ$H\$PH$H$HHDŽ$HDŽ$@HH$D@H$1H$H$HDŽ$H$H$ʝL|$@L IHH@fHLHXHH{t$nH$ID$pH$H|$PID$H$I<$L HD$xL$DŽ$ HP0BRHH H H%H 1H$6  @H|$@L5蟥VH@L j L ^ +L R L F pL5P1ɺ1L LH|$H# H|$@)L1ɺXH\$ AHHH9LHLi1.H5̕L  Lw1ɺH$HHLHLHHHHH)H)Ճ&1҉փH|5H<19r L / ZH\$ HHt'H9t"LHHqt$`L+jL  Lɓ1ɺAID$L1ɺ%TfTxC$ۉTT\AULcATUHSHHHdH%(HD$813 tw@HcIH=}3 H L HH ȉ$HtLd$HHLNI9E1HD$8dH+%(HHD[]A\A]DIjE11j1ҿjVL~H IHD$$EuL H@PH1HAHHuD+E1tyKH@HH;Hp(H1HAH!D+fDL1ɺ1H5E1H@DHAHuSI1HH nHTxĘAHEx [1L:hH5.L1[AWAVAUATUSHH $HXL=+ dH%(H$H1Ld$@AIIHI;LH$_LL*_1ɺ51L1;ŅI?L_HIƅHcL11A>IEAnwH$HdH+%(HXD[]A\A]A^A_1IMLH}^LAx]1L1qŅ6E18HM1PHL|PH5x1_AXTL]1ɺH5x1E1|(8E1M1ɺPH(LPH5Rx19LA>M1PHDLǏPH5x1XZ@[1MẵPHU]E1PH5wL1Y^Vff.@AUATIHUH LLhL*IHtRLHHE11LL\H H-H5+^HtL]A\A]f.Le1H5f.UHAWAVAUATSHXHLHdH%(HE1HHI9 AD$LHI%HHHH)H9tHH$H9u%H)HDHE4HWHrHID$H@ <HHHHH HH(H H0HH8H0H@ctH@PHH&uHPAŅsHHH9XH@@Hb:AŅHbLcIH516HUHr9HID$H@ HibIT$HHB HHHLIHLbSH51gA\A]E1HHHH4HH1HH5?AŅHaYHHHL%oLbLHCPLsH1AXLAY1Lb|HCPHLLsH1LbJAZL1A[Lb&L1Lb7@H`LIH5z1HEdH+%(HeD[A\A]A^A_]HLJDLJ(HLu1ɺHHƿ1UA\$L[Dž1kf.t:I$HHDHH`I$HDHH`AD$L9M$H@H IHAucI$ …PLNM7MmM9tfIvLa,M6M9uI$HM/LtM9uTMmM9DIuLatfDA|$LHHMt M;?HA}^= HHI1L1a 1A[[DHHxP#`1ɺAL]H5N|fLA`H5ɉ1E1G@L9^DE;[IT$Jt ;|B DžE11M/HRHHHI$H\M9uyfMmM9tWIuH_t烽DžAL$LA A9si1D1AEpI$HM/H\M9uMmM9IuH__toDEHuAŅv HH;LL#fDH{gHL9IEPH{L8HLu1ɺAL!H5@I$HH\CbI$HHD@bzHHxPL AŅ HH1AŅLLLE1HHLAŅ AFcDA`HLL90A~LOHE1H@AE;fL8DL,@JHHILlAEctII9u@HI9tHsL$]tHIHDHHH1HH9jf.HH9uLHIDžHD@ct @pH9t9DH8uH@H@tJ$HH9u؉LLsYHD PH5L1L]DLMY^L9DILMDL=LIH LN]VPH5ڄ1-A[A_M6I9IuH@LxAuAA+D9LXIW@HtH Ht H9jL bHRHH1ɺ`1LH1ɺf1LuE1eDLLVHEL[TPH51HDH@PHAXAYeHWHHILZF.1E1LLZH51H*WHLPL"ZH5HLLVHHJ@HHHH9LJHQ PLN1H5HXZMHH@PHL1ɺ91H501ɺALmH5^L r IHUHID$HP H.HH"LHID$@HE1SLLXH5RP1H AD$LPM$I$HRH4 I Ha`H HHa`H9uߋL@1MtpDAD$L9[HH4Ht L4MtHRI$HLlI$H|[ahLLHaUAEbtIIH9LHLIMHH?,H@H1߄L}1ɺMLHPHHHH@PHxIH H8tAALLk`IMHHKL19L|1ɺL[LhHLH@PHxpIHA7AEtAAAHL_ALl|11H5~O}LF|1ɺH5~1)L |1ɺ1H5~1HP(HAŅAHrRLVmIH5H~1LU1=H5~rHRLIMIH5}1:hLHH@PHLLH1LAt$L+M7AŅ}HLH;uHH;IFPHsH80WAŅuLz1ɺ1H5#}xIIxLHIDITITLH)ALH)HIIxLHIILILLH) H)HAD$LE1yML!@IKAD9IIEAKTmDEuID EuL L;IIBH5LHHBHD0LHK0IR1DLLLB`LAIz襛L0L;IIBH5LHHBHD覻LHIMIR1DLLLB`FLAIzAGLMHHHDžBoHH{L-x1ɺH5zM;?Lw1ɺ 1H5z Lw1ɺl1H5cz*Lw1ɺdLw1ɺ1H5%zE1wADfAD9HNLRIH5y1.\1ɺALwH5y5AAADADECD/fCD(MI$HH\HM_MIHSMLȭWISH5)y1|Y^1ɺE1LbvH5xSHMLIHLAPILKS1ɺE1L vH5x(AEACD/CD(SLu1ɺH5dxVfATUHSHvDHAHRDEL%ZDHLqAH6DEtmH5!DHSAHEtSH5DH9ALEt9HFHHAHCEtHHHݔHD[]A\ATUSHH-8Iu L[]A\DH@Hh HCPHHHxYHHtMHH CHHC1L%e{LI[]LA\ff.AUATUHSHHHGH9HHP Ln(HtYHHtQIH}JHILOAUH5vATP1H H[]A\A]@L`(f.HgJHUIHB HtwHHtoHATIٺPL O1H5vpXZH[]A\A]H1[L8O]A\H5uA]2fHB(f.AVHGAUATIHHW(AD$ UHESH8+HPI$IT$HPL"L`HtlH8HHL5 EHLJ1DH)J|5Hkyt'LH{8LLPtY[]A\A]A^H-1ɺ1LLrH<1ɺHL.r[1]A\A]A^LAH5dː[Lq]1A\A]H5A1A^ftXHFpLFpHI9t^H9PtL HL9tMLH9PuHH@HAH HBH@h@HLHI9uHNHHHBL L@LNMH5FH@HQҺPHf*LE11HHHH9HB`ff.AW/AVAUIATUSHLHLwPLLt$M IHXHIDI9ufDHmI9LuHIFHxHGuMehMtIt$A<$LiI]pM}pL56L9uADE$IEPHHBH@hHL9t\HSMt E$EtIEPHHS:HBuHHH9HHB`L9ufIEPHMHUH@HQH H@HHHuAHUHHH*HHHD[]A\A]A^A_HxLċ(D$Ln1ɺH51DL$ID$H1LLKLHHHBpH1AXAYD$Ln1ɺfHD$H@L@I9ugfDHmI9tXHEHH@HxHCuHD$H 1LKH5ELAW1 XAZHD$HH5L{JLAW1YE1^zf.ATHIH@dH%(HT$81H|$HHH=zLL$HDHt$ H$HT$PHT$PAEHD$8dH+%(uFH@DA\fBT@Ll1ɺ 1H5AWAVAUATU1SHHHH$Ht$T$0D$L$4LD$(LL$ u LMHtxHD$D$HHD$@EH[HtH;uLKAY<@tUEtLI1ɺH 1H5H[HuE1H$AHHD[]A\A]A^A_@AyUEuAy*MymHD$LHD$L9LH\$8LIfDHI9HsLXuH\$8Ht>LuL9IvL1t!DM6L9IvLuH$Pt$H$1L?dD$f.ELH1ɺA H5\LG1ɺ: 1H5o3f.E L`H1ɺQ 1H5d6AH$HtfHD$L|$LM9HED$H\$8HMfH9IfDMmL9IuLuHD$H|$ H@@~HHHH9HBHLiHu ATL$@QPDL$TH5o1A9H ZM6M9DH\$8D$fHD$LL;t$DD$Et)IvH$1<M6L9t$H$1H5uLMAƺ^ H5IMID H\$8.H$1H5A详VLAƺ H5P"GD$HL$(HHt&HI@H)HHH9HRHtHHt H9tLIL RL Fo AT1H5AXZH LAƺ H5|NsHtHI@HHHtyH9ttHRHtHHt H9tHAH' RMLEPr MLAƺc H5H H HD$H|$ Hx@tIHHHH9H@HLoE AWL$@QPDL$T$uhHL$(HHt&HQ@HHHH9H@HtjHHtbH9t]HRPMLDR A苸L HHD$(Ht Hx@nIRLD AWH H H pATE1E11SHH1AHjSjH t HD[A\fAHC011C8L&e H5; HD[A\fAVAUATIUSLA8H1LcwL~IHL5 L'LHLHlH贿L謿+LH=}+fHI H9IEHL9LHL_;1ɺ?1L@HHH1SDL+1LwXZLPhLHL i fH #SG`Ht@gC`HcCXt9C ~HB {THCT[ÐHHt H9L 1L:CH5qC`gC`HcCXuHHH9LHL:1[JH5!T@{HHtQH9tLLHH1LE*1RH5QXZHCT[fDLH/L L [@AWAVAUATUSHH $H8T$DL$dH%(H$(D $x vHIADMHEPH83 t}   HEPL|$ LMHHLH0L1HhC`kHEP11LH8IH@`t Ā̀AF`[U uO F Ew$xCHEP1ҾOH85H/Hr1Lu:I"H޿1./fHD$.L8M"IH51DT$H$(dH+%(VH8D[]A\A]A^A_@wfD1U ^LMHb"L;8H51hE1xL踖D$ H-LH8l"IH5M1DT$ +$xHAHEhHM9MCDl$I9LG-HIHEPLHDL$Hxj6k_AXAUAWIL-81ɺ"H޿1oD AYAZEu |$MI 1DLLAFaEHu`+A,@ADMg"L6lHH,1ɺr"HIL61豻HEPj1ɋ$xALH8RDL$LhUA[A_D$AFaDT$HDT$,DT$Hŋ u DT$HL W%y"H]%L%LDH1UAXAYDT$fDIHL9LH1L]%1ɺH5{论AvXH= ΜLfAF`DMI IHD$1Ll$HD$Mu'HT$HD$HHT$L9HL9v LH)HD$A~T1L7t.8tWb1ɺ"HPH%LTPL $1ŹYL5^1ɺ"H޿1覹fDE1KHEPHLHDL$HxjgHIXZ)Hŋ > L #L5"H޿H#LDH1ATAUUH E1AvXH= LL @[)Hȅ1L 4I"H޿1脸HLeh()HIHEPLHDL$HxjfA_1ɺ"IXj1AUL3H޿ XZ{ME1I LR12H5RзLR12H5R觷DT$]AvXH= 轙LUDT$ffDAWAVAUATUSHH $HE1H|$HHt$hHT$ L$`LD$xdH%(H$1H$HD$H$H$H$HD$@H$H$HH9tHAH9uL=1L*3L襶HD$ D$dD$tD$pL DH M,$1XL9d$ I|$G`%G`mLMIID$1҃H=T pXI$ID$HBHH$ HD$I$H$ID$H$L(IL$ML9t$ I~G`%G`MIeXID$HHHH9HJHP8QL, LMA A%A кP1#I$ID$HBHID$IH` AYAZL9t$ tI~G`%G`9D1ALL轴L$I$MHD$L;d$^H$HD$0@ID$HHH~H9uLJL1LTAIt$D$pD$dN` H菷HHtCH$HtН|$`uID$H= pXI|$I$ID$HBHH$HD$@I$H$ID$H$L(L$Ll$IEML;l$;HD$ID$LD$011H= HDŽ$pX=L$H$H|$(IpHLIL$HA8yX % H1HH9LNHLl/LWRP1踲Il$DŽ$H HD$he`Ht1H|$HHH Lt$(Ll$P11HD$8HD$Ld$XMAHLABELONEI9$]EtID$H9It$ϦB|A;D$WEfDHIHuH|$Ll$PLd$XLD$8HL$(HL$Ht$M`LH|$HH HHP$HEHHH9H@HIL.1P1L>ID$AZA[HHHH9LJL1LD$tD$d @H L(I9I}HLHuMmH I9uDHEHH9H@H8I1PL.1LaXZENIEH\$8AHD$EDHUHt_H9tZLJS1LL-P'1Y^L  @L @H N@L HEHt7H9t2LHHLk,L1S#良_AXML L_I1ɺ~1LFAHD$ L L9\$dLL$-SD$|PD$1Y^HD$xHtHt$@LH$dH+%(H[]A\A]A^A_fHEHt/H9t*LHL+1ɺ/1L聮@L HH9LHHL,11RL0ID$AXAYHfDL 1 @HEHtOH9tJLHH;1SL*LѭXZf.H ٷ K@L ɷ H 1@L 2@HEHtgH9tbLH=' xLLx11GHHH襰HHt(sM茧XE1ZHDL|A1ɺH5taL]A11 H5r@E1HD$(dH+%(H8D[]A\A]A^A_LL$Lj%H5r1E1fLL$LD9wAsLL$LLL$L%{DLL$L"%[@AVAAUIATUHSHGHHxPIHt>LDHH-bt[L]A\A]A^DHCLE1HxdLS1H5Dg輥AMDAWIAVMAUIATUDSH1HH8HHL$HL$dH%(HD$(1D$LT$HIFHP(LX(tJH@HHtAIL$@H9t7HIL$ LM\$@H<H94))4ID$0HLH uXMOIHCL9:H@H ME1P1LH5f藤ZYIL$ H<1H9j1HL$ HCQHL$ QAKL\$QH nQHHLWLQLV1PD$mH@L\$HIHHHHtH9tzHBM PL{#1AW H5\eAsAQLKʣH Mt t IL$` HD$(dH+%(H8L[]A\A]A^A_fDH Mt AMHHtHHt H9Hh M PLu"1AWH5d1AsAQLKH ZfDHHt HHtH9uSH HMPH5QdL!1^_fHB_HBf.H off.@ATSHH $HHߚHOdH%(H$1HIHhCHARu.H$dH+%(HD[A\f 8t?0I1PHHLn<PH5Cb1袡XZfD(1E1LJ!H5bq^WAWAVAUATUSH8H|$Ht$HT$(HHyD$$11H|$E1E1zfÀu_IM ADA@tI"tD D$$tHD$(AAB _A]EHD$(D$$AAB EHH;D$s>HT$L,A]t,EL;d$s" jEaEE1HH;D$rH8[]A\A]A^A_fD$$fDUHH $HH ]HdH%(H$1HIH7Ax+H+H$dH+%(u3H]L91ɺ1H5觟萢AWAVAUATUSL$HH $L9uHfHdH%(H$a1HH$pH)$`LMHL$`HHEPLHL1HhF@&Ht$@L衜L$`A1p L蒘LL/Dh AAHcrypto_LH9$`A?AED$L\$hp LHL$H$`H5LH=HHT$HH5H$XH)H)΁H- HL$H5 HL$L$ HD$hL$`!LH Hx LHD$1>-LmHH $L$`1L|$0H蘤Hx.L@uAxtހx.uAx.uAxtf.1LHLw>E L11補Džd LD$Ș|$ HD$HT$1LHL$,H5HcD0HT$(觗/ D$,t$( $HH H%H H ƸH9t$DȀ{ $qh @AHDT$DT$$Dh AA Dh A|{NLL$L1H5CDh E1AH L'IH51詛E1H$adH+%( HaD[]A\A]A^A_f.L$`LLLD$1p LD$H = MH1ɺ0PLn1H5KX1Z1LrD$VH$DT$$D$DT$6D1rDT$H$aD$ΔD$DT$&DD$衔D$CLLD$D$Rp LHDT$ՠLfE1i L$H5H=HT$HLP H$`EAH5H$X!AH- HAH)H)ƉDH )$`11)$p1% j 1jjL\$PH L$DT$HHH@L\$HHxLpHMH5D$9D$bAE111L\$t5< EtDF<`14DƍBHAuHDT$L$L$DT$$`1H$`111L$L$ H H$5 LtIH51^D$DE1ҁ$hAUKSML[Hxh k{a|@LHMDh AAEtH5ʸHD$趚D$jEh ҃ Јh 賙H8$`MHGQIHoH5HDH9APLSP1)D\$ DT$(H DD$/D$]D$*8cM1ɺ>PHL1PH51Ɩ]A\D$f.HX)LILL$$1LH5\Dh D$AyL$`11Ls1 LHL蝕ŅL1~X2D$`1L1ɿH$1H5LHH@ AVATR+P1赕H ʏDh AAM4L蛗8Ԕ1MPHH5PL/17Y^DT$#1fDHHMLPDH5!1ԔA[E1[#HD$L.1ɺH5/1蜔D$1LzOH5D$pD$M;1LH5@D$DT$D$Y8蒓>M1PHL.PH5B1XZD$uLL$L&D$H5迓DT$K8M1ɺPHLM.PH51|_E1AX蜕8Ւ{MIH3MHhHDHH APH5LQP1H L-1ɺ`1H5ADh E1A38AM1ɺPHLp-PH51褒AYAZ|$跌E1%躔8M1ɺPH3L'-P菔8ȑ{MIH&LH[HDHH #APH5LQP1 H AD$L+1ɺ{(D$L+1ɺƄ$`1螔ٓ$8h Af.ATUSHH $H`H q HBdH%(H$X1AI@A AH\$PD$ AAHA 1H2H5\HQHHaLd$H¾@LH1HT$ H5F#L葋u fHBH|$AIH$0 A AAAdH%(H$(01)$ H@H|$ LA 1H|$/H|$jHHH$ L-H萕IHAz.MruA~tA>.uA~.u A~tfD1MLLHp/L$ 1ɺHL$ pLH5=yLI^MHHHD$HHL$Hxk8IH'HL$HLT$#LT$&H$(0dH+%(H80L[]A\A]A^A_f.ML11H5L '1ɺH5Z@E1C<7 uC7_ILHL9wfDH$ IzLHIITITLH)H)ƉH@$ AATfAT{8贋L&1ɺPHPLL$(1H5XZLT$L21ɺ1H5VE1j$ AATAT58tPL1AYAZBчAWAVAUATUSHH $HH $HXL=~ HGLdH%(H$H 1Lt$@IL% 5 LHHHD$0.H$fDH0HPLh9uA}t@9uAE9u A}t@H $1HT$,LH5 ~1MLH5螃H覊HvDH H$H dH+%(HX []A\A]A^A_H=p 1wHHuPfDL8H1HHu@Dl$0HcD$,LL$8Ht$4H=U LLL$D$AHH IcH H%H HT$AҺADT$4DT$oLL$DT$taHt$8HtWL蟉Rf.蛄8ԁM1ɺPHLP1H57XZH HL$activate/activate.cGetting target version for %sFound %s target v%u.%u.%u./usr/sbin/modprobe%smodule/dm_%sModule directory %s exists./lib/modules%s/%s/modules.builtin%s: %s failed: %skvdodm-%sfcloseInterrupted...misc/lvm-signal.cLogical volume %s in use.metadata/snapshot_manip.cactivate/dev_manager.cthin-poolChecking device id for LV %s.%*u:%*u %u (no device driver)Counted %d open LVs in VG %s.Found active component LV %s.Found active holder LV %s. [Test mode: skipping this]Not mSkipping %smonitor of %s.%s%s already monitored.Monitoring %s with %s.%s%s already not monitored.Not monitoring %s with %s%s temporary noscanmetadata/raid_manip.cSkipping: Activating %s.Activating %s%s%s%s%s.LV %s is already active.No host tag matches %slocking for suspendunlocking on resumeGetting driver versiondevice_mapper/libdm-common.cFailed to get driver versioncache/lvmcache.c#orphansbase/data-struct/list.chead->ndevice is used by LVdevice size is correctdevice name matches previousdevice has fs mounteddevice is in dm subsystemdevice is in subsystemdevice was seen firstis not used foris used forhas nohasis notis not inis inlvmcache label scan beginResolving duplicate devicesPV %s: %s %s dm. %s %s dm.PV %s: %s %s LV. %s %s LV.Adding chosen duplicate %slvmcache label scan doneno longerdevice not founddevice is a duplicatedevice cannot be used[unknown](root)How LVM uses block devices. allocationshellHost tag settings. validate_metadataabort_on_errorsprofile_dirdevice_id_sysfs_dir/sys/#S/devloopfilesobtain_device_list_from_udevexternal_device_info_sourcepreferred_namesuse_devicesfile@DEFAULT_USE_DEVICES_FILE@system.devicesdevicesfile_backup_limitsearch_for_devnamesdevice_ids_refreshdevice_ids_refresh_checks#Sproduct_uuid#Shostname#Sa|.*|global_filtercache_dircache_file_prefixwrite_cache_statesysfs_scanscan_lvsmultipath_component_detectionmultipath_wwids_file/etc/multipath/wwidsmd_component_detectionmd_component_checksfw_raid_component_detectionmd_chunk_alignmentdefault_data_alignmentdata_alignment_detectionignore_suspended_devicesignore_lvm_mirrorsdisable_after_error_countrequire_restorefile_with_uuidpv_min_sizeissue_discardsallow_mixed_block_sizescling_tag_listmaximise_clinguse_blkid_wiping@DEFAULT_USE_BLKID_WIPING@raid_stripe_all_devicescache_pool_cachemodeCache mode. cache_metadata_formatcache_modecache_policycache_settingspolicy_settingscache_pool_chunk_sizecache_pool_max_chunksthin_pool_crop_metadatathin_pool_zerothin_pool_discardsthin_pool_chunk_size_policygenericzero_metadatathin_pool_chunk_sizephysical_extent_sizevdo_use_compressionvdo_use_deduplicationvdo_use_metadata_hintsvdo_minimum_io_sizevdo_block_map_cache_size_mbvdo_block_map_periodvdo_check_point_frequencyvdo_use_sparse_indexvdo_index_memory_size_mbvdo_slab_size_mbvdo_ack_threadsvdo_bio_threadsvdo_bio_rotationvdo_cpu_threadsvdo_hash_zone_threadsvdo_logical_threadsvdo_physical_threadsvdo_write_policyvdo_max_discardreport_command_logcommand_log_sortlog_seq_numcommand_log_colscommand_log_selectionsilentsyslogjournaloverwritelevelindentcommand_namesactivate_filedebug_classesdebug_file_fieldsdebug_output_fieldsbackup_dirarchive_dirretain_minretain_dayshistory_sizeumasktestunitssi_unit_consistencysuffixfallback_to_lvm1format_librariessegment_libraries/proc@DEFAULT_PROC_DIR@Location of proc filesystem. /etc@CONFDIR@locking_typewait_for_locksfallback_to_clustered_lockingfallback_to_local_lockinglocking_dir/run/lock/lvm@DEFAULT_LOCK_DIR@prioritise_write_lockslibrary_dirlocking_libraryliblvm2clusterlock.soabort_on_internal_errorsmetadata_read_onlymirror_segtype_defaultraid1@DEFAULT_MIRROR_SEGTYPE@support_mirrored_mirror_lograid10_segtype_defaultraid10@DEFAULT_RAID10_SEGTYPE@sparse_segtype_default@DEFAULT_SPARSE_SEGTYPE@event_activation@DEFAULT_EVENT_ACTIVATION@use_lvmetadlvmetad_update_wait_timeuse_aiouse_lvmlockdlvmlockd_lock_retriessanlock_lv_extendsanlock_align_sizelvmlockctl_kill_commandthin_check_executable/usr/sbin/thin_check@THIN_CHECK_CMD@thin_dump_executable/usr/sbin/thin_dump@THIN_DUMP_CMD@thin_repair_executable/usr/sbin/thin_repair@THIN_REPAIR_CMD@thin_restore_executable/usr/sbin/thin_restore@THIN_RESTORE_CMD@thin_check_optionsthin_repair_options#Sthin_restore_optionsthin_disabled_featurescache_disabled_featurescache_check_executable/usr/sbin/cache_check@CACHE_CHECK_CMD@cache_dump_executable/usr/sbin/cache_dump@CACHE_DUMP_CMD@cache_repair_executable/usr/sbin/cache_repair@CACHE_REPAIR_CMD@cache_restore_executable/usr/sbin/cache_restore@CACHE_RESTORE_CMD@cache_check_optionscache_repair_optionscache_restore_optionsvdo_format_executable/usr/bin/vdoformat@VDO_FORMAT_CMD@vdo_format_optionsvdo_disabled_featuresfsadm_executable/usr/sbin/fsadm@FSADM_PATH@system_id_sourcesystem_id_fileuse_lvmpolld@DEFAULT_USE_LVMPOLLD@notify_dbusio_memory_sizeudev_syncudev_rulesverify_udev_operationsretry_deactivationmissing_stripe_filleruse_linear_targetreserved_stackreserved_memoryprocess_priorityauto_activation_volume_listread_only_volume_listmirror_region_sizeraid_region_sizeerror_when_fullreadaheadraid_fault_policywarnmirror_image_fault_policymirror_log_fault_policyallocatemirror_device_fault_policysnapshot_autoextend_thresholdsnapshot_autoextend_percentthin_pool_autoextend_percentvdo_pool_autoextend_thresholdvdo_pool_autoextend_percentmlock_filteruse_mlockallmonitoringpolling_intervalauto_set_activation_skipactivation_modedegradedauto_lock_start_listcheck_pv_device_sizesrecord_lvs_historylvs_history_retention_timepvmetadatacopiesvgmetadatacopiespvmetadatasizepvmetadataignoredirsdisk_areasdisk_areastart_sectoroutput_formatbasiccompact_outputcompact_output_colsalignedbufferedheadingslist_item_separatorprefixesquotedcolumns_as_rowsbinary_values_as_numerictime_format%Y-%m-%d %T %zdevtypes_sortdevtype_namedevtypes_colsdevtypes_cols_verboselvs_sortvg_name,lv_namelvs_colslvs_cols_verbosevgs_sortvg_namevgs_colsvgs_cols_verbosepvs_sortpv_namepvs_colspvs_cols_verbosevg_name,lv_name,seg_startpvsegs_sortpv_name,pvseg_startpvsegs_colspvsegs_cols_verbosevgs_cols_fullvg_allpvs_cols_fullpv_alllvs_cols_fulllv_allpvsegs_cols_fullpvseg_all,pv_uuid,lv_uuidseg_all,lv_uuidvgs_sort_fullpvs_sort_fulllvs_sort_fullpvsegs_sort_fullpv_uuid,pvseg_startlv_uuid,seg_startmark_hidden_devicestwo_word_unknown_devicemirror_libraryraid_librarysnapshot_librarythin_librarylvm lvextend --use-policiesvdo_librarylibdevmapper-event-lvm2vdo.so/usr/sbin/dmeventd@DMEVENTD_PATH@hosttagshost_listsystem_idextra_system_idsmodule string allocation failedsnap_seg module string allocation failed%s configuration setting defined: Checking the list to match %s.No item supplied in %s configuration setting matches %s.Ignoring invalid string in config file %s.Ignoring empty string in config file %s.Ignoring empty tag in config file %sactivation/auto_activation_volume_list configuration setting not defined: All logical volumes will be auto-activated.Activation enabled. Device-mapper kernel driver will be used.WARNING: Activation disabled. No device-mapper interaction will be attempted.Activation disabled. No device-mapper interaction will be attempted.Failed to get %s target versionModules path %s/%s/modules.builtin is too long.Found %s as built-in kernel module.module_present module name too long: %sInternal error: Target present version called when activation is disabled.Found suspended LV %s in critical section().Found suspended layered LV %s in critical section().Snapshot merge is in progress, querying status of %s instead.Logical volume %s is used by another device.Logical volume %s contains a filesystem in use.Retrying open_count check for %s.Checking snapshot percent for LV %s.Internal error: Cannot get origin from snapshot %s.Checking mirror percent for LV %s.Getting device %s status percentage for %s.Checking raid status for volume %s.Expected %s segment type but got %s instead.Checking raid data offset and dev sectors for LV %s/%sChecking raid device health for LV %s.Checking raid mismatch count for LV %s.Checking raid sync_action for LV %s.Unable to send message to an inactive logical volume.Internal error: %s is not a writecache logical volume.Internal error: Cannot check status for unused cache pool %s.Cannot check status for deleted cache volume %s.Checking status for cache volume %s.Checking thin pool status for LV %s.More than one table line found for %s.Unexpected target type %s found for thin %s.Cannot parse table like parameters %s for %s.Preloading detached hidden volume %s as visible volume %s.Cannot determine activation status of %s%s.Counted %d active LVs in VG %sRAID module does not support RAID4. Cache pool activation for clearing only.Skipping unmonitor of opened %s (open:%d)Skipping monitor of snapshot larger then origin %s.WARNING: Failed to %smonitor %s.WARNING: %s: segment unmonitoring failed.WARNING: %s: %s segment monitoring function failed.%s %smonitoring still pending: waiting...WARNING: %sonitoring %s failed.Activation of logical volume %s is prohibited while logical volume %s is active.activation/volume_list configuration setting not defined: Checking only host tags for %s.Not activating %s since it does not pass activation filter.No degraded or partial activation for raid with integrity.Integrity must be removed before degraded or partial activation of raid.Refusing activation of partial LV %s. Use '--activationmode partial' to override.Refusing activation of partial LV %s. Try '--activationmode degraded'.Cannot use partial or degraded activation with writecache.Refusing activation of RAID LV %s with visible SubLVs.Refusing activation of LV %s containing an unrecognised segment.WARNING: lookup found duplicate VGID %s for VGs %s and %s.Internal error: vginfo_lookup %s has_duplicate_local_vgname.vginfo_lookup %s has_duplicate_local_vgname return none.vgnameid_list allocation failed.vgnameid_list member allocation failed.Skip multipath component checks with single device for PVID %sDifferent wwids for duplicate PVs %s %s %s noneDifferent wwids for duplicate PVs %s %s %s %sFound multiple multipath devices for PVID %s WWID %s: %s %s.Same wwids for duplicate PVs %s %sFound multipath device %s for PVID %s WWID %s.Using multipath device %s for PVID %s.Ignoring multipath component %s with PVID %s (dropping info)Ignoring multipath component %s with PVID %s (dropping duplicate)Found multiple md devices for PVID %s: %s %sFound md device %s for PVID %s.Using md device %s for PVID %s.Ignoring md component %s with PVID %s (dropping info)Ignoring md component %s with PVID %s (dropping duplicate)PV %s with duplicates unselected using %s.PV %s with duplicates unselected comparing alternativesPV %s with duplicates comparing alternatives for %sPV %s compare duplicates: %s %u:%u. %s %u:%u. device_hint %s.PV %s: size %llu. %s is %llu. %s is %llu.PV %s: %s %s subsystem. %s %s subsystem.PV %s: %s %s mounted fs. %s %s mounted fs.PV %s with duplicates will use %s.Internal error: PV %s with duplicates no alternate list entry for %sPV %s with duplicates will change from %s to %s.PV %s with duplicates will continue using %s.Dropping unchosen duplicate %sWARNING: Not using device %s for PV %s.WARNING: PV %s prefers device %s because %s.PV %s: device_id %s. %s is %s. %s is %s.Checking for multipath components for duplicate PVID %s_lvmcache_update: vgid hash insertion failed: %slvmcache %s: VG %s: set VGID to %.32s.Internal error: NULL vgname handed to cachelvmcache change %s to orphan from previous VG %s.Failed to update VG %s info in lvmcache.lvmcache %s mda%d VG %s set seqno %u checksum %x mda_size %zulvmcache %s mda%d VG %s older seqno %u checksum %x mda_size %zulvmcache %s mda%d VG %s newer seqno %u checksum %x mda_size %zuWARNING: scan of VG %s from %s mda%d found mda_checksum %x mda_size %zu vs %x %zulvmcache %s: VG %s %s exported.cache creation host alloc failed for %s.lvmcache %s: VG %s: set creation host to %s.cache lock_type alloc failed for %slvmcache %s: VG %s: set lock_type to %s.cache system_id alloc failed for %slvmcache %s: VG %s: set system_id to %s.How LVM configuration settings are handled. How LVM selects space and applies properties to LVs. How LVM log information is reported. How LVM metadata is backed up and archived. In LVM, a 'backup' is a copy of the metadata for the current system, and an 'archive' contains old metadata configurations. They are stored in a human readable text format. Settings for running LVM in shell (readline) mode. Miscellaneous global LVM settings. LVM report command output formatting. Settings for the LVM event daemon. LVM settings that are specific to the local host. If enabled, any LVM configuration mismatch is reported. This implies checking that the configuration key is understood by LVM and that the value of the key is the proper type. If disabled, any configuration mismatch is ignored and the default value is used without any warning (a message about the configuration key not being found is issued in verbose mode only). Allows to select the level of validation after metadata transformation. Validation takes extra CPU time to verify internal consistency. Accepted values: full Do a full metadata validation before disk write. none Skip any checks (unrecommended, slightly faster). # Abort the LVM process if a configuration mismatch is found. Directory where LVM looks for configuration profiles. Directory in which to create volume group device nodes. Commands also accept this as a prefix on volume group names. Location of sysfs for finding device ids (for testing.) Directories containing device nodes to use with LVM. Obtain the list of available devices from udev. This avoids opening or using any inapplicable non-block devices or subdirectories found in the udev directory. Any device node or symlink not managed by udev in the udev directory is ignored. This setting applies only to the udev-managed device directory; other directories will be scanned fully. LVM needs to be compiled with udev support for this setting to apply. Enable device information from udev. If set to "udev", lvm will supplement its own native device information with information from libudev. This can potentially improve the detection of MD component devices and multipath component devices. Use a local file to remember which devices have PVs on them. Some commands will use this as an optimization to reduce device scanning, and will only scan the listed PVs. Removing the hint file will cause lvm to generate a new one. Disable hints if PVs will be copied onto devices using non-lvm commands, like dd. # Accepted values: all Use all hints. none Use no hints. # Select which path name to display for a block device. If multiple path names exist for a block device, and LVM needs to display a name for the device, the path names are matched against each item in this list of regular expressions. The first match is used. Try to avoid using undescriptive /dev/dm-N names, if present. If no preferred name matches, or if preferred_names are not defined, the following built-in preferences are applied in order until one produces a preferred name: Prefer names with path prefixes in the order of: /dev/mapper, /dev/disk, /dev/dm-*, /dev/block. Prefer the name with the least number of slashes. Prefer a name that is a symlink. Prefer the path with least value in lexicographical order. # Example preferred_names = [ "^/dev/mpath/", "^/dev/mapper/mpath", "^/dev/[hs]d" ] # Enable or disable the use of a devices file. When enabled, lvm will only use devices that are listed in the devices file. A devices file will be used, regardless of this setting, when the --devicesfile option is set to a specific file name. The name of the system devices file, listing devices that LVM should use. This should not be used to select a non-system devices file. The --devicesfile option is intended for alternative devices files. The max number of backup files to keep in /etc/lvm/devices/backup. LVM creates a backup of the devices file each time a new version is created, or each time a modification is detected. When the max number of backups is reached, the oldest are removed to remain at the limit. Set to 0 to disable backups. Only the system devices file is backed up. Look outside of the devices file for missing devname entries. A devname entry is used for a device that does not have a stable device id, e.g. wwid, so the unstable device name is used as the device id. After reboot, or if the device is reattached, the device name may change, in which case lvm will not find the expected PV on the device listed in the devices file. This setting controls whether lvm will search other devices, outside the devices file, to look for the missing PV on a renamed device. If "none", lvm will not look at other devices, and the PV may appear to be missing. If "auto", lvm will look at other devices, but only those that are likely to have the PV. If "all", lvm will look at all devices on the system. Find PVs on new devices and update the device IDs in the devices file. If PVs are restored or moved to a new system with new devices, but an old system.devices remains with old device IDs, then search for the PVIDs on new devices and update the device IDs in system.devices. The original device IDs must also not be found on the new system. See device_ids_refresh_check for conditions that trigger the refresh. Conditions that trigger device_ids_refresh to locate PVIDs on new devices. product_uuid: refresh if /sys/devices/virtual/dmi/id/product_uuid does not match the value saved in system.devices. hostname: refresh if hostname does not match the value saved in system.devices. (hostname is used if product_uuid is not available.) Remove values from this list to prevent lvm from using them. Limit the block devices that are used by LVM commands. This is a list of regular expressions used to accept or reject block device path names. Each regex is delimited by a vertical bar '|' (or any character) and is preceded by 'a' to accept the path, or by 'r' to reject the path. The first regex in the list to match the path is used, producing the 'a' or 'r' result for the device. When multiple path names exist for a block device, if any path name matches an 'a' pattern before an 'r' pattern, then the device is accepted. If all the path names match an 'r' pattern first, then the device is rejected. Unmatching path names do not affect the accept or reject decision. If no path names for a device match a pattern, then the device is accepted. Be careful mixing 'a' and 'r' patterns, as the combination might produce unexpected results (test changes.) Run vgscan after changing the filter to regenerate the cache. # Example Accept every block device: filter = [ "a|.*|" ] Reject the cdrom drive: filter = [ "r|/dev/cdrom|" ] Work with just loopback devices, e.g. for testing: filter = [ "a|loop|", "r|.*|" ] Accept all loop devices and ide drives except hdc: filter = [ "a|loop|", "r|/dev/hdc|", "a|/dev/ide|", "r|.*|" ] Use anchors to be very specific: filter = [ "a|^/dev/hda8$|", "r|.*|" ] # Limit the block devices that are used by LVM system components. Because devices/filter may be overridden from the command line, it is not suitable for system-wide device filtering, e.g. udev. Use global_filter to hide devices from these LVM system components. The syntax is the same as devices/filter. Devices rejected by global_filter are not opened by LVM. List of additional acceptable block device types. These are of device type names from /proc/devices, followed by the maximum number of partitions. # Example types = [ "fd", 16 ] # Restrict device scanning to block devices appearing in sysfs. This is a quick way of filtering out block devices that are not present on the system. sysfs must be part of the kernel and mounted.) Allow LVM LVs to be used as PVs. When enabled, LVM commands will scan active LVs to look for other PVs. Caution is required to avoid using PVs that belong to guest images stored on LVs. When enabled, the LVs scanned should be restricted using the devices file or the filter. This option does not enable autoactivation of layered VGs, which requires editing LVM udev rules (see LVM_PVSCAN_ON_LVS.) Ignore devices that are components of DM multipath devices. The path to the multipath wwids file used for multipath component detection. Set this to an empty string to disable the use of the multipath wwids file. Enable detection and exclusion of MD component devices. An MD component device is a block device that MD uses as part of a software RAID virtual device. When an LVM PV is created on an MD device, LVM must only use the top level MD device as the PV, and should ignore the underlying component devices. In cases where the MD superblock is located at the end of the component devices, it is more difficult for LVM to consistently identify an MD component, see the md_component_checks setting. The checks LVM should use to detect MD component devices. MD component devices are block devices used by MD software RAID. # Accepted values: auto LVM will skip scanning the end of devices when it has other indications that the device is not an MD component. start LVM will only scan the start of devices for MD superblocks. This does not incur extra I/O by LVM. full LVM will scan the start and end of devices for MD superblocks. This requires an extra read at the end of devices. # Ignore devices that are components of firmware RAID devices. LVM must use an external_device_info_source other than none for this detection to execute. Align the start of a PV data area with md device's stripe-width. This applies if a PV is placed directly on an md device. default_data_alignment will be overridden if it is not aligned with the value detected for this setting. This setting is overridden by data_alignment_detection, data_alignment, and the --dataalignment option. Align the start of a PV data area with this number of MiB. Set to 1 for 1MiB, 2 for 2MiB, etc. Set to 0 to disable. This setting is overridden by data_alignment and the --dataalignment option. Align the start of a PV data area with sysfs io properties. The start of a PV data area will be a multiple of minimum_io_size or optimal_io_size exposed in sysfs. minimum_io_size is the smallest request the device can perform without incurring a read-modify-write penalty, e.g. MD chunk size. optimal_io_size is the device's preferred unit of receiving I/O, e.g. MD stripe width. minimum_io_size is used if optimal_io_size is undefined (0). If md_chunk_alignment is enabled, that detects the optimal_io_size. default_data_alignment and md_chunk_alignment will be overridden if they are not aligned with the value detected for this setting. This setting is overridden by data_alignment and the --dataalignment option. Align the start of a PV data area with this number of KiB. When non-zero, this setting overrides default_data_alignment. Set to 0 to disable, in which case default_data_alignment is used to align the first PE in units of MiB. This setting is overridden by the --dataalignment option. data_alignment_offset_detectionShift the start of an aligned PV data area based on sysfs information. After a PV data area is aligned, it will be shifted by the alignment_offset exposed in sysfs. This offset is often 0, but may be non-zero. Certain 4KiB sector drives that compensate for windows partitioning will have an alignment_offset of 3584 bytes (sector 7 is the lowest aligned logical block, the 4KiB sectors start at LBA -1, and consequently sector 63 is aligned on a 4KiB boundary). This setting is overridden by the --dataalignmentoffset option. Ignore DM devices that have I/O suspended while scanning devices. Otherwise, LVM waits for a suspended device to become accessible. This should only be needed in recovery situations. Do not scan 'mirror' LVs to avoid possible deadlocks. This avoids possible deadlocks when using the 'mirror' segment type. This setting determines whether LVs using the 'mirror' segment type are scanned for LVM labels. This affects the ability of mirrors to be used as physical volumes. If this setting is enabled, it is impossible to create VGs on top of mirror LVs, i.e. to stack VGs on mirror LVs. If this setting is disabled, allowing mirror LVs to be scanned, it may cause LVM processes and I/O to the mirror to become blocked. This is due to the way that the mirror segment type handles failures. In order for the hang to occur, an LVM command must be run just after a failure and before the automatic LVM repair process takes place, or there must be failures in multiple mirrors in the same VG at the same time with write failures occurring moments before a scan of the mirror's labels. The 'mirror' scanning problems do not apply to LVM RAID types like 'raid1' which handle failures in a different way, making them a better choice for VG stacking. Allow use of pvcreate --uuid without requiring --restorefile. Minimum size in KiB of block devices which can be used as PVs. In a clustered environment all nodes must use the same value. Any value smaller than 512KiB is ignored. The previous built-in value was 512. Issue discards to PVs that are no longer used by an LV. Discards are sent to an LV's underlying physical volumes when the LV is no longer using the physical volumes' space, e.g. lvremove, lvreduce. Discards inform the storage that a region is no longer used. Storage that supports discards advertise the protocol-specific way discards should be issued by the kernel (TRIM, UNMAP, or WRITE SAME with UNMAP bit set). Not all storage will support or benefit from discards, but SSDs and thinly provisioned LUNs generally do. If enabled, discards will only be issued if both the storage and kernel provide support. allow_changes_with_duplicate_pvsAllow VG modification while a PV appears on multiple devices. When a PV appears on multiple devices, LVM attempts to choose the best device to use for the PV. If the devices represent the same underlying storage, the choice has minimal consequence. If the devices represent different underlying storage, the wrong choice can result in data loss if the VG is modified. Disabling this setting is the safest option because it prevents modifying a VG or activating LVs in it while a PV appears on multiple devices. Enabling this setting allows the VG to be used as usual even with uncertain devices. Allow PVs in the same VG with different logical block sizes. When allowed, the user is responsible to ensure that an LV is using PVs with matching block sizes when necessary. Advise LVM which PVs to use when searching for new space. When searching for free space to extend an LV, the 'cling' allocation policy will choose space on the same PVs as the last segment of the existing LV. If there is insufficient space and a list of tags is defined here, it will check whether any of them are attached to the PVs concerned and then seek to match those PV tags between existing extents and new extents. # Example Use the special tag "@*" as a wildcard to match any PV tag: cling_tag_list = [ "@*" ] LVs are mirrored between two sites within a single VG, and PVs are tagged with either @site1 or @site2 to indicate where they are situated: cling_tag_list = [ "@site1", "@site2" ] # Use a previous allocation algorithm. Changes made in version 2.02.85 extended the reach of the 'cling' policies to detect more situations where data can be grouped onto the same disks. This setting can be used to disable the changes and revert to the previous algorithm. Use blkid to detect and erase existing signatures on new PVs and LVs. The blkid library can detect more signatures than the native LVM detection code, but may take longer. LVM needs to be compiled with blkid wiping support for this setting to apply. LVM native detection code is currently able to recognize: MD device signatures, swap signature, and LUKS signatures. To see the list of signatures recognized by blkid, check the output of the 'blkid -k' command. wipe_signatures_when_zeroing_new_lvsLook for and erase any signatures while zeroing a new LV. The --wipesignatures option overrides this setting. Zeroing is controlled by the -Z/--zero option, and if not specified, zeroing is used by default if possible. Zeroing simply overwrites the first 4KiB of a new LV with zeroes and does no signature detection or wiping. Signature wiping goes beyond zeroing and detects exact types and positions of signatures within the whole LV. It provides a cleaner LV after creation as all known signatures are wiped. The LV is not claimed incorrectly by other tools because of old signatures from previous use. The number of signatures that LVM can detect depends on the detection code that is selected (see use_blkid_wiping.) Wiping each detected signature must be confirmed. When this setting is disabled, signatures on new LVs are not detected or erased unless the --wipesignatures option is used directly. mirror_logs_require_separate_pvsMirror logs and images will always use different PVs. The default setting changed in version 2.02.85. Stripe across all PVs when RAID stripes are not specified. If enabled, all PVs in the VG or on the command line are used for raid0/4/5/6/10 when the command does not specify the number of stripes to use. This was the default behaviour until release 2.02.162. cache_pool_metadata_require_separate_pvsCache pool metadata and data will always use different PVs. This has been replaced by the allocation/cache_mode setting. Sets default metadata format for new cache. # Accepted values: 0 Automatically detected best available format 1 Original format 2 Improved 2nd. generation format # The default cache mode used for new cache. # Accepted values: writethrough Data blocks are immediately written from the cache to disk. writeback Data blocks are written from the cache back to disk after some delay to improve performance. # This setting replaces allocation/cache_pool_cachemode. The default cache policy used for new cache volume. Since kernel 4.2 the default policy is smq (Stochastic multiqueue), otherwise the older mq (Multiqueue) policy is selected. Settings for the cache policy. See documentation for individual cache policies for more info. Replace this subsection name with a policy name. Multiple subsections for different policies can be created. The minimal chunk size in KiB for cache pool volumes. Using a chunk_size that is too large can result in wasteful use of the cache, where small reads and writes can cause large sections of an LV to be mapped into the cache. However, choosing a chunk_size that is too small can result in more overhead trying to manage the numerous chunks that become mapped into the cache. The former is more of a problem than the latter in most cases, so the default is on the smaller end of the spectrum. Supported values range from 32KiB to 1GiB in multiples of 32. The maximum number of chunks in a cache pool. For cache target v1.9 the recommended maximum is 1000000 chunks. Using cache pool with more chunks may degrade cache performance. thin_pool_metadata_require_separate_pvsThin pool metadata and data will always use different PVs. Older version of lvm2 cropped pool's metadata size to 15.81 GiB. This is slightly less than the actual maximum 15.88 GiB. For compatibility with older version and use of cropped size set to 1. Thin pool data chunks are zeroed before they are first used. Zeroing with a larger thin pool chunk size reduces performance. The discards behaviour of thin pool volumes. # Accepted values: ignore nopassdown passdown # The chunk size calculation policy for thin pool volumes. # Accepted values: generic If thin_pool_chunk_size is defined, use it. Otherwise, calculate the chunk size based on estimation and device hints exposed in sysfs - the minimum_io_size. The chunk size is always at least 64KiB. performance If thin_pool_chunk_size is defined, use it. Otherwise, calculate the chunk size for performance based on device hints exposed in sysfs - the optimal_io_size. The chunk size is always at least 512KiB. # Zero whole metadata area before use with thin or cache pool. The minimal chunk size in KiB for thin pool volumes. Larger chunk sizes may improve performance for plain thin volumes, however using them for snapshot volumes is less efficient, as it consumes more space and takes extra time for copying. When unset, lvm tries to estimate chunk size starting from 64KiB. Supported values are in the range 64KiB to 1GiB. Default physical extent size in KiB to use for new VGs. Enables or disables compression when creating a VDO volume. Compression may be disabled if necessary to maximize performance or to speed processing of data that is unlikely to compress. Enables or disables deduplication when creating a VDO volume. Deduplication may be disabled in instances where data is not expected to have good deduplication rates but compression is still desired. Deprecated enablement whether VDO volume should tag its latency-critical writes with the REQ_SYNC flag. Some device mapper targets such as dm-raid5 process writes with this flag at a higher priority. The minimum IO size for VDO volume to accept, in bytes. Valid values are 512 or 4096. The recommended value is 4096. Specifies the amount of memory in MiB allocated for caching block map pages for VDO volume. The value must be a multiple of 4096 and must be at least 128MiB and less than 16TiB. The cache must be at least 16MiB per logical thread. Note that there is a memory overhead of 15%. The speed with which the block map cache writes out modified block map pages. A smaller era length is likely to reduce the amount time spent rebuilding, at the cost of increased block map writes during normal operation. The maximum and recommended value is 16380; the minimum value is 1. Deprecated option to set default check point frequency for VDO volume. Enables sparse indexing for VDO volume. Specifies the amount of index memory in MiB for VDO volume. The value must be at least 256MiB and at most 1TiB. Specifies the size in MiB of the increment by which a VDO is grown. Using a smaller size constrains the total maximum physical size that can be accommodated. Must be a power of two between 128MiB and 32GiB. Specifies the number of threads to use for acknowledging completion of requested VDO I/O operations. The value must be at in range [0..100]. Specifies the number of threads to use for submitting I/O operations to the storage device of VDO volume. The value must be in range [1..100]. Each additional thread after the first will use an additional 18MiB of RAM, plus 1.12 MiB of RAM per megabyte of configured read cache size. Specifies the number of I/O operations to enqueue for each bio-submission thread before directing work to the next. The value must be in range [1..1024]. Specifies the number of threads to use for CPU-intensive work such as hashing or compression for VDO volume. The value must be in range [1..100]. Specifies the number of threads across which to subdivide parts of the VDO processing based on the hash value computed from the block data. The value must be at in range [0..100]. vdo_hash_zone_threads, vdo_logical_threads and vdo_physical_threads must be either all zero or all non-zero. Specifies the number of threads across which to subdivide parts of the VDO processing based on the hash value computed from the block data. A logical thread count of 9 or more will require explicitly specifying a sufficiently large block map cache size, as well. The value must be in range [0..60]. vdo_hash_zone_threads, vdo_logical_threads and vdo_physical_threads must be either all zero or all non-zero. Specifies the number of threads across which to subdivide parts of the VDO processing based on physical block addresses. Each additional thread after the first will use an additional 10MiB of RAM. The value must be in range [0..16]. vdo_hash_zone_threads, vdo_logical_threads and vdo_physical_threads must be either all zero or all non-zero. Deprecated option to specify the write policy with these accepted values: auto - VDO will check the storage device and determine whether it supports flushes. If it does, VDO will run in async mode, otherwise it will run in sync mode. sync - Writes are acknowledged only after data is stably written. This policy is not supported if the underlying storage is not also synchronous. async - Writes are acknowledged after data has been cached for writing to stable storage. Data which has not been flushed is not guaranteed to persist in this mode. async-unsafe - Writes are handled like 'async' but there is no guarantee of the atomicity async provides. This mode should only be used for better performance when atomicity is not required. Specified the maximum size of discard bio accepted, in 4096 byte blocks. I/O requests to a VDO volume are normally split into 4096-byte blocks, and processed up to 2048 at a time. However, discard requests to a VDO volume can be automatically split to a larger size, up to 4096-byte blocks in a single bio, and are limited to 1500 at a time. Increasing this value may provide better overall performance, at the cost of increased latency for the individual discard requests. The default and minimum is 1. The maximum is UINT_MAX / 4096. Specified the empty header size in KiB at the front and end of vdo pool device. Enable or disable LVM log reporting. If enabled, LVM will collect a log of operations, messages, per-object return codes with object identification and associated error numbers (errnos) during LVM command processing. Then the log is either reported solely or in addition to any existing reports, depending on LVM command used. If it is a reporting command (e.g. pvs, vgs, lvs, lvm fullreport), then the log is reported in addition to any existing reports. Otherwise, there's only log report on output. For all applicable LVM commands, you can request that the output has only log report by using --logonly command line option. Use log/command_log_cols and log/command_log_sort settings to define fields to display and sort fields for the log report. You can also use log/command_log_selection to define selection criteria used each time the log is reported. Note that if report/output_format (or --reportformat command line option) is set to json or json_std, then log/report_command_log=1 is default. List of columns to sort by when reporting command log. See --logonly --configreport log -o help for the list of possible fields. log_seq_num,log_type,log_context,log_object_type,log_object_name,log_object_id,log_object_group,log_object_group_id,log_message,log_errno,log_ret_codeList of columns to report when reporting command log. See --logonly --configreport log -o help for the list of possible fields. !(log_type=status && message=success)Selection criteria used when reporting command log. You can define selection criteria that are applied each time log is reported. This way, it is possible to control the amount of log that is displayed on output and you can select only parts of the log that are important for you. To define selection criteria, use fields from log report. See also --logonly --configreport log -S help for the list of possible fields and selection operators. You can also define selection criteria for log report on command line directly using --configreport log -S which has precedence over log/command_log_selection setting. To make all the command log lines visible, use "all" value for the command log selection. For more information about selection criteria in general, see lvmreport(7) man page. Controls the messages sent to stdout or stderr. Suppress all non-essential messages from stdout. This has the same effect as -qq. When enabled, the following commands still produce output: dumpconfig, lvdisplay, lvmdiskscan, lvs, pvck, pvdisplay, pvs, version, vgcfgrestore -l, vgdisplay, vgs. Non-essential messages are shifted from log level 4 to log level 5 for syslog and lvm2_log_fn purposes. Any 'yes' or 'no' questions not overridden by other arguments are suppressed and default to 'no'. Send log messages through syslog. Write error and debug log messages to a file specified here. Record lvm information in the systemd journal. command: record commands that are run. output: record default output from commands. debug: record debug messages from commands. Overwrite the log file each time the program is run. The level of log messages that are sent to the log file or syslog. There are 6 syslog-like log levels currently in use: 2 to 7 inclusive. 7 is the most verbose (LOG_DEBUG). Indent messages according to their severity. Display the command name on each line of output. A prefix to use before the log message text. (After the command name, if selected). Two spaces allows you to see/grep the severity of each message. To make the messages look similar to the original LVM tools use: indent = 0, command_names = 1, prefix = " -- " Log messages during activation. Don't use this in low memory situations (can deadlock). #Smemory#Sdevices#Sio#Sactivation#Sallocation#Smetadata#Scache#Slocking#Slvmpolld#SdbusSelect log messages by class. Some debugging messages are assigned to a class and only appear in debug output if the class is listed here. Classes currently available: memory, devices, io, activation, allocation, metadata, cache, locking, lvmpolld. Use "all" to see everything. #Stime#Scommand#Sfileline#SmessageThe fields included in debug output written to log file. Use "all" to include everything (the default). The fields included in debug output written to stderr. Use "all" to include everything (the default). Maintain a backup of the current metadata configuration. Think very hard before turning this off! Location of the metadata backup files. Remember to back up this directory regularly! Maintain an archive of old metadata configurations. Think very hard before turning this off. Location of the metadata archive files. Remember to back up this directory regularly! Minimum number of archives to keep. Minimum number of days to keep archive files. Number of lines of history to store in ~/.lvm_history. The file creation mask for any files and directories created. Interpreted as octal if the first digit is zero. No on-disk metadata changes will be made in test mode. Equivalent to having the -t option on every command. Default value for --units argument. Distinguish between powers of 1024 and 1000 bytes. The LVM commands distinguish between powers of 1024 bytes, e.g. KiB, MiB, GiB, and powers of 1000 bytes, e.g. KB, MB, GB. If scripts depend on the old behaviour, disable this setting temporarily until they are updated. Display unit suffix for sizes. This setting has no effect if the units are in human-readable form (global/units = "h") in which case the suffix is always displayed. Enable/disable communication with the kernel device-mapper. Disable to use the tools to manipulate LVM metadata without activating any logical volumes. If the device-mapper driver is not present in the kernel, disabling this should suppress the error messages. Location of /etc system configuration directory. When disabled, fail if a lock request would block. Directory to use for LVM command file locks. Local non-LV directory that holds file-based locks while commands are in progress. A directory like /tmp that may get wiped on reboot is OK. Allow quicker VG write access during high volume read access. When there are competing read-only and read-write access requests for a volume group's metadata, instead of always granting the read-only requests immediately, delay them to allow the read-write requests to be serviced. Without this setting, write access may be stalled by a high volume of read-only requests. This option only affects file locks. Search this directory first for shared libraries. Abort a command that encounters an internal error. Treat any internal errors as fatal errors, aborting the process that encountered the internal error. Please only enable for debugging. detect_internal_vg_cache_corruptionNo operations that change on-disk metadata are permitted. Additionally, read-only commands that encounter metadata in need of repair will still be allowed to proceed exactly as if the repair had been performed (except for the unchanged vg_seqno). Inappropriate use could mess up your system, so seek advice first! The segment type used by the short mirroring option -m. The --type mirror|raid1 option overrides this setting. # Accepted values: mirror The original RAID1 implementation from LVM/DM. It is characterized by a flexible log solution (core, disk, mirrored), and by the necessity to block I/O while handling a failure. There is an inherent race in the dmeventd failure handling logic with snapshots of devices using this type of RAID1 that in the worst case could cause a deadlock. (Also see devices/ignore_lvm_mirrors.) raid1 This is a newer RAID1 implementation using the MD RAID1 personality through device-mapper. It is characterized by a lack of log options. (A log is always allocated for every device and they are placed on the same device as the image, so no separate devices are required.) This mirror implementation does not require I/O to be blocked while handling a failure. This mirror implementation is not cluster-aware and cannot be used in a shared (active/active) fashion in a cluster. # Enable mirrored 'mirror' log type for testing. # This type is deprecated to create or convert to but can be enabled to test that activation of existing mirrored logs and conversion to disk/core works. # Not supported for regular operation! The segment type used by the -i -m combination. The --type raid10|mirror option overrides this setting. The --stripes/-i and --mirrors/-m options can both be specified during the creation of a logical volume to use both striping and mirroring for the LV. There are two different implementations. # Accepted values: raid10 LVM uses MD's RAID10 personality through DM. This is the preferred option. mirror LVM layers the 'mirror' and 'stripe' segment types. The layering is done by creating a mirror LV on top of striped sub-LVs, effectively creating a RAID 0+1 array. The layering is suboptimal in terms of providing redundancy and performance. # The segment type used by the -V -L combination. The --type snapshot|thin option overrides this setting. The combination of -V and -L options creates a sparse LV. There are two different implementations. # Accepted values: snapshot The original snapshot implementation from LVM/DM. It uses an old snapshot that mixes data and metadata within a single COW storage volume and performs poorly when the size of stored data passes hundreds of MB. thin A newer implementation that uses thin provisioning. It has a bigger minimal chunk size (64KiB) and uses a separate volume for metadata. It has better performance, especially when more data is used. It also supports full snapshots. # lvdisplay_shows_full_device_pathEnable this to reinstate the previous lvdisplay name format. The default format for displaying LV names in lvdisplay was changed in version 2.02.89 to show the LV name and path separately. Previously this was always shown as /dev/vgname/lvname even when that was never a valid path in the /dev filesystem. Disable event based autoactivation commands. WARNING: setting this to zero may cause machine startup to fail. Previously, setting this to zero would enable static autoactivation services (via the lvm2-activation-generator), but the autoactivation services and generator have been removed. Use async I/O when reading and writing devices. Use lvmlockd for locking among hosts using LVM on shared storage. Applicable only if LVM is compiled with lockd support in which case there is also lvmlockd(8) man page available for more information. Retry lvmlockd lock requests this many times. Applicable only if LVM is compiled with lockd support Size in MiB to extend the internal LV holding sanlock locks. The internal LV holds locks for each LV in the VG, and after enough LVs have been created, the internal LV needs to be extended. lvcreate will automatically extend the internal LV when needed by the amount specified here. Setting this to 0 disables the automatic extension and can cause lvcreate to fail. Applicable only if LVM is compiled with lockd support The sanlock lease size in MiB to use on disks with a 4K sector size. Possible values are 1,2,4,8. The default is 8, which supports up to 2000 hosts (and max host_id 2000.) Smaller values support smaller numbers of max hosts (and max host_ids): 250, 500, 1000, 2000 for lease sizes 1,2,4,8. Disks with 512 byte sectors always use 1MiB leases and support 2000 hosts, and are not affected by this setting. The command that lvmlockctl --kill should use to force LVs offline. The lvmlockctl --kill command is run when a shared VG has lost access to locks (e.g. when sanlock has lost access to storage.) An empty string means that there will be no automatic attempt by lvmlockctl --kill to forcibly shut down LVs in the VG, and the user can manually intervene as described in lvmlockd(8). The VG name will be appended to the command specified here. The full path to the thin_check command. LVM uses this command to check that a thin pool metadata device is in a usable state. When a thin pool is activated and after it is deactivated, this command is run. Activation will only proceed if the command has an exit status of 0. Set to "" to skip this check. (Not recommended.) Also see thin_check_options. (See package device-mapper-persistent-data or thin-provisioning-tools) The full path to the thin_dump command. LVM uses this command to dump thin pool metadata. (See package device-mapper-persistent-data or thin-provisioning-tools) The full path to the thin_repair command. LVM uses this command to repair a thin metadata device if it is in an unusable state. Also see thin_repair_options. (See package device-mapper-persistent-data or thin-provisioning-tools) The full path to the thin_restore command. LVM uses this command to restore generated data for a thin pool metadata device. Also see thin_restore_options. (See package device-mapper-persistent-data or thin-provisioning-tools) #S-q#S--clear-needs-check-flagList of options passed to the thin_check command. With thin_check version 2.1 or newer you can add the option --ignore-non-fatal-errors to let it pass through ignorable errors and fix them later. With thin_check version 3.2 or newer you should include the option --clear-needs-check-flag. List of options passed to the thin_repair command. List of options passed to the thin_restore command. Features to not use in the thin driver. This can be helpful for testing, or to avoid using a feature that is causing problems. Features include: block_size, discards, discards_non_power_2, external_origin, metadata_resize, external_origin_extend, error_if_no_space. # Example thin_disabled_features = [ "discards", "block_size" ] # Features to not use in the cache driver. This can be helpful for testing, or to avoid using a feature that is causing problems. Features include: policy_mq, policy_smq, metadata2. # Example cache_disabled_features = [ "policy_smq" ] # The full path to the cache_check command. LVM uses this command to check that a cache metadata device is in a usable state. When a cached LV is activated and after it is deactivated, this command is run. Activation will only proceed if the command has an exit status of 0. Set to "" to skip this check. (Not recommended.) Also see cache_check_options. (See package device-mapper-persistent-data or thin-provisioning-tools) The full path to the cache_dump command. LVM uses this command to dump cache pool metadata. (See package device-mapper-persistent-data or thin-provisioning-tools) The full path to the cache_repair command. LVM uses this command to repair a cache metadata device if it is in an unusable state. Also see cache_repair_options. (See package device-mapper-persistent-data or thin-provisioning-tools) The full path to the cache_restore command. LVM uses this command to restore generated data for a cache metadata device. Also see cache_restore_options. (See package device-mapper-persistent-data or thin-provisioning-tools) List of options passed to the cache_check command. With cache_check version 5.0 or newer you should include the option --clear-needs-check-flag. List of options passed to the cache_repair command. List of options passed to the cache_restore command. The full path to the vdoformat command. LVM uses this command to initial data volume for VDO type logical volume List of options passed added to standard vdoformat command. Features to not use in the vdo driver. This can be helpful for testing, or to avoid using a feature that is causing problems. Features include: online_rename, version4 # Example vdo_disabled_features = [ "online_rename", "version4" ] # The full path to the fsadm command. LVM uses this command to help with lvresize -r operations. The method LVM uses to set the local system ID. Volume Groups can also be given a system ID (by vgcreate, vgchange, or vgimport.) A VG on shared storage devices is accessible only to the host with a matching system ID. See 'man lvmsystemid' for information on limitations and correct usage. # Accepted values: none The host has no system ID. lvmlocal Obtain the system ID from the system_id setting in the 'local' section of an lvm configuration file, e.g. lvmlocal.conf. uname Set the system ID from the hostname (uname) of the system. System IDs beginning localhost are not permitted. appmachineid Use an LVM-specific derivation of the local machine-id as the system ID. See 'man machine-id'. machineid Use the contents of the machine-id file to set the system ID. (appmachineid is recommended to avoid exposing the confidential machine-id.) file Use the contents of another file (system_id_file) to set the system ID. # The full path to the file containing a system ID. This is used when system_id_source is set to 'file'. Comments starting with the character # are ignored. Perform internal checks of libdevmapper operations. Useful for debugging problems with activation. Some of the checks may be expensive, so it's best to use this only when there seems to be a problem. Use lvmpolld to supervise long running LVM commands. When enabled, control of long running LVM commands is transferred from the original LVM command to the lvmpolld daemon. This allows the operation to continue independent of the original LVM command. After lvmpolld takes over, the LVM command displays the progress of the ongoing operation. lvmpolld itself runs LVM commands to manage the progress of ongoing operations. lvmpolld can be used as a native systemd service, which allows it to be started on demand, and to use its own control group. When this option is disabled, LVM commands will supervise long running operations by forking themselves. Applicable only if LVM is compiled with lvmpolld support. Enable D-Bus notification from LVM commands. When enabled, an LVM command that changes PVs, changes VG metadata, or changes the activation state of an LV will send a notification. The amount of memory in KiB that LVM allocates to perform disk io. LVM performance may benefit from more io memory when there are many disks or VG metadata is large. Increasing this size may be necessary when a single copy of VG metadata is larger than the current setting. This value should usually not be decreased from the default; setting it too low can result in lvm failing to read VGs. Use udev notifications to synchronize udev and LVM. The --noudevsync option overrides this setting. When disabled, LVM commands will not wait for notifications from udev, but continue irrespective of any possible udev processing in the background. Only use this if udev is not running or has rules that ignore the devices LVM creates. If enabled when udev is not running, and LVM processes are waiting for udev, run the command 'dmsetup udevcomplete_all' to wake them up. Use udev rules to manage LV device nodes and symlinks. When disabled, LVM will manage the device nodes and symlinks for active LVs itself. Manual intervention may be required if this setting is changed while LVs are active. Use extra checks in LVM to verify udev operations. This enables additional checks (and if necessary, repairs) on entries in the device directory after udev has completed processing its events. Useful for diagnosing problems with LVM/udev interactions. Retry failed LV deactivation. If LV deactivation fails, LVM will retry for a few seconds before failing. This may happen because a process run from a quick udev rule temporarily opened the device. Method to fill missing stripes when activating an incomplete LV. Using 'error' will make inaccessible parts of the device return I/O errors on access. Using 'zero' will return success (and zero) on I/O You can instead use a device path, in which case, that device will be used in place of missing stripes. Using anything other than 'error' with mirrored or snapshotted volumes is likely to result in data corruption. Use the linear target to optimize single stripe LVs. When disabled, the striped target is used. The linear target is an optimised version of the striped target that only handles a single stripe. Stack size in KiB to reserve for use while devices are suspended. Insufficient reserve risks I/O deadlock during device suspension. Value 0 disables memory locking. Memory size in KiB to reserve for use while devices are suspended. Insufficient reserve risks I/O deadlock during device suspension. Value 0 disables memory locking. Nice value used while devices are suspended. Use a high priority so that LVs are suspended for the shortest possible time. Only LVs selected by this list are activated. If this list is defined, an LV is only activated if it matches an entry in this list. If this list is undefined, it imposes no limits on LV activation (all are allowed). # Accepted values: vgname The VG name is matched exactly and selects all LVs in the VG. vgname/lvname The VG name and LV name are matched exactly and selects the LV. @tag Selects an LV if the specified tag matches a tag set on the LV or VG. @* Selects an LV if a tag defined on the host is also set on the LV or VG. See tags/hosttags. If any host tags exist but volume_list is not defined, a default single-entry list containing '@*' is assumed. # Example volume_list = [ "vg1", "vg2/lvol1", "@tag1", "@*" ] # A list of VGs or LVs that should be autoactivated. Autoactivation is an activation command run with -aay, i.e. vgchange -aay, lvchange -aay, or pvscan --cache -aay. When this list is defined, an autoactivation command will only activate LVs included in the list. If this list is undefined, it has no effect. If this list is defined but empty, then no LVs will be autoactivated. LVs can be included in the list by LV name, VG name (applies to all LVs in the VG), or tag name. VGs and LVs can also have an autoactivation property set in metadata, see --setautoactivation. LVs included in this list will not be autoactivated if the VG or LV autoactivation property is disabled (see vgs or lvs "-o autoactivation"). The volume_list setting and the "activation skip" property also apply to autoactivation. The -aay option is meant to be used by activation commands that are run automatically by the system, e.g. from systemd services. # Accepted values: vgname The VG name is matched exactly and selects all LVs in the VG. vgname/lvname The VG name and LV name are matched exactly and selects the LV. @tag Selects an LV if the specified tag matches a tag set on the LV or VG. @* Selects an LV if a tag defined on the host is also set on the LV or VG. See tags/hosttags. If any host tags exist but volume_list is not defined, a default single-entry list containing '@*' is assumed. # Example auto_activation_volume_list = [ "vg1", "vg2/lvol1", "@tag1", "@*" ] # LVs in this list are activated in read-only mode. If this list is defined, each LV that is to be activated is checked against this list, and if it matches, it is activated in read-only mode. This overrides the permission setting stored in the metadata, e.g. from --permission rw. # Accepted values: vgname The VG name is matched exactly and selects all LVs in the VG. vgname/lvname The VG name and LV name are matched exactly and selects the LV. @tag Selects an LV if the specified tag matches a tag set on the LV or VG. @* Selects an LV if a tag defined on the host is also set on the LV or VG. See tags/hosttags. If any host tags exist but volume_list is not defined, a default single-entry list containing '@*' is assumed. # Example read_only_volume_list = [ "vg1", "vg2/lvol1", "@tag1", "@*" ] # This has been replaced by the activation/raid_region_size setting. Size in KiB of each raid or mirror synchronization region. Size in KiB of each raid or mirror synchronization region. The clean/dirty state of data is tracked for each region. The value is rounded down to a power of two if necessary, and is ignored if it is not a multiple of the machine memory page size. Return errors if a thin pool runs out of space. The --errorwhenfull option overrides this setting. When enabled, writes to thin LVs immediately return an error if the thin pool is out of data space. When disabled, writes to thin LVs are queued if the thin pool is out of space, and processed when the thin pool data space is extended. New thin pools are assigned the behavior defined here. Setting to use when there is no readahead setting in metadata. # Accepted values: none Disable readahead. auto Use default value chosen by kernel. # Defines how a device failure in a RAID LV is handled. This includes LVs that have the following segment types: raid1, raid4, raid5*, and raid6*. If a device in the LV fails, the policy determines the steps performed by dmeventd automatically, and the steps performed by the manual command lvconvert --repair --use-policies. Automatic handling requires dmeventd to be monitoring the LV. # Accepted values: warn Use the system log to warn the user that a device in the RAID LV has failed. It is left to the user to run lvconvert --repair manually to remove or replace the failed device. As long as the number of failed devices does not exceed the redundancy of the LV (1 device for raid4/5, 2 for raid6), the LV will remain usable. allocate Attempt to use any extra physical volumes in the VG as spares and replace faulty devices. # Defines how a device failure in a 'mirror' LV is handled. An LV with the 'mirror' segment type is composed of mirror images (copies) and a mirror log. A disk log ensures that a mirror LV does not need to be re-synced (all copies made the same) every time a machine reboots or crashes. If a device in the LV fails, this policy determines the steps performed by dmeventd automatically, and the steps performed by the manual command lvconvert --repair --use-policies. Automatic handling requires dmeventd to be monitoring the LV. # Accepted values: remove Simply remove the faulty device and run without it. If the log device fails, the mirror would convert to using an in-memory log. This means the mirror will not remember its sync status across crashes/reboots and the entire mirror will be re-synced. If a mirror image fails, the mirror will convert to a non-mirrored device if there is only one remaining good copy. allocate Remove the faulty device and try to allocate space on a new device to be a replacement for the failed device. Using this policy for the log is fast and maintains the ability to remember sync state through crashes/reboots. Using this policy for a mirror device is slow, as it requires the mirror to resynchronize the devices, but it will preserve the mirror characteristic of the device. This policy acts like 'remove' if no suitable device and space can be allocated for the replacement. allocate_anywhere Not yet implemented. Useful to place the log device temporarily on the same physical volume as one of the mirror images. This policy is not recommended for mirror devices since it would break the redundant nature of the mirror. This policy acts like 'remove' if no suitable device and space can be allocated for the replacement. # Defines how a device failure in a 'mirror' log LV is handled. The mirror_image_fault_policy description for mirrored LVs also applies to mirrored log LVs. This has been replaced by the activation/mirror_image_fault_policy setting. Define how a device failure affecting a mirror is handled. Auto-extend a snapshot when its usage exceeds this percent. Setting this to 100 disables automatic extension. The minimum value is 50 (a smaller value is treated as 50.) Also see snapshot_autoextend_percent. Automatic extension requires dmeventd to be monitoring the LV. # Example Using 70% autoextend threshold and 20% autoextend size, when a 1G snapshot exceeds 700M, it is extended to 1.2G, and when it exceeds 840M, it is extended to 1.44G: snapshot_autoextend_threshold = 70 # Auto-extending a snapshot adds this percent extra space. The amount of additional space added to a snapshot is this percent of its current size. # Example Using 70% autoextend threshold and 20% autoextend size, when a 1G snapshot exceeds 700M, it is extended to 1.2G, and when it exceeds 840M, it is extended to 1.44G: snapshot_autoextend_percent = 20 # thin_pool_autoextend_thresholdAuto-extend a thin pool when its usage exceeds this percent. Setting this to 100 disables automatic extension. The minimum value is 50 (a smaller value is treated as 50.) Also see thin_pool_autoextend_percent. Automatic extension requires dmeventd to be monitoring the LV. # Example Using 70% autoextend threshold and 20% autoextend size, when a 1G thin pool exceeds 700M, it is extended to 1.2G, and when it exceeds 840M, it is extended to 1.44G: thin_pool_autoextend_threshold = 70 # Auto-extending a thin pool adds this percent extra space. The amount of additional space added to a thin pool is this percent of its current size. # Example Using 70% autoextend threshold and 20% autoextend size, when a 1G thin pool exceeds 700M, it is extended to 1.2G, and when it exceeds 840M, it is extended to 1.44G: thin_pool_autoextend_percent = 20 # Auto-extend a VDO pool when its usage exceeds this percent. Setting this to 100 disables automatic extension. The minimum value is 50 (a smaller value is treated as 50.) Also see vdo_pool_autoextend_percent. Automatic extension requires dmeventd to be monitoring the LV. # Example Using 70% autoextend threshold and 20% autoextend size, when a 10G VDO pool exceeds 7G, it is extended to 12G, and when it exceeds 8.4G, it is extended to 14.4G: vdo_pool_autoextend_threshold = 70 # Auto-extending a VDO pool adds this percent extra space. The amount of additional space added to a VDO pool is this percent of its current size. # Example Using 70% autoextend threshold and 20% autoextend size, when a 10G VDO pool exceeds 7G, it is extended to 12G, and when it exceeds 8.4G, it is extended to 14.4G: Do not mlock these memory areas. While activating devices, I/O to devices being (re)configured is suspended. As a precaution against deadlocks, LVM pins memory it is using so it is not paged out, and will not require I/O to reread. Groups of pages that are known not to be accessed during activation do not need to be pinned into memory. Each string listed in this setting is compared against each line in /proc/self/maps, and the pages corresponding to lines that match are not pinned. On some systems, locale-archive was found to make up over 80% of the memory used by the process. # Example mlock_filter = [ "locale/locale-archive", "gconv/gconv-modules.cache" ] # Use the old behavior of mlockall to pin all memory. Prior to version 2.02.62, LVM used mlockall() to pin the whole process's memory while activating devices. Monitor LVs that are activated. The --ignoremonitoring option overrides this setting. When enabled, LVM will ask dmeventd to monitor activated LVs. Check pvmove or lvconvert progress at this interval (seconds). When pvmove or lvconvert must wait for the kernel to finish synchronizing or merging data, they check and report progress at intervals of this number of seconds. If this is set to 0 and there is only one thing to wait for, there are no progress reports, but the process is awoken immediately once the operation is complete. Set the activation skip flag on new thin snapshot LVs. The --setactivationskip option overrides this setting. An LV can have a persistent 'activation skip' flag. The flag causes the LV to be skipped during normal activation. The lvchange/vgchange -K option is required to activate LVs that have the activation skip flag set. When this setting is enabled, the activation skip flag is set on new thin snapshot LVs. How LVs with missing devices are activated. The --activationmode option overrides this setting. # Accepted values: complete Only allow activation of an LV if all of the Physical Volumes it uses are present. Other PVs in the Volume Group may be missing. degraded Like complete, but additionally RAID LVs of segment type raid1, raid4, raid5, raid6 and raid10 will be activated if there is no data loss, i.e. they have sufficient redundancy to present the entire addressable range of the Logical Volume. partial Allows the activation of any LV even if a missing or failed PV could cause data loss with a portion of the LV inaccessible. This setting should not normally be used, but may sometimes assist with data recovery. # Locking is started only for VGs selected by this list. The rules are the same as those for volume_list. Locking is auto-started only for VGs selected by this list. The rules are the same as those for auto_activation_volume_list. Check device sizes are not smaller than corresponding PV sizes. If device size is less than corresponding PV size found in metadata, there is always a risk of data loss. If this option is set, then LVM issues a warning message each time it finds that the device size is less than corresponding PV size. You should not disable this unless you are absolutely sure about what you are doing! When enabled, LVM keeps history records about removed LVs in metadata. The information that is recorded in metadata for historical LVs is reduced when compared to original information kept in metadata for live LVs. Currently, this feature is supported for thin and thin snapshot LVs only. Retention time in seconds after which a record about individual historical logical volume is automatically destroyed. A value of 0 disables this feature. Number of copies of metadata to store on each PV. The --pvmetadatacopies option overrides this setting. # Accepted values: 2 Two copies of the VG metadata are stored on the PV, one at the front of the PV, and one at the end. 1 One copy of VG metadata is stored at the front of the PV. 0 No copies of VG metadata are stored on the PV. This may be useful for VGs containing large numbers of PVs. # Number of copies of metadata to maintain for each VG. The --vgmetadatacopies option overrides this setting. If set to a non-zero value, LVM automatically chooses which of the available metadata areas to use to achieve the requested number of copies of the VG metadata. If you set a value larger than the the total number of metadata areas available, then metadata is stored in them all. The value 0 (unmanaged) disables this automatic management and allows you to control which metadata areas are used at the individual PV level using pvchange --metadataignore y|n. The default size of the metadata area in units of 512 byte sectors. The metadata area begins at an offset of the page size from the start of the device. The first PE is by default at 1 MiB from the start of the device. The space between these is the default metadata area size. The actual size of the metadata area may be larger than what is set here due to default_data_alignment making the first PE a MiB multiple. The metadata area begins with a 512 byte header and is followed by a circular buffer used for VG metadata text. The maximum size of the VG metadata is about half the size of the metadata buffer. VGs with large numbers of PVs or LVs, or VGs containing complex LV structures, may need additional space for VG metadata. The --metadatasize option overrides this setting. Ignore metadata areas on a new PV. The --metadataignore option overrides this setting. If metadata areas on a PV are ignored, LVM will not store metadata in them. Format of LVM command's report output. If there is more than one report per command, then the format is applied for all reports. You can also change output format directly on command line using --reportformat option which has precedence over report/output_format setting. Accepted values: basic Original format with columns and rows. If there is more than one report per command, each report is prefixed with report's name for identification. json JSON format. json_std JSON format that is more compliant with JSON standard. Compared to original "json" format: - it does not use double quotes around numeric values, - it uses 'null' for undefined numeric values, - it prints string list as proper JSON array of strings instead of a single string. Note that if json or json_std output format is used, then log/command_log_report=1 is default. Do not print empty values for all report fields. If enabled, all fields that don't have a value set for any of the rows reported are skipped and not printed. Compact output is applicable only if report/buffered is enabled. If you need to compact only specified fields, use compact_output=0 and define report/compact_output_cols configuration setting instead. Do not print empty values for specified report fields. If defined, specified fields that don't have a value set for any of the rows reported are skipped and not printed. Compact output is applicable only if report/buffered is enabled. If you need to compact all fields, use compact_output=1 instead in which case the compact_output_cols setting is then ignored. Align columns in report output. Buffer report output. When buffered reporting is used, the report's content is appended incrementally to include each object being reported until the report is flushed to output which normally happens at the end of command execution. Otherwise, if buffering is not used, each object is reported as soon as its processing is finished. Format of LVM command's report output headings. Accepted values: 0 no headings, 1 headings with column abbreviations, 2 headings with full column names. A separator to use on report after each field. A separator to use for list items when reported. Use a field name prefix for each field reported. Quote field values when using field name prefixes. Output each column as a row. If set, this also implies report/prefixes=1. Use binary values 0 or 1 instead of descriptive literal values. For columns that have exactly two valid values to report (not counting the 'unknown' value which denotes that the value could not be determined). Set time format for fields reporting time values. Format specification is a string which may contain special character sequences and ordinary character sequences. Ordinary character sequences are copied verbatim. Each special character sequence is introduced by the '%' character and such sequence is then substituted with a value as described below. # Accepted values: %a The abbreviated name of the day of the week according to the current locale. %A The full name of the day of the week according to the current locale. %b The abbreviated month name according to the current locale. %B The full month name according to the current locale. %c The preferred date and time representation for the current locale (alt E) %C The century number (year/100) as a 2-digit integer. (alt E) %d The day of the month as a decimal number (range 01 to 31). (alt O) %D Equivalent to %m/%d/%y. (For Americans only. Americans should note that in other countries%d/%m/%y is rather common. This means that in international context this format is ambiguous and should not be used. %e Like %d, the day of the month as a decimal number, but a leading zero is replaced by a space. (alt O) %E Modifier: use alternative local-dependent representation if available. %F Equivalent to %Y-%m-%d (the ISO 8601 date format). %G The ISO 8601 week-based year with century as a decimal number. The 4-digit year corresponding to the ISO week number (see %V). This has the same format and value as %Y, except that if the ISO week number belongs to the previous or next year, that year is used instead. %g Like %G, but without century, that is, with a 2-digit year (00-99). %h Equivalent to %b. %H The hour as a decimal number using a 24-hour clock (range 00 to 23). (alt O) %I The hour as a decimal number using a 12-hour clock (range 01 to 12). (alt O) %j The day of the year as a decimal number (range 001 to 366). %k The hour (24-hour clock) as a decimal number (range 0 to 23); single digits are preceded by a blank. (See also %H.) %l The hour (12-hour clock) as a decimal number (range 1 to 12); single digits are preceded by a blank. (See also %I.) %m The month as a decimal number (range 01 to 12). (alt O) %M The minute as a decimal number (range 00 to 59). (alt O) %O Modifier: use alternative numeric symbols. %p Either "AM" or "PM" according to the given time value, or the corresponding strings for the current locale. Noon is treated as "PM" and midnight as "AM". %P Like %p but in lowercase: "am" or "pm" or a corresponding string for the current locale. %r The time in a.m. or p.m. notation. In the POSIX locale this is equivalent to %I:%M:%S %p. %R The time in 24-hour notation (%H:%M). For a version including the seconds, see %T below. %s The number of seconds since the Epoch, 1970-01-01 00:00:00 +0000 (UTC) %S The second as a decimal number (range 00 to 60). (The range is up to 60 to allow for occasional leap seconds.) (alt O) %t A tab character. %T The time in 24-hour notation (%H:%M:%S). %u The day of the week as a decimal, range 1 to 7, Monday being 1. See also %w. (alt O) %U The week number of the current year as a decimal number, range 00 to 53, starting with the first Sunday as the first day of week 01. See also %V and %W. (alt O) %V The ISO 8601 week number of the current year as a decimal number, range 01 to 53, where week 1 is the first week that has at least 4 days in the new year. See also %U and %W. (alt O) %w The day of the week as a decimal, range 0 to 6, Sunday being 0. See also %u. (alt O) %W The week number of the current year as a decimal number, range 00 to 53, starting with the first Monday as the first day of week 01. (alt O) %x The preferred date representation for the current locale without the time. (alt E) %X The preferred time representation for the current locale without the date. (alt E) %y The year as a decimal number without a century (range 00 to 99). (alt E, alt O) %Y The year as a decimal number including the century. (alt E) %z The +hhmm or -hhmm numeric timezone (that is, the hour and minute offset from UTC). %Z The timezone name or abbreviation. %% A literal '%' character. # List of columns to sort by when reporting 'lvm devtypes' command. See 'lvm devtypes -o help' for the list of possible fields. devtype_name,devtype_max_partitions,devtype_descriptionList of columns to report for 'lvm devtypes' command. See 'lvm devtypes -o help' for the list of possible fields. List of columns to report for 'lvm devtypes' command in verbose mode. See 'lvm devtypes -o help' for the list of possible fields. List of columns to sort by when reporting 'lvs' command. See 'lvs -o help' for the list of possible fields. lv_name,vg_name,lv_attr,lv_size,pool_lv,origin,data_percent,metadata_percent,move_pv,mirror_log,copy_percent,convert_lvList of columns to report for 'lvs' command. See 'lvs -o help' for the list of possible fields. lv_name,vg_name,seg_count,lv_attr,lv_size,lv_major,lv_minor,lv_kernel_major,lv_kernel_minor,pool_lv,origin,data_percent,metadata_percent,move_pv,copy_percent,mirror_log,convert_lv,lv_uuid,lv_profileList of columns to report for 'lvs' command in verbose mode. See 'lvs -o help' for the list of possible fields. List of columns to sort by when reporting 'vgs' command. See 'vgs -o help' for the list of possible fields. vg_name,pv_count,lv_count,snap_count,vg_attr,vg_size,vg_freeList of columns to report for 'vgs' command. See 'vgs -o help' for the list of possible fields. vg_name,vg_attr,vg_extent_size,pv_count,lv_count,snap_count,vg_size,vg_free,vg_uuid,vg_profileList of columns to report for 'vgs' command in verbose mode. See 'vgs -o help' for the list of possible fields. List of columns to sort by when reporting 'pvs' command. See 'pvs -o help' for the list of possible fields. pv_name,vg_name,pv_fmt,pv_attr,pv_size,pv_freeList of columns to report for 'pvs' command. See 'pvs -o help' for the list of possible fields. pv_name,vg_name,pv_fmt,pv_attr,pv_size,pv_free,dev_size,pv_uuidList of columns to report for 'pvs' command in verbose mode. See 'pvs -o help' for the list of possible fields. List of columns to sort by when reporting 'lvs --segments' command. See 'lvs --segments -o help' for the list of possible fields. lv_name,vg_name,lv_attr,stripes,segtype,seg_sizeList of columns to report for 'lvs --segments' command. See 'lvs --segments -o help' for the list of possible fields. lv_name,vg_name,lv_attr,seg_start,seg_size,stripes,segtype,stripesize,chunksizeList of columns to report for 'lvs --segments' command in verbose mode. See 'lvs --segments -o help' for the list of possible fields. List of columns to sort by when reporting 'pvs --segments' command. See 'pvs --segments -o help' for the list of possible fields. pv_name,vg_name,pv_fmt,pv_attr,pv_size,pv_free,pvseg_start,pvseg_sizepv_name,vg_name,pv_fmt,pv_attr,pv_size,pv_free,pvseg_start,pvseg_size,lv_name,seg_start_pe,segtype,seg_pe_rangesList of columns to sort by when reporting 'pvs --segments' command in verbose mode. See 'pvs --segments -o help' for the list of possible fields. List of columns to report for lvm fullreport's 'vgs' subreport. See 'vgs -o help' for the list of possible fields. List of columns to report for lvm fullreport's 'vgs' subreport. See 'pvs -o help' for the list of possible fields. List of columns to report for lvm fullreport's 'lvs' subreport. See 'lvs -o help' for the list of possible fields. List of columns to report for lvm fullreport's 'pvseg' subreport. See 'pvs --segments -o help' for the list of possible fields. List of columns to report for lvm fullreport's 'seg' subreport. See 'lvs --segments -o help' for the list of possible fields. List of columns to sort by when reporting lvm fullreport's 'vgs' subreport. See 'vgs -o help' for the list of possible fields. List of columns to sort by when reporting lvm fullreport's 'vgs' subreport. See 'pvs -o help' for the list of possible fields. List of columns to sort by when reporting lvm fullreport's 'lvs' subreport. See 'lvs -o help' for the list of possible fields. List of columns to sort by when reporting for lvm fullreport's 'pvseg' subreport. See 'pvs --segments -o help' for the list of possible fields. List of columns to sort by when reporting lvm fullreport's 'seg' subreport. See 'lvs --segments -o help' for the list of possible fields. Use brackets [] to mark hidden devices. Use the two words 'unknown device' in place of '[unknown]'. This is displayed when the device for a PV is not known. libdevmapper-event-lvm2mirror.soThe library dmeventd uses when monitoring a mirror device. libdevmapper-event-lvm2mirror.so attempts to recover from failures. It removes failed devices from a volume group and reconfigures a mirror as necessary. If no mirror library is provided, mirrors are not monitored through dmeventd. libdevmapper-event-lvm2raid.solibdevmapper-event-lvm2snapshot.soThe library dmeventd uses when monitoring a snapshot device. libdevmapper-event-lvm2snapshot.so monitors the filling of snapshots and emits a warning through syslog when the usage exceeds 80%. The warning is repeated when 85%, 90% and 95% of the snapshot is filled. libdevmapper-event-lvm2thin.soThe library dmeventd uses when monitoring a thin device. libdevmapper-event-lvm2thin.so monitors the filling of a pool and emits a warning through syslog when the usage exceeds 80%. The warning is repeated when 85%, 90% and 95% of the pool is filled. The plugin runs command with each 5% increment when thin-pool data volume or metadata volume gets above 50%. Command which starts with 'lvm ' prefix is internal lvm command. You can write your own handler to customise behaviour in more details. User handler is specified with the full path starting with '/'. The library dmeventd uses when monitoring a VDO pool device. libdevmapper-event-lvm2vdo.so monitors the filling of a pool and emits a warning through syslog when the usage exceeds 80%. The warning is repeated when 85%, 90% and 95% of the pool is filled. The plugin runs command with each 5% increment when VDO pool volume gets above 50%. Command which starts with 'lvm ' prefix is internal lvm command. You can write your own handler to customise behaviour in more details. User handler is specified with the full path starting with '/'. The full path to the dmeventd binary. Create a host tag using the machine name. The machine name is nodename returned by uname(2). Replace this subsection name with a custom tag name. Multiple subsections like this can be created. The '@' prefix for tags is optional. This subsection can contain host_list, which is a list of machine names. If the name of the local machine is found in host_list, then the name of this subsection is used as a tag and is applied to the local machine as a 'host tag'. If this subsection is empty (has no host_list), then the subsection name is always applied as a 'host tag'. # Example The host tag foo is given to all hosts, and the host tag bar is given to the hosts named machine1 and machine2. tags { foo { } bar { host_list = [ "machine1", "machine2" ] } } # A list of machine names. These machine names are compared to the nodename returned by uname(2). If the local machine name matches an entry in this list, the name of the subsection is applied to the machine as a 'host tag'. Defines the local system ID for lvmlocal mode. This is used when global/system_id_source is set to 'lvmlocal' in the main configuration file, e.g. lvm.conf. When used, it must be set to a unique value among all hosts sharing access to the storage, e.g. a host name. # Example Set no system ID: system_id = "" Set the system_id to a specific name: system_id = "host1" # A list of extra VG system IDs the local host can access. VGs with the system IDs listed here (in addition to the host's own system ID) can be fully accessed by the local host. (These are system IDs that the host sees in VGs, not system IDs that identify the local host, which is determined by system_id_source.) Use this only after consulting 'man lvmsystemid' to be certain of correct usage and possible dangers. The sanlock host_id used by lvmlockd. This must be unique among all the hosts using shared VGs with sanlock. Accepted values are 1-2000, except when sanlock_align_size is configured to 1, 2 or 4, which correspond to max host_id values of 250, 500, or 1000. Applicable only if LVM is compiled with support for lvmlockd+sanlock. dm_list_addunknownsys_wwidsys_serialmpath_uuidmd_uuidloop_filecrypt_uuidlvmlv_uuiddevnamewwid_naawwid_euiwwid_t10nvme_eui64nvme_nguidnvme_uuidחA Setting %scache_segtype/cache.ccommands/toolcontext.cSetting host tag: %swritecache/writecache.cwritecachewritecache_block_sizehigh_watermarklow_watermarkwriteback_jobsautocommit_blocksautocommit_timemax_agepause_writebackwritecache_setting_keywritecache_setting_valwritecache = "%s"writecache_block_size = %uhigh_watermark = %llulow_watermark = %lluwriteback_jobs = %lluautocommit_blocks = %lluautocommit_time = %llunofua = %ucleaner = %umax_age = %umetadata_only = %upause_writeback = %uwritecache_setting_key = "%s"writecache_setting_val = "%s"integrity/integrity.cdata_sectors = %llutag_size = %uinternal_hash = "%s"meta_dev = "%s"recalculate = %ujournal_sectors = %uinterleave_sectors = %ubuffer_sectors = %ujournal_watermark = %ucommit_time = %ubitmap_flush_interval = %usectors_per_bit = %lluallow_discards = %udevice_mapper/libdm-deptree.cNo integrity meta uuid.queue/daxLV %s dev %s is pmem.metadata/metadata.cLV %s dev %s not pmem.LV %s on pmemrealmisc/lvm-string.cdata_sectorstag_sizeinternal_hashmeta_devjournal_sectorsinterleave_sectorsbuffer_sectorsjournal_watermarkbitmap_flush_intervalsectors_per_bitchunk_size = %ucache_mode = "%s"metadata = "%s"metadata_format = %ucache_pool = "%s"cleaner = 1metadata_start = %lumetadata_len = %lumetadata_id = "%s" Chunk size %s Metadata format %u Mode %s Policy %sdevice_mapper/libdm-config.ccache_pool_corigmetadata_startmetadata_lenmetadata_idCache supports %s.SMQMissing cache's data uuid %s.migration_thresholdfilelinemessagelvmcache %s: now in VG %s %slocalhostWARNING: %s: fopen failed: %sLVM_SUPPRESS_SYSLOGmisc/lvm-globals.cLVM_LOG_FILE_EPOCH%s_%s_%d_%lluLVM_LOG_FILE_MAX_LINES%s%s%s failed: %sLogging initialised at %sLVM_ configuration invalid.host_filterhost_filter not supported yet%s/lvm%s%s.confFailed to create config treeprofile_params alloc failedraid/raid.cthin/thin.cInitialised segtype: %scache-poolvdo/vdo.cvdo-poolInitialised segtypes: %s, %s._init_hostnameunamearchive_init failed.backup_init failed./run/lvm/lvmpolld.socketLVM_LVMPOLLD_SOCKETdevice_mapper/mm/pool.c [%p] %s/dev/Ignoring %s: %s.device/dev-cache.cIgnoring %s: Not a directory.dir_list allocation failedReloading config filessequential_thresholdrandom_thresholdread_promote_adjustmentwrite_promote_adjustmentdiscard_promote_adjustmentDuplicate segment type %s: unloading shared library %s_set_tag: str_list_add %s failedorigin not specified in segment %s of logical volume %s.origin must be a string in segment %s of logical volume %s.Unknown LV specified for writecache origin %s in segment %s of logical volume %s.writecache not specified in segment %s of logical volume %s.writecache must be a string in segment %s of logical volume %s.Unknown logical volume %s specified for writecache in segment %s of logical volume %s.writecache block_size must be set in segment %s of logical volume %s.Unknown writecache_setting in segment %s of logical volume %s.dm-writecache module version older than minimum 1.0.0Integrity target version older than minimum 1.6.0String list allocation failed for writecache module.String list allocation failed for integrity module.String list allocation failed for cache module.Internal error: Passed segment is not integrity._integrity_add_target_line zero sizeMissing integrity's meta uuid %s.Missing integrity's origin uuid %s.Internal error: Passed segment is not writecache.Internal error: Passed segment has no writecache.WARNING: ignoring writecache setting "cleaner" which is not supported by kernel for LV %s.WARNING: ignoring writecache setting "max_age" which is not supported by kernel for LV %s.Invalid mix of cache device types in %s.Failed to build LVM dlid for %s.Missing writecache's cache uuid %s.Missing writecache's origin uuid %s.Unknown LV specified for integrity origin %s in segment %s of logical volume %s.integrity data_sectors must be set in segment %s of logical volume %s.integrity mode must be set in segment %s of logical volume %s.integrity mode invalid in segment %s of logical volume %s.integrity tag_size must be set in segment %s of logical volume %s.integrity block_size invalid in segment %s of logical volume %s.integrity internal_hash must be set in segment %s of logical volume %s.integrity internal_hash failed to be set in segment %s of logical volume %s.meta_dev must be a string in segment %s of logical volume %s.Unknown logical volume %s specified for integrity in segment %s of logical volume %s.integrity recalculate error in segment %s of logical volume %s.Unknown integrity_setting in segment %s of logical volume %s.Cache pool %s is missing cache policy, using %s.Cache pool %s uses implicit metadata format %u.Cache pool %s is missing cache mode, using %s.Internal error: Incorrect policy_settings tree, %s.Internal error: LV %s is using unknown cache metadata format %u.Couldn't read cache chunk_size in segment %s of logical volume %s.WARNING: Ignoring unsupported value for %s.cache_mode must be a string in segment %s of logical volume %s.Unknown cache_mode in segment %s of logical volume %s.policy must be a string in segment %s of logical volume %s.Failed to duplicate policy in segment %s of logical volume %s.policy_settings must have a policy_name in segment %s of logical volume %s.policy_settings must be a section in segment %s of logical volume %s.Cache data not specified in segment %s of logical volume %s.Cache data must be a string in segment %s of logical volume %s.Unknown logical volume %s specified for cache data in segment %s of logical volume %s.Cache metadata not specified in segment %s of logical volume %s.Cache metadata must be a string in segment %s of logical volume %s.Unknown logical volume %s specified for cache metadata in segment %s of logical volume %s.Unknown cache metadata format %u number in segment %s of logical volume %s.cache_pool not specified in segment %s of logical volume %s.cache_pool must be a string in segment %s of logical volume %s.Unknown logical volume %s specified for cache_pool in segment %s of logical volume %s.Cache origin not specified in segment %s of logical volume %s.Cache origin must be a string in segment %s of logical volume %s.Unknown logical volume %s specified for cache origin in segment %s of logical volume %s.Could not read cache cleaner in segment %s of logical volume %s.Couldn't read cache metadata_format in segment %s of logical volume %s.Couldn't read metadata_start in segment %s of logical volume %s.Couldn't read metadata_len in segment %s of logical volume %s.Couldn't read data_start in segment %s of logical volume %s.Couldn't read data_len in segment %s of logical volume %s.Couldn't allocate metadata_id in segment %s of logical volume %s.Couldn't read metadata_id in segment %s of logical volume %s.Couldn't format metadata_id in segment %s of logical volume %s.Couldn't allocate data_id in segment %s of logical volume %s.Couldn't read data_id in segment %s of logical volume %s.Couldn't format data_id in segment %s of logical volume %s.WARNING: The cache kernel module is version %u.%u.%u. Version 1.3.0+ is required.Cache policy %s is available%s.Target %s does not support %s.Target %s %s support disabled by %sInternal error: Passed segment is not cache.cache_add_target_line lv %s pool %sInternal error: LV %s has unknown cache mode %d.LV %s has metadata format %u unsupported by kernel.Using metadata2 format for %s.Internal error: LV %s has unknown metadata format %u.Internal error: LV %s using unsupported ranges with cache pool.Internal error: LV %s has invalid ranges metadata %llu %llu data %llu %llu.Unsupported cache's feature flags set %lu.Invalid cache's feature flag %lu.Data block size %u is lower then %u sectors.Data block size %u is higher then %u sectors.Missing cache's metadata uuid %s.Missing cache's origin uuid %s.Cache policy parameter %s is without integer value.WARNING: %s cache policy does not support "%s=%lu" setting, remove with 'lvchange --cachesettings "%s=default" ...'.Internal error: Unable to find configuration for log/%s.log/%s contains a value which is not a string. Ignoring.Unrecognised value for log/%s: %sInternal error: _destroy_config: cmd config tree not destroyed fullylvmcache adding vg list alloc failed %slvmcache adding vg name alloc failed %sWARNING: fix duplicate VGID %s for VGs %s and %s (see vgchange -u).Ignoring %s with conflicting VG info %s %s.lvmcache adding vginfo for %s %slvmcache adding vginfo found duplicate VG name %sInternal error: lvmcache_update_vgname %s %s %s %sWARNING: VG name %s is used by VGs %s and %s.WARNING: fix duplicate VG names with vgrename uuid, or vgrename --deviceslvmcache adding vginfo to name hash failed %slvmcache adding vg to name hash failed %sWARNING: Empty system ID supplied.WARNING: Invalid system ID format: %sWARNING: system ID may not begin with the string "localhost".WARNING: Failed to allocate system ID.WARNING: Ignoring extra line(s) in system ID file %s.TEST MODE: Metadata will NOT be updated and volumes will not be (de)activated.WARNING: Ignoring invalid LVM_LOG_FILE_EPOCH envvar "%s".Failed to obtain pid and starttime.WARNING: Debug log file path is too long for epoch.WARNING: Ignoring invalid LVM_LOG_MAX_LINES envvar "%s".Internal error: Unable to find configuration for log/debug_classes.log/debug_classes contains a value which is not a string. Ignoring.Unrecognised value for log/debug_classes: %sSetting log debug classes to %dUnrecognised configuration setting for global/units: %sConfigured time format is empty string.Configured time format contains non-printable characters.Invalid time format "%s" supplied.Invalid tag in config file: %sInvalid hostname string for tag %sLVM_SYSTEM_DIR or tag was too longconfig_tree_list allocation failed_init_profiles: dm_strncpy failedFailed to allocate memory for %s segtypeFailed to allocate memory for cache_pool segtypeFailed to allocate memory for cache segtypeFailed to allocate memory for VDO segtypes.Failed to allocate memory for writecache segtypeFailed to allocate memory for integrity segtype_init_hostname: dm_pool_strdup kernel_vsn failed_init_hostname: dm_pool_strdup failedWARNING: Metadata changes will NOT be backed upReleasing activation in critical section.libdevmapper exiting with %d device(s) still suspended.device_mapper/ioctl/libdm-iface.cYou have a memory leak (not released memory pool):Internal error: Unreleased memory pool(s) found.Internal error: Unable to find configuration for devices/scan.Invalid string in config file: devices/scanNon standard udev dir %s, resetting devices/obtain_device_list_from_udev.Failed to add %s to internal device cacheInternal error: Unprocessed pending delete for %d devices.raid0raid0_metaraid1raid10 raid10_near raid4@raid5raid5_nraid5_laraid5_lsraid5_raraid5_rsraid6@raid6_n_6raid6_ncraid6_nr raid6_zr@raid6_ls_6raid6_rs_6raid6_la_6raid6_ra_6aAbBcCdDeFGghHIjklmMpPrRsStTuUVwWxXyYzZ%deHImMSuUVwWycCxXyYglobal/cache_disabled_featurescache metadata2 policy_smqcache-smq and aliases cache-mqpolicy_smqcache-smqpolicy_mqcache-mq@DEFAULT_SYS_DIR@/@DEFAULT_CACHE_SUBDIR@@DEFAULT_SYS_DIR@/@DEFAULT_BACKUP_SUBDIR@@DEFAULT_SYS_DIR@/@DEFAULT_ARCHIVE_SUBDIR@@DEFAULT_SYS_DIR@/@DEFAULT_PROFILE_SUBDIR@_get_config_node_version: couldn't create version stringInternal error: Profile %s already added as %s type, but requested type is %s._config_array_line: dm_pool_strdup failedPersistent cache directory name too long.Couldn't create default backup path '%s/%s'.Couldn't create default archive path '%s/%s'.Couldn't create default profile path '%s/%s'.struct device allocation failedWARNING: bcache_invalidate: block (%d, %llu) still dirty.WARNING: bcache_invalidate: block (%d, %llu) still held.bcache_abort: block (%d, %llu) still heldUsing metadata size 960 KiB for non-standard page size %d.WARNING: async io still in flight.Limit write at %llu len %llu beyond last byte %lluSkip extending write at %llu len %llu limit %llu extra %llu sector_size %lluLimit write at %llu len %llu to len %llu rounded to %lluLimit write at %llu len %llu to len %lluInvalid adjusted write at %llu len %llu adjusted %llu limit %llu extra %llu sector_size %llucouldn't allocate control blockDevice seek error %d for offset %lluDevice seek failed for offset %lluDevice read error %d offset %llu len %lluDevice write error %d offset %llu len %lluDevice read short %u bytes remainingDevice write short %u bytes remainingFailed to add alias to dev cache.Couldn't add name to hash in dev cache.Failed to allocate configuration check handle.Internal error: config_file_check: expected file, special file or profile config source, found %s config source.Failed to open config file %s.Internal error: _cfg_def_make_path: supplied buffer too small for %s/%s%s# This configuration %s is deprecated. %s# This configuration %s is advanced. %s# This configuration %s is not officially supported. %s# This configuration %s has variable name. %s# This configuration %s does not have a default value defined. %s# This configuration %s has an automatic default value. %s# Value defined in existing configuration has been used for this setting. %s# Available since version %s. %s# Deprecated since version %s. _get_def_array_values: strdup failedInternal error: Default array value malformed for "%s", value: "%s", token: "%s".Failed to create default empty array for %s.Failed to duplicate token for default array value of %s.Failed to create default config array value for %s.Internal error: Inconsistent state reached in _check_value_differs_from_default.Failed to create default config setting node.Internal error: _add_def_node: unknown typeFailed to create default config setting node value.Failed to construct path for configuration node %s.Configuration setting "%s" unknown.Configuration section "%s" unknown.WARNING: Configuration setting "%s" has invalid type. Found%s but expected%s.Configuration setting "%s" invalid. Empty value not allowed.Configuration setting "%s" invalid. Found string value "%s", expected boolean value: 0/1, "y/n", "yes/no", "on/off", "true/false".Configuration setting "%s" invalid. It cannot be set to an empty value.Configuration %s "%s" is not customizable by a profile.Configuration %s "%s" is customizable by metadata profile only, not command profile.Configuration %s "%s" is customizable by command profile only, not metadata profile.Configuration %s "%s" is not allowed here.Internal error: %s cfg tree element not declared as boolean._log_array_value_used: failed to write node value%s not found in config: defaulting to %sInternal error: couldn't determine missing config nodes - unknown status of last config check.Failed to create default config section node.%s: bad profile name, it contains '/'.Internal error: add_profile: loaded profile has incorrect type, expected %s but %s foundInternal error: Trying to load profile %s in critical section.LVM_SYSTEM_DIR or profile name too longInternal error: _override_config_tree_from_command_profile: config cascade already contains a command profile config.Internal error: _override_config_tree_from_metadata_profile: config cascade already contains a metadata profile config.Internal error: override_config_tree_from_profile: incorrect profile source typeFailed to create configuration definition hash.Failed to insert configuration to hash.Configuration setting "%s" invalid. It's not part of any section._check_profile: profile check handle allocation failedInternal error: override_config_tree_from_string: config cascade already contains a string config.Failed to set overridden configuration entries.Ignoring invalid configuration string.Failed to allocate config source.Internal error: %s cfg tree element not declared as string.Internal error: %s cfg tree element not declared to allow empty values.Persistent cache filename too long.Internal error: %s cfg tree element not declared as integer.%s not found in config: defaulting to %ldWARNING: Configured cache_pool_max_chunks value %lu is higher then recommended %lu.str_to_str_list: string list allocation failed.str_to_str_list: string list item allocation failed.bcache no new blocks for di %d index %u with >%d errors.bcache no new blocks for di %d index %ubcache unable to insert block in radix tree (OOM?)concurrent write lock attemptedbcache failed to get block %u di %dref count on bcache block already zero_get_sysfs_value: %s: no valueDevice directory given in config file too longWARNING: unknown external device info source, using none.WARNING: failed to init udev for external device info, using none.WARNING: proc dir %s not found - some checks will be bypassedNo proc filesystem found: skipping sysfs detectionFailed to create /proc/mounts string for sysfs detectionFailed to find sysfs mount pointInvalid readahead specificationWARNING: Ignoring unknown validate_metadata setting: %s.DM_DISABLE_UDEV environment variable set.Overriding configuration to use udev_rules=0, udev_sync=0, verify_udev_operations=1.manage logical volume symlinks in device directoryLVM activation checks disabledWARNING: activation/missing_stripe_filler = "%s" is invalid,Falling back to "error" missing_stripe_filler.WARNING: activation/missing_stripe_filler = "%s" is not a block device.Ignoring invalid activation/mlock_filter entry in config fileIgnoring too small pv_min_size %ldKB, using default %dKB.WARNING: local/system_id is set, so should global/system_id_source be "lvmlocal" not "%s"?WARNING: sd_id128_get_machine_app_specific() failed %s (%d).%02x%02x%02x%02x%02x%02x%02x%02x%02x%02x%02x%02x%02x%02x%02x%02xWARNING: Unrecognised system_id_source "%s".WARNING: No system ID found from system_id_source %s.%sdevices/virtual/dmi/id/product_uuid_insert_sysfs_dev: %s: dm_snprintf failedCouldn't add device to binary tree of sysfs-only devices in dev cache.%s: dm_snprintf failed for path to holders directory.%s: path does not exist, skipping%s: dm_snprintf failed for holder %s device path._get_device_for_sysfs_dev_name_using_devno: %s: dm_snprintf failed_get_device_for_sysfs_dev_name_using_devno: %s: failed to get major and minor number%s: failed to find associated device structure for holder %s.%s: failed to allocate dev list item.Found dev %u:%u %s - exists. %.8sCouldn't insert device into binary tree.Found dev %u:%u %s - new alias.Found dev %u:%u %s - new device, path was previously %u:%u.Found dev %u:%u %s - failed to use.Found dev %u:%u %s - existing device, path was previously %u:%u.Skipping "%s" (no block devices).Creating list of system devices.WARNING: Cannot use dir %s, %s.Failed to udev_enumerate_add_match_subsystem.Failed to udev_enumerate_scan_devices.udev failed to return a device for entry %s.udev failed to return a device node for entry %s.udev failed to return a symlink name for entry %s.%s: Failed to insert devices from udev-managed directory to device cache fully%s: Failed to insert devices to device cache fullyconfig/config.cdevice/bcache.cio_destroyWARNING: %s failed: %s.misaligned data bufferio_geteventsunable to allocate sync_iodisk/lstat/dev/nvme%s is not a regular file%s is empty<#option%s# Configuration %s %s. %s# %s%s#%s%s - %s%s%s%s%s%s%s # %.*s%s%s section integer float stringSetting %s to %sUndefined profile name.profile allocation failed%s/%s.profileIgnoring invalid %s %s.%s%s%s/%s.cache%s/%s/%s.cachedatastruct/str_list.cstr_list allocation failedfgetsSet umask from %04o to %04o%s/%s/mounts_get_sysfs_dir fopensysfsDM_DISABLE_UDEVLVM will %s.LVM activation checks enabled/dev/ioerror stat failed: %sunknown devicelvmlocalappmachineid%s/machine-idproduct_uuid%s: Not available device node%sdev/block/%u:%u/holders/opendir%sblock/%s/devclosedirFound dev %u:%u %s - new.Dir path %s is too longPath %s/%s is too long.Drop alias for %u:%u %s.Failed to udev_enumerate_new.WXWWXWWWSXWWWWWWW-XWWWWWWWWWWWWWWWWbsg/bus/char/cpu/dma_heap/dri/input/snd/usb/dm_list_add_hundefinedfilemerged filesstringcommand profilemetadata profilespecial purposeD,!@T"4Device '%s' has been left open (%d remaining references).%sdev/block/%d:%d/device/blockFound %s for %d:%d from sys dm.Failed to create sysfs path for %sWARNING: cannot open devices file to read.check devices file version %s prev %sMismatching UUID or devno found %s %u:%u %s %u:%u.Creating DM cache for devno and uuid.Internal error: %d device(s) were left open and have been closed.devices/preferred_names %s: using built-in preferencespreferred_names patterns must be enclosed in quotesFailed to allocate preferred device name pattern list.Preferred device name pattern matcher creation failed.Failed to allocate a preferred device name pattern.Couldn't create binary tree for sysfs-only devices in dev cache.Couldn't create binary tree for dev-cache.Drop alias for %u:%u invalid path %s %u:%u.Ignoring dev with no valid paths for %s.Device path %s is invalid for %u:%u %s.Dropping aliases for device entry %u:%u %s for new device %u:%u %s.Dropping aliases for %u:%u before adding new path %s.dev_cache_get filter excludes %sInvalid devices file name from config setting "%s".Failed to copy devices dir pathFailed to copy devices file pathCannot access device %s for %u:%u.No device name found from %u:%u.Cannot access device %s from %u:%u.Found %s devno %u:%u expected %u:%u.Device lookup failed for %u:%u %s%s: failed to insert device list to device cache index.%s: failed to allocate device list for device cache index.device_id_system_read reduced underscores %s to %sMatch dm names %s %s for %u:%u (from cache).Match dm names %s %s for %u:%u (from stat)Match %s %s to %s: using extra %s %sdevice_ids_write create %d edit %d pending %d exists %d version %s devicesfile %sNot creating system devices file due to existing VGs.WARNING: not updating devices file with unparsed version.WARNING: not updating devices file with larger major version.WARNING: %s: cannot open for writing: %s.WARNING: %s: cannot open directory: %s.Failed to allocate buffer size %d for devices file.Failed to write buffer for devices file content.IDTYPE=%s IDNAME=%s DEVNAME=%s PVID=%s PART=%d IDTYPE=%s IDNAME=%s DEVNAME=%s PVID=%s # LVM uses devices listed in this file. # Created by LVM command %s%s pid %d at %s# HASH=%u Failed to write devices file header.WARNING: %s: failed to replace devices file: %sWrote devices file %s hash %u hashed size %u total size %u%s/devices/backup/system.devices-%s.%04u%s/devices/backup/system.devices-%s.%uWARNING: Failed to create backup file %sWARNING: Failed to write backup file %sWARNING: Failed to sync backup file %sWARNING: Failed to sort backup devices files.Limit backup %u found %u sorted %d removing %u.WARNING: devices to use does not include %sdevice_id update %s pvid %s vgid %s to %sCannot create devices file, missing devices directory %s.WARNING: devices file already locked %dWARNING: devices file lock file already open %dlock_devices_file open errno %dlock_devices_file flock errno %dSkip devices file update (busy).Skip devices file update (changed).Validating devices file entriesValidating %s %s PVID %s: initial match %sValidate %s %s PVID %s on %s: replace old wwid with %sDevice %s PVID %s is using only old wwid %s.Validate %s %s PVID %s on %s: not scannedValidate %s %s PVID %s on %s: not readValidate %s %s PVID %s on %s: filtered (%s)suspect device id serial %s for %sValidate %s %s PVID %s on %s: wrong PVID %sDevice %s has PVID %s (devices file %s)Device %s has no PVID (devices file %s)Validate %s %s PVID %s on %s: correctValidate %s %s PVID %s on %s: outdated DEVNAME %sWARNING: fixing devices file IDNAME %s for PVID %s device %sValidate %s %s PVID %s: found on %sValidate %s %s PVID %s: no device foundValidate %s %s PVID %s: no device found, remove incorrect PVIDValidate %s %s PVID none: remove entry with repeated devnameValidate %s %s PVID %s: no idname, set invalid.Validate %s %s PVID %s: no device for idtype devname, set invalid.Validated device ids: invalid=%d, update disabled.Validated device ids: invalid=%d, trying to update devices file.Validated device ids: hash mismatch, update disabled.Validated device ids: hash mismatch, trying to update devices file.Validated device ids: invalid=%d, no update needed.Override device_ids_invalid for complete hints.Validate %s %s PVID %s on %s: wrong PVID %s.Finding all devs with suspect serial numbers.Reading and filtering %d devs with suspect serial numbers.Checking %d PVs with suspect serial numbers.Matching suspect serial device id %s PVID %s prev %sMatch suspect serial device id %s PVID %s to %sMatch PVID failed in %d devs checked.Matching suspect serial device id %s unmatched PVID %s prev %sNo device matches devices file PVID %s with duplicate serial number %s previously %s.Device %s with serial number %s has PVID %s (devices file %s)Drop incorrectly matched serial %sDevices file %s %s PVID %s not found.Search for PVIDs %d trigger %d all_ids %d search all %d auto %d none %dSearch for PVIDs skipped for matching %sSearch for PVIDs reading labels.Search for PVIDs skip %s (stable id)WARNING: found PVID %s on multiple devices %s %s.WARNING: duplicate PVIDs should be changed to be unique.WARNING: use lvmdevices to select a device for PVID %s.Search for PVID %s found on %s.Devices file PVID %s has new device ID %s %s from %s.Found new device name %s for PVID %s.WARNING: new device %s for PVID %s is excluded: %s.Search for PVIDs update disabledSearch for PVIDs updating devices fileSearch for PVIDs found no updatessearched_devnames_create error fopen %dsearched_devnames_create error open dir %d# Created by LVM command %s pid %d system.devices %s at %ssearched_devnames_create error fflush %d fclose %dsearched_devnames_create error rename %dsearched_devnames created pvids %d %u devs %d %uCannot open devices file to read.Devices file invalid hash value errno %dDevices file hostname %s vs local %s.read devices file product_uuid %sDevices file product_uuid %s vs local %s.WARNING: failed to process devices file entry.Devices file comment hash %u calc hash %uDevices file refresh: missing product_uuidDevices file refresh: missing product_uuid and hostnameDevices file not found, ignoring.Failed to lock the devices file to read.Failed to read the devices file.Matching devices file entries to devicesMatch %s %s PVID %s: done previously %sMatch %s %s PVID %s: done %s (immediate)Match %s %s PVID %s: wrong devname %sMatch %s %s PVID %s: no device matchesMatch %s %s PVID %s: no idnameMatch %s %s PVID %s: idname not foundMatch %s %s PVID %s: dev %s already matched to an entryDevice %s not matched to device_idDevices file PVID %s last seen on %s not found.Devices file PVID %s not found.Devices file %s %s PVID %s last seen on %s not found.Failed to lock the devices file to create.Failed to lock the devices file.system.devices-/dev/%sFound %s for %d:%d from sys%sdev/block/%d:%d/dm/name%u %u %llu %128sFound %s for %d:%d from %s%sdev/block/%u:%u/%sdevice/device_id.cVERSIONDestroying DM devno cache.Destroying DM uuid cache.Preserving DM cache.not found in configdev_cachepreferred device name matcherstrdup dev_dir failed.Not a block device %s.Failed to get device %smetadata_versionDevice %s %s is %s.device/dev-md.c1.00.90%s/devices/dmeventd.devices%s/devices/%s%Y%m%d.%H%M%S%s/devices/%s-unused.%sDevices file moved to %sCreating %s.Failed to create %s %dInvalid device type %s.parteui.naa.t10.device/vpd_pg83t10.%seui.%snaa.%sdevice/serialdevice/vpd_pg80/dev/vd%s/class/block/%s/serialmd/uuidloop/backing_file(deleted)__QEMUmpath-CRYPT-LVM-/dev/dm-/dev/mapper/Match %s %s to %s (auto)pvcreatevgcreateCreating devices file %s%s_newunlinkw+PRODUCT_UUID=%s HOSTNAME=%s VERSION=%u.%u.%uFailed to write devices file.%s/devices/backup/Wrote backup %sdirfdRemove backup %sunlinkatDevice not found for %s.%s/D_%sDevices file update skipped.not setDrop incorrectly matched %susablempathserial missing for %sserial %s pvid %s %sserial %s nolabel %sserial %s no pvid %sfwraidserial %s pvid %s filtered %sSearch for PVID %s.Search for PVIDs filtering.Search for PVIDs on %slvmdeviceswxpvids: %d %u devs: %d %u device_ids_read already donedevice_ids_read %s# HASH=0# HASHSYSTEMIDHOSTNAMEread devices file hostname %sPRODUCT_UUIDread devices file version %sIDTYPEIDNAMEDEVNAMEPVIDPARTCannot access device %s.Match %s %s PVID %s: done %sDevices file not found: %spPPP  /run/lvm/run/lvm/searched_devnames_new/run/lvm/searched_devnames/proc/partitionsdevice/dev-ext.cdevice/dev-io.cClosed %sdevice/dev-luks.cLUKSblacklist_exceptionsblacklistdevice/dev-mpath.cmultipath wwid %s in %s %snot %sdev/block/%u:%ureadlinkDevice name is not valid.%sblock/%s/holdersPath %s is not a directory.Device %s has no holders direrror/errseg.cdevice/nvme.cNOT display/display.cPV Name %s PV UUID %sTotal PE / Free PE %u / %uerro (test mode - suppressed)device/dev-type.c%s: size is %lu sectorsIntel Raid ISM Cfg Sig. ID_FS_TYPElinux_raid_memberdevice/dev-swap.cSWAP-SPACESWAPSPACE2S1SUSPENDS2SUSPENDULSUSPEND/etc/multipath.confloopdevice-mapperblkextdrbddasdemcpowerVxDMPpower2%sdev/block/%u:%u/partitionsysfs file %s does not exist.%s/dev/block/%u:%u/md/%sdm_snprintf md %s failed%s/block/md%u/md/%sdm_snprintf old md %s failedmpath_memberDM_MULTIPATH_DEVICE_PATHunusedFailed libblkid probe for %sNo file system found on %s.No file system type on %s.BLOCK_SIZEFSLASTBLOCKFSBLOCKSIZEFSSIZEswapbtrfsdevice/dev-dasd.cioctl BIODASDINFO2%sdev/block/%u:%u/holdersdevice/filesystem.cMissing %s for %s.Cannot open %s.Unrecognized holder %s of %sFound holder %s of %s.No holder in %s/etc/mtabWARNING: Failed to open %s.device/online.cWARNING: No info in %s.vg:No vgname in %sdev:No devname in %s/run/lvm/pvs_onlineFound PVs online %d for %s/run/lvm/vgs_onlineUnlink vg online: %sCreate vg online: %sFailed to create %s: %d%u:%u vg:%s dev:%s Check pv online: %sCheck pv online %s: yesCheck pv online %s: no/run/lvm/pvs_lookupUnlink pvs_lookup: %snext freeclvm%.2fPercentage %d does not fit.read/writeread onlyINACTIVErecoveringnormaloffline (partial)LV Name %s%sVG Name %sLV UUID %sLV Creation time %sLV Removal time %s--- Logical volume ---LV Name %sInternal LV Name %sLV Write Access %sLV Creation host, time %s, %sLV Pool name %sLV Thin origin name %sLV External origin name %sLV merging to %sLV merged with %sLV Pool metadata %sLV Pool data %sLV origin of Cache LV %sLV Cache pool name %sLV Cache origin name %sLV VDO Pool data %sLV VDO Pool usage %s%%LV VDO Pool saving %s%%metadata/vdo_manip.cLV VDO Operating mode %sLV VDO Index state %sLV VDO Compression st %sLV VDO Used size %sLV VDO Pool name %s# open %uLV Size %sCache used blocks %s%%Cache metadata blocks %s%%Cache dirty blocks %s%%Cache demotions %luCache promotions %luAllocated pool data %s%%Allocated metadata %s%%Mapped size %s%%Current LE %uCOW-table size %sCOW-table LE %uAllocated to snapshot %s%%Snapshot chunk size %sMirrored volumes %uSegments %uAllocation %sRead ahead sectors autoRead ahead sectors 0Read ahead sectors %u- currently set to %uBlock device %d:%dPersistent minor %dPersistent major %dMissing%sPhysical volume %s%sPhysical extents %d to %d%sLogical volume %s%sLogical extents %d to %d%sUnassigned areaWARNING: Invalid input '%s'.[n] Accepted input: [%c]Aborted wiping of %s.Wiping %s on %s.Failed to wipe %s on %s.LVM2_memberLVM1_memberSBMAGIC_OFFSETSBMAGICPTTYPEPTMAGIC_OFFSETPTMAGICpartition tableUSAGELABELDM_snapshot_cowsoftware RAID md superblockswap signatureLUKS signatureSCSI diskIDE diskMultiple Disk (MD/SoftRAID)Loop deviceRAM diskMapped devicePartitionable MDDAC960Network Block DeviceCompaq SMART2Compaq CCISS arrayATA RaidEMC Powerpathi2o Block DiskiSeries disksNetwork block deviceATA over EthernetXen virtual block devicePlayStation 3 internal diskVirtIO diskMMC block deviceExtended device partitionsFusion IOMicron PCIe SSDViolin MemorySTECbcache block device cacheNVM ExpressZFS ZvolsVeritas Dynamic Multipathingzram block deviceUdev database has incomplete information about device %s.Found md ddf magic at %llu wrong crc %x disk %x %sSysfs path string is too long.Cannot find device name in sysfs path.Cannot find '/' in device name.Failed to get primary device for %u:%u.Sysfs path to check mpath is too long.dm device path to check mpath is too long.dev_is_mpath_component %s holder %s stat result %ddev_is_mpath_component %s holder %s %d:%d does not have dm majordev_is_mpath_component %s holder %s %u:%u already checked as %sbeing mpath.dev_is_mpath_component %s holder %s %u:%u ignore mpath componentdev_read_nvme_wwids ignore invalid nguid %s for %sdev_read_nvme_wwids ignore invalid eui64 %s for %sdtree node segment allocation failedPV Status %sallocatableerror module string list allocation failedWARNING: devices file unlock no fdWARNING: devices file unlock not lockedWARNING: devices file unlock errno %d%s: Failed to get external handle [%s].%s: External handle [%s:%p] attached%s: Failed to release external handle [%s:%p]%s: External handle [%s:%p] detachedAttempt to close device '%s' which is not open.%s: Immediate close attempt while still referencedDiscarding %lu bytes offset %lu bytes on %s. %sWARNING: %s: ioctl BLKDISCARD at offset %lu size %lu failed: %s.%s: using cached size %lu sectorsWARNING: %s: ioctl BLKGETSIZE64 %sFound md magic number at offset 0 of %s.Found md magic number at offset 4096 of %s.Found md magic number at offset %llu of %s.Found md imsm magic number at offset %llu of %s.Found md ddf magic number at offset %llu of %s.multipath config ignored %d wwidsFailed to allocate device type register.No proc filesystem found: using all block device typesFailed to create /proc/devices stringWARNING: /proc/devices line: %s, replacing major with %d.Expecting string in devices/types in config fileMax partition count missing for %s in devices/types in config fileZero partition count invalid for %s in devices/types in config fileFailed to read sysfs path for %sFailed to read sysfs partition value for %sWARNING: %s: partition path is too long.WARNING: %s: major:minor sysfs path is too long.WARNING: Readlink of %s failed.WARNING: sysfs path for %s is too long.WARNING: sysfs file %s not in expected MAJ:MIN format: %s_md_sysfs_attribute_scanf fopen failed %s_md_sysfs_attribute_scanf fgets failed %s%s sysfs attr %s not in expected format: %sdev_is_mpath_component %s no primary devdev_is_mpath_component %s %s in wwids fileFailed libblkid probe setup for %sFound blkid fstype %s fsblocksize %s on %slibblkid TYPE %s BLOCK_SIZE %d FSLASTBLOCK %llu FSBLOCKSIZE %u fs_last_byte %lluWARNING: sysfs file %s not in expected format: %sCouldn't create holder path for %s.fs_get_info %s is mounted "%s"WARNING: No device numbers in %s.WARNING: Ignoring invalid vg field in %s.WARNING: Ignoring invalid vgname in %s (%s).WARNING: Ignoring invalid devname field in %s.WARNING: Ignoring invalid devname in %s (%s).Found PV online %s for VG %s %spvscan[%d] Path %s/%s is too long.Cannot create online file path for %s %u:%u.pvscan[%d] Cannot create online file path for %s %u:%u.Incomplete online file for %s %d:%d vg %s.Incomplete devname in online file for %s.Create pv online: %s %u:%u %s.Failed to create online file for %s path %s error %dpvscan[%d] Failed to create online file for %s path %s error %dCannot write online file for %s to %s error %dExisting online file for %d:%dPV %s %d:%d is duplicate for PVID %s on %d:%d %s.pvscan[%d] PV %s %d:%d is duplicate for PVID %s on %d:%d %s.PV %s has unexpected VG %s vs %s.pvscan[%d] PV %s has unexpected VG %s vs %s.Internal error: Path %s/%s is too long.Incorrect VG lookup file %s PVID %s %s.Found PV online lookup %s for VG %s on %s.Found PVs online lookup %d for %s.dev_read_nvme_wwids cannot open %sdev_read_nvme_wwids nvme_get_nsid error %d %sdev_read_nvme_wwids nvme_identify_ns error %d %sdev_read_nvme_wwids nvme_identify_ns_descs error %d %sdev_read_nvme_wwids ignore invalid uuid %s for %sUnrecognised allocation policy %sFull LV name "%s/%s" is too long.read/write (activated read only)--- Historical Logical volume ---LV Name %s%s/%sLV Path %s%s/%sLV snapshot status source of %s%s/%s [%s] %s [%s]LV snapshot status %s destination for %s%s/%sLV snapshot status %s destination for %sChecking thin status for LV %s.WARNING: LV %s maps %s while the size is only %s.Internal error: Unrecognized operating mode: %u.Internal error: Unrecognized compression state: %u.LV Status suspendedLV Status %savailable%sCache read hits/misses %lu / %luCache wrt hits/misses %lu / %luLV type Mirror undergoing conversionFatal error while trying to detect %s on %s.WARNING: %s detected on %s. Wipe it? [y/n]: Failed to create a new blkid probe for device %s.Failed to get offset of the %s signature on %s.WARNING: Failed to get offset of the %s signature on %s. Wiping skipped.Failed to get length of the %s signature on %s.WARNING: Failed to get length of the %s signature on %s. Wiping skipped.Found existing signature on %s at offset %s: LABEL="%s" UUID="%s" TYPE="%s" USAGE="%s"WARNING: %s signature detected on %s at offset %s. Wipe it? [y/n]: Failed to wipe %s signature on %s.Failed to step back blkid probe to check just wiped signature.%d existing signature%s left on the device.DASD disk (IBM S/390, zSeries)User-mode virtual block deviceDistributed Replicated Block Device (DRBD)Ceph rados object as a Linux block deviceSUN's LDOM virtual block deviceStorage Class Memory (IBM S/390)noyescontiguouscclinglcling_by_tagstnormalnanywhereainheritiWiping %s signature on %s./etc/multipath/conf.d%s: Skipping: Unrecognised LVM device type %luInternal error: Destroying composite filter while in use %u times.Internal error: Destroying sysfs filter while in use %u times.Internal error: Destroying md filter while in use %u times.Internal error: Destroying firmware RAID filter while in use %u times.Internal error: Destroying mpath filter while in use %u times.Internal error: Destroying partitioned filter while in use %u times.Internal error: Destroying lvm_type filter while in use %u times.Internal error: Destroying usable device filter while in use %u times.Internal error: Destroying signature filter while in use %u times.Internal error: Destroying deviceid filter while in use %u times.%s: Failed to enable external handle [%s].%s: Failed to disable external handle [%s].Internal error: Destroying persistent filter while in use %u times.%u:%u: filter cache skipping (no name).%s: filter cache skipping (cached bad).%s: filter cache using (cached good).Ignore invalid filter result %d %s.Failed to hash alias to filter.Internal error: PV name for %s missing in metadata export radix tree.Please remove the lvm.conf filter, it is ignored with the devices file.Please remove the lvm.conf global_filter, it is ignored with the devices file.Internal error: Destroying regex filter while in use %u times.md filter full %d excluding md component %s%s: Skipping md component device%s: Skipping md component device [%s:%p]%s: Skipping: error in md component detection%s: Firmware RAID detection is not supported by LVM natively. Skipping firmware raid detection. Internal error: Missing hook for firmware RAID recognition using external device info source %s%s: Skipping firmware RAID component device%s: Skipping firmware RAID component device [%s:%p]%s: Skipping mpath component deviceWARNING: devices file is missing %s (%u:%u) using multipath component %s.See lvmdevices --update for devices file update.%s: Skipping: Partition table signature found%s: Skipping: Partition table signature found [%s:%p]%s: Skipping: dev_get_size failed%s: Skipping: error in signature detection'%s' does not contain volume group '%s'.Failed to find cached info for PV %s.PV %s header needs rewrite for new ext versionPV %s header needs rewrite to set ext usedDoubling metadata output buffer to %uRandom lvid creation failed for %s/%s.WARNING: reading %s mda%d failed to read metadata.WARNING: repair VG metadata on %s with vgck --updatemetadata.VG %s metadata %scommit %sseq %u on %s mda header at %llu %s.VG %s metadata %scommit %sslot0 offset %llu size %llu slot1 offset %llu size %llu.Failed to write metadata area headerstruct mda_header allocation failedWARNING: Removing metadata location on %s with bad mda header.Test mode: Skipping committing %s metadata (%u)Committing file %s metadata (%u)Renaming path %s is too long for VG %s.Creating metadata area on %s at sector %lu size %lu sectorsstruct data_area_list allocation failedFilter patterns must be enclosed in quotes.Pattern must begin with 'a' or 'r'.Invalid separator at end of regex.filter-sysfs disabled: /sys/dev/block not foundCouldn't scan the archive directory (%s).Couldn't create new archive file.Created path %s/%s is too long.Couldn't create text instance object.Internal error: Passed file path name %s is too long.Couldn't copy archive directory name.Couldn't copy backup directory name.Couldn't create text format object.Consider using option --force to restore Volume Group %s with thin volumes.WARNING: Forced restore of Volume Group %s with thin volumes.Failed to allocate format instance.Failed to allocate structure for scheduled writing of PV '%s'.Format-specific setup for %s failed.Cannot restore Volume Group %s with %i PVs marked as missing.Failed to duplicate empty name.Failed to generate backup filename (for restore).Creating volume group backup "%s" (seqno %u).Couldn't create backup object.Internal error: No in use metadata areas to write.Failed to generate volume group metadata backup filename.WARNING: This metadata update is NOT backed up.Test mode: Skipping backup of volume group.Skipping backup of volume group on read-only filesystem.Backup of volume group %s metadata failed.# Generated by LVM2 version %s: %scontents = "Text Format Volume Group"creation_host = "%s" # %s %s %s %s %screation_host_system_id = "%s"pv device name size is out of bounds.Internal error: problem tracking indentationCould not allocate memory for ancestor list buffer.Couldn't create temporary archive name.Couldn't create FILE object for archive.Consider pruning %s VG archive with more than %u MiB in %u files (see archiving settings in lvm.conf).Test mode: Skipping archiving of volume group.Cannot archive volume group metadata for %s to read-only filesystem.Archiving volume group "%s" metadata (seqno %u).Skipping check for current backup, since backup is disabled.WARNING: Failed to generate backup pathname %s/%s.Text format failed to determine directory.Couldn't create temporary text file name.Failed to write metadata to %s.text_export buffer allocation failedError parsing metadata for VG %s.VG %s seqno %u metadata write to %s mda_start %llu mda_size %llu mda_last %lluVG %s %u metadata on %s (%llu bytes) exceeds maximum metadata size (%llu bytes)VG %s %u new metadata start align from %llu to beginning %uVG %s %u new metadata start align from %llu to %llu (+%llu)VG %s %u wrapping metadata new_start %llu new_size %llu to size1 %llu size2 %lluVG %s %u metadata area location old start %llu last %llu size %llu wrap %lluVG %s %u metadata area location new start %llu last %llu size %llu wrap %lluVG %s %u metadata on %s (%llu bytes) too large for circular buffer (%llu bytes with %llu used)VG %s %u metadata disk location start %llu size %llu last %lluVG %s %u metadata disk location write1 start %llu size %llu last %llu write2 start %llu size %llu last %lluVG %s %u metadata last align from %llu to %llu (+%u)VG %s %u %s adjusted metadata end %llu extra %u larger than write buffer %lluVG %s %u metadata last align from %llu to %llu (+%u) (wrapped)VG %s %u %s adjusted metadata end %llu wrap %llu extra %u larger than write buffer %lluVG %s %u %s metadata write size %llu %llu larger than buffer %lluVG %s %u metadata write at %llu size %llu (wrap %llu)VG %s %u metadata write at %llu size %llu (wrapped)Failed to write metadata wrap to %sInternal error: Missing PV for area %u of %s segment of LV %s.RAID segment has non-RAID areasInternal error: Invalid type for area %u of %s segment of LV %s.filters/filter-type.c%s: Skipping (deviceid)filters/filter-deviceid.cimporting unknown segmentunknown/unknown.cstart_extentextent_countfilters/filter-composite.cfilters/filter-sysfs.cfilters/filter-md.cfilters/filter-fwraid.cfilters/filter-mpath.cfilters/filter-partitioned.cfilters/filter-usable.cfilters/filter-signature.cfilters/filter-persistent.cgoodbadfilter caching %s %s.format_text/export.cfilters/filter-regex.c%s: New preferred name%s: Skipping (regex)failed to create sysfs path%s: Skipping (sysfs)*before**after*Failed to allocate desc.format_text/archiver.cCreated %s executing '%s'Failed to build desc.ID_PART_TABLE_TYPEDEVTYPE%s: Skipping unusable device.%s: Skipping: %s%s: Skipping lvm1 device%s: Skipping gfs-pool deviceFailed to read VG %s from %sformat_text/format-text.cRead volume group %s from %sBuffer reallocation failed.uname failed: %sWARNING: No cache info for %s(ignored)(used)empty preUnlinking %sRenaming %s to %s%s: rename to %s failed: %sTest mode: Skipping renameformat_text/text_label.cfilter regexfilter dm_regexFailed to allocate regex.Failed to create bitset.Invalid filter pattern "%s".Regex filter initialised.%sdev/blockformat_text/archive.cFile: %sUnable to read archive file.VG name: %sDescription: %sBackup Time: %sArchive file %s not found.archive_params alloc failedbackup_params alloc failedFailed to find device for PV.# %g %s2.03.33(2)-RHEL9 (2025-09-25)version = %ddescription = "%s"creation_time = %lu # %sstatus = [%s]flags = [%s]seqno = %uformat = "%s"# informationalsystem_id = "%s"lock_type = "%s"lock_args = "%s"extent_size = %umax_lv = %umax_pv = %uallocation_policy = "%s"profile = "%s"metadata_copies = %uphysical_volumes {pv%d {device = "%s"device_id_type = "%s"device_id = "%s"dev_size = %lupe_start = %luba_start = %luba_size = %lu%s {creation_timecreation_host = "%s"read_ahead = -1# Noneread_ahead = %umajor = %dminor = %dsegment_count = %u+%sstart_extent = %uextent_count = %ureshape_count = %utype = "%s%s"segment%u {historical_logical_volumes {%s"%s"removal_timeorigin = "%s%s"descendants = [%s]%s/%s_%05u-%d.vgArchive file name too long.misc/lvm-file.c%s: rename to %s failedExpiring archive %sArchive rename failed for %sfdopenWriting %s metadata to %sfsyncWrite from %s.Write[%u] from %s.VG %s metadata writing failed%ss = ["pv%d", %u%s"%s", %u%s"%s", "%s"%sStatus value is not a string.format_text/flags.cCACHE_VOLUnknown status flag '%s'.PARTIALALLOCATABLEEXPORTEDMISSINGRESIZEABLEPVMOVEREADWRITEWRITE_LOCKEDNOAUTOACTIVATECLUSTEREDSHAREDFIXED_MINORVISIBLENOTSYNCEDREBUILDRESHAPE_DATA_OFFSETRESHAPE_DELTA_DISKS_PLUSRESHAPE_DELTA_DISKS_MINUSREMOVE_AFTER_RESHAPEWRITEMOSTLYACTIVATION_SKIPERROR_WHEN_FULLMETADATA_FORMATCROP_METADATACACHE_USES_CACHEVOLKilobytesMegabytesGigabytesTerabytesPetabytesExabytesToo small to hold a PV?@P?mda_context allocation failedDevice %s %s is %lu bytes.raid%draid_disksDevice %s %s is %d.queue/minimum_io_sizequeue/optimal_io_sizealignment_offsetPV %s missing from cachepe_startMDA1 startba_startdisk sizelabel scan sizeMDA0 endpe_endba_endformat_instance%s.tmpcontentsmissing contents fieldformat_text/import_vsn1.cText Format Volume Groupunrecognised contents fieldmissing version numberunrecognised version numberCouldn't find section '%s'.Could not find status flags.Could not read status flags.Could not read flags.descriptionEmpty pv section.dev_sizedevice_id_typecreation_hostlock_typeseqnophysical_volumesCouldn't read pv summariesdescendantsmetadata/lv_manip.cba_sizeImporting logical volume %s.allocation_policyread_aheadEmpty logical volume section.Empty segment section.reshape_countstripedSegment allocation failed_mimagetmpsegment_countmajormax_lvmax_pvmetadata_copieshistorical_logical_volumesmirrormetadata/mirror.cread_vgScanning %s found no mdas.Scanning %s mda1 summary.Scanning %s mda2 summary.Failed to allocate dir_listlabel/label.ctext_orphanInitialised format: %sformat_text/import.cid/id.cs, mda2 ( mda1 ( da1 ( ba1 (dm_pool_alloc failedlabel allocation failedrwrwexCannot extend bcache fd tableFailed to set bcache fd.open %s %s di %d fd %dFailed to open device %sFailed to write label to %sclose and reopen excl %sio_setup failed %dFailed to set up sync io.PV init requested data_alignment_sectors %llu data_alignment_offset_sectors %lluPV init config data_alignment_sectors %lluRequested PE alignment is %llu sectorsStandard PE alignment is %llu sectorsIncreasing PE alignment to page size %u sectorsDevice %s has an unknown md raid level: %dDevice %s stripe-width is %lu bytes.Adjusting PE alignment from %llu sectors to md stripe width %llu sectors for %sAdjusting PE alignment from %llu sectors to minimum io size %llu sectors for %sAdjusting PE alignment from %llu sectors to optimal io size %llu sectors for %sSetting PE alignment to %llu sectors for %s.Setting PE alignment offset to %llu sectors for %s.%s: pe_align (%llu sectors) must not be less than pe_align_offset (%llu sectors)PV init final alignment %llu sectors from align %llu align_offset %llu%s: Data alignment must not exceed device size.%s: Bootloader area with data-aligned start must not exceed device size.Setting pe start to %llu sectors after ba start %llu size %llu for %sSetting PE start to %llu sectors for %sSetting pe start to requested %llu sectors for %s%s: Bootloader area would overlap data area.Physical extents (%s) end beyond end of device (%s) %s.PV %s is a different format (seqno %s)PV %s too large for extent size %s.Internal error: invalid index of value %u used while trying to add metadata area on PV %s. Metadata layout not supported by %s format.Internal error: Metadata area with index %u already exists on PV %s and removal failed.Using limited metadata area size on %s with value %lu (limited by %s of %lu).Metadata area size too small: %lu bytes. It must be at least %u bytes.Failed to wipe new metadata area on %s at %llu len %lluNot enough space available for metadata area with index %u on PV %s.struct mda_context allocation failedstruct metadata_area allocation failedInternal error: can't remove metadata area with index %u from PV %s. Metadata layout not supported by %s format.Failed to move metadata area with index 1 while resizing PV %s.%s: Volume group filename may not end in .tmpCouldn't allocate text format context object.Couldn't create metadata index for format instance of VG %s.No cached vginfo for VG %s and ID %s.Couldn't allocate text_fid_context.Couldn't allocate format_instance object.Can't process text format file - %s.Couldn't read uuid for physical volume.Couldn't read dev size for physical volume.Failed to allocate memory for device_id_type in read_pv_sum.Failed to allocate memory for device_id in read_pv_sum.Failed to allocate memory for device hint in read_pv_sum.Empty removed logical volume section.Couldn't read uuid for removed logical volume %s in vg %s.Invalid creation_time for removed logical volume %s.Invalid removal_time for removed logical volume %s.Removed logical volume structure allocation failedCouldn't read uuid for volume group %s.Couldn't find status flags for volume group %s.Couldn't read seqno for volume group %s.Couldn't find volume group in file.Couldn't read origin for historical logical volume %s/%s%sCouldn't get descendants list for historical logical volume %s/%s%sFound empty descendants list for historical logical volume %s/%s%sUnknown origin %s for historical logical volume %s/%s%sDescendant value for historical logical volume %s/%s%s is not a string.Failed to find descendant %s for historical LV %s.Failed to allocate generic logical volume structure.Failed to allocate list item for historical logical volume %s/%s%sUnknown historical logical volume %s/%s%sFound an item that is not a stringCouldn't read status flags for physical volume.Couldn't read extent start value (pe_start) for physical volume.Couldn't find extent count (pe_count) for physical volume.Found bootloader area specification for PV %s in metadata: ba_start=%lu, ba_size=%lu.Found incomplete bootloader area specification for PV %s in metadata.Couldn't read tags for physical volume %s in %s.Failed to allocate memory for device_id_type in read_pv.Failed to allocate memory for device_id in read_pv.Failed to allocate memory for device hint in read_pv.Empty logical volume section for %s.Couldn't read status flags for logical volume %s.Invalid creation_time for logical volume %s.Couldn't read creation_host for logical volume %s.Missing creation_time for logical volume %s.WARNING: Ignoring unrecognised allocation policy %s for LV %s.Adding profile configuration %s for LV %s.Failed to add configuration profile %s for LV %s.Couldn't read tags for logical volume %s.Couldn't use another pool metadata spare logical volume %s.Logical volume %s is pool metadata spare.Logical volume %s is sanlock lv.Lost logical volume reference %sCouldn't read uuid for logical volume %s.Couldn't read 'start_extent' for segment '%s' of logical volume %s.Couldn't read 'extent_count' for segment '%s' of logical volume %s.Segment type must be a string.Couldn't read segtype %s for logical volume %s.Couldn't read tags for a segment of %s/%s.Only one segment permitted for snapshotCouldn't read segment count for logical volume %s.segment_count and actual number of segments disagree for logical volume %s.Couldn't read minor number for logical volume %s.WARNING: Couldn't read major number for logical volume %s.WARNING: Ignoring invalid major, minor number for logical volume %s.WARNING: Unrecognised flag(s) %s.Unrecognised format %s for volume group %s.Couldn't read 'seqno' for volume group %s.Error reading flags of volume group %s.Couldn't read extent size for volume group %s.Couldn't read 'max_lv' for volume group %s.Couldn't read 'max_pv' for volume group %s.WARNING: Ignoring unrecognised allocation policy %s for VG %sAdding profile configuration %s for VG %s.Failed to add configuration profile %s for VG %sCouldn't find all physical volumes for volume group %s.Couldn't read tags for volume group %s.Couldn't read all logical volume names for volume group %s.Couldn't read all historical logical volumes for volume group %s.Couldn't read all logical volumes for volume group %s.Couldn't read all removed logical volume interconnections for volume group %s.Failed to fixup mirror pointers after import for volume group %s.Failed to allocate memory for system_id in _read_vg.Couldn't create lv_names radix tree.Couldn't create pv_names radix tree.Found pv_header_extension version %u on %sWARNING: Scanning %s mda1 found mismatch with other metadata.WARNING: Scanning %s mda1 failed to save internal summary.Found metadata seqno %u in mda1 on %sWARNING: scanning %s mda1 failed to read metadata summary.WARNING: Scanning %s mda2 found mismatch with other metadata.WARNING: Scanning %s mda2 failed to save internal summary.Found metadata seqno %u in mda2 on %sWARNING: scanning %s mda2 failed to read metadata summary.Failed to allocate text format type structure.Couldn't allocate labeller object.Couldn't create text label handler.Couldn't allocate memory for labeller list object.Couldn't register text label handler.Reading metadata from %s at %llu size %d (+%d)WARNING: couldn't read volume group metadata from %s.WARNING: couldn't read volume group metadata from file.Skipped parsing metadata on %sFailed to allocate VG fmtdata for text format.There are %d physical volumes missing.UUID contains invalid character '%c'%s: Preparing PV label header %s size %lu with%s%.*lu%s%.*lu%s%s%.*lu%s%.*lu%s%s%.*lu%s%.*lu%s%s%.*lu%s%.*lu%sInternal error: %s label header currently requires a data area.Too many characters to be uuid.Couldn't read uuid: incorrect number of characters.Device open %s has DEV_IN_BCACHE already setDevice open %u:%u has no path names.Device open %s already open with di %d fd %dCan't open %s exclusively. Mounted filesystem?Drop alias for %u:%u failed open %s (%d).Invalid path %s for device %u:%u, trying different path.Label handler does not support label writesLabel sector %lu beyond range (%ld)%s: Writing label to sector %lu with stored offset %u.Scanning for labels to wipe from %sFailed to read label from %s sector %lluFailed to remove label from %s at sector %llu%s: Wiping label at sector %llu_SC_PAGESIZE returns negative value.couldn't create control block setFailed to set up async io, using sync io.WARNING: _SC_PAGESIZE returns negative value.bcache block size must be a multiple of page sizeFailed to set up io layer with %d blocks.klkklllkkkl0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ!##orphans_lvm2printDM_ABORT_ON_INTERNAL_ERRORSInternal error: failed to report cmdstatusCODE_LINE=687CODE_FILE=log/log.c%s%s %s:%d%s%s %s:%d%s%s%s %s#globaldev_read bcache not set up %sclose and reopen to write %ssome blocks are still lockedlabel/hints.cnewhints createdtouch_hints errno %d %stouch_hints close errno %d %sunlink_nohints errno %d %sclear_hints open errno %dunlink_hints errno %d %sclear_hints flush errno %d %sclear_hints close errno %d %slock_hints existing fd %dlock_hints open errno %d %slock_hints close errno %d %sunlock_hints no existing fdunlock_hints flock errno %dFinding devices to scanFailed to set up devices.Failed to get device list.get_hints: pvscan recreateget_hints: nohints filenohints_exist errno %d %snewhints_exist errno %d %sget_hints: newhints fileget_hints: no fileget_hints: lock failget_hints: read failget_hints: needs refreshget_hints: no entriesValidating hintsInvalid hints: none used.No size for %s./dev/mdclear_hint_file%s/P_%slocking/file_locking.c%s/V_%sUnrecognised lock type: %dmisc/lvm-flock.cLocking %s %c%c convertLocking %s %c%c:auxmemlock reset.mm/memlock.cglobal flock already held exlocking/locking.cstderrstdoutstdindup2dup2(%d, %d) returned %dread%d Cannot parse content of %s.metadata/cache_manip.cmetadata/lv.c %s/%s uses %sFailed to allocate memoryfailed to write log file: %s failed to write log file Unknown cache mode: %s.another LVCan't convert internal LV %s.%s_cpoolsmqreporter_poolmetadata/writecache_manip.cmetadata/integrity_manip.cbitmapunassigned:%u-%u(%u)not enablednot monitored%s is %son %stpoolvpoollvpath snprintf failedActivating logical volume %s.Thin volume %s is active.Flushing of %s aborted.Failed to deactivate %s.flush_on_suspendRemoving previous wcorig %spartialvsnprintf failed: skipping external logging function %s:%d %sAborting. Command has reached limit for logged lines (LVM_LOG_FILE_MAX_LINES=%lu).Error opening device %s for reading at %llu length %u.Error reading device %s at %llu length %u.dev_write bcache not set up %sError opening device %s for writing at %llu length %u.Error writing device %s at %llu length %u.Set last byte mixed block sizes physical %u logical %u using 512Set last byte mixed block sizes physical %u logical %u using 4096Error writing device value %s at %llu length %u.dev_set_bytes bcache not set up %s# Created empty by %s pid %d %sEnable full md component check.Filtering devices to scan (nodata)Filtering devices to scan done (nodata)Clear pvid and info for filtered dev %s.get_hints: applied using %d other %d vgname %sWARNING: metadata may not be usable with current io_memory_size %d KiBWARNING: increase lvm.conf io_memory_size to at least %llu KiBHints not used with duplicate pvsHints not used with duplicate vg namesUncertain hint for unread device %d:%d %sInvalid hint device %d:%d %s pvid %s had hint pvid %sInvalid hint device %d:%d %s pvid %s had vgname %s no VG info.Will scan %d remaining devicesextra md component check skip %llu %llu device_hint %s dev %sIgnoring PV from md component %s with PVID %s (metadata %s %llu)extra md component check %llu %llu device_hint %s dev %sInvalid hint device %d:%d %s pvid %s had vgname %s no PV info.Too long locking filename %s/P_%s.Too long locking filename %s/V_%s.Failed to convert flock on %s %dInternal error: Unknown locking mode %s.Internal error: reopen_standard_stream called on non-standard stream %*c %*d %*d %*d %*d %*d %*u %*u %*u %*u %*u %*u %*u %*d %*d %*d %*d %*d %*d %lluCannot use chunk size %s with cache pool %s metadata size %s.Minimal size for cache pool %s metadata with chunk size %s would be %s.Cannot use too small chunk size %s with cache pool %s data volume size %s.Maximum configured chunks for a cache pool is %lu.Use smaller cache pool (<%s) or bigger cache chunk size (>=%s) or enable higher values in 'allocation/cache_pool_max_chunks'.WARNING: Ignoring unrecognized journal value.Internal error: Cache pool %s has undefined cache mode, using writethrough instead.Internal error: Cannot set cache mode for non cache volume %s.Cannot use locked cache pool %s.Logical volume %s is already in use by %s.Cannot use locked origin volume %s.Cache is not supported with %s segment type of the original logical volume %s.Cache chunk size %s is not in the range %s to %s.Cache chunk size %s must be a multiple of %s.Can't prepare new cachepool name for %s.WARNING: Cannot detect default cache policy, using "mq".Default cache policy is not available.Detected default cache_policy "%s".Internal error: Cannot set cache metadata format for non cache volume %s.Failed to duplicate policy name.WARNING: Cannot detect default cache metadata format, using format: %u.Cache metadata format %u is not supported by kernel target.Replacing chunk size %s in cache pool %s with chunk size %s from profile.WARNING: Data redundancy could be lost with writeback caching of raid logical volume!Detected default cache metadata format: %u.Internal error: Failed to wipe cache pool for volume %s.Skipping wipe of %s volume with %s segtype.Aborting. Failed to activate cache pool %s.Aborting. Failed to wipe cache pool %s.Aborting. Could not deactivate cache pool %s.Failed to get mem for LV status.Failed to get device mapper status for %sNo device mapper info exists for %sInvalid device mapper status type (%d) for %sintegrity_meta_bytes %llu from lv_size_bytes %llu meta_bytes %llu initial_bytes %llu journal_sectors %uInvalid raid integrity mode (use "bitmap" or "journal")_format_pvsegs: str_list_create failedInternal error: Unknown area segtype._format_pvsegs: extent range dm_snprintf failed._format_pvsegs: extent number dm_snprintf failed._format_pvsegs: list item dm_snprintf failed_format_pvsegs: failed to add item to list_format_pvsegs: list item dm_pool_zalloc failedWARNING: Thin volume %s maps %s while the size is only %s.Internal error: for_each_sub_lv failure.Internal error: Bad pvmove structureInternal error: Cannot find mirror segment.Internal error: %s is not a RAID imageFailed to find RAID segment for %s%s on %s is not a RAID segmentInternal error: sub-LV %s was not found in raid segmentCannot remove from lv_names LV %sDuplicate LV name %s detected.Cannot insert to lv_names LV %sFailed to lock logical volume %s.Deactivating logical volume %s.Failed to unlock logical volume %s.WARNING: Skipping flush for failed cache %s.Flushing %lu blocks for cache %s.WARNING: Dirty blocks found on read-only cache volume %s.Internal error: LV %s is not cache volume.Internal error: LV %s is already dropped cache volume.Failed to activate %s to flush cache.Failed to deactivate after cleaning cache.Internal error: %s is not of RAID typeInternal error: %s on %s is not a RAID segment.LV layout list allocation failedLV role list allocation failedInternal error: WARNING: Failed to properly detect layout and role for LV %s/%s.Generating list of PVs that %s/%s uses:Overriding default 'mirror_region_size' setting with 'raid_region_size' setting of %u kiBReducing region size to %u kiB (power of 2).Using default region size %u kiB (multiple of page size).Adding %s:%u as an user of %s.Failed to allocate segment list.%s:%u is no longer a user of %s.Internal error: Segment %s:%u is not a user of %s.LV %s segment is not writecache.LV %s writecache segment has no writecache.LV %s writecache segment has no originFailed to activate LV %s for flushing writecache.Failed to flush writecache for %s.Failed to get writecache error status for %s.Failed to flush writecache (error %u) for %s.Failed to deactivate LV %s for detaching writecache.Failed to set flush_on_suspend in writecache detach %s.Failed to remove seg in writecache detach.Failed to remove lv layer in writecache detach.Failed to write VG in writecache detach.Failed to get lv_committed in writecache detach.Suspending writecache to detach %sFailed to suspend LV in writecache detach.Checking writecache errors to detach.Failed to commit VG in writecache detach.Resuming after writecache detached %sFailed to resume LV in writecache detach.Deactivating previous cachevol %sFailed to deactivate previous cachevol in writecache detach.Deactivating previous wcorig %sFailed to deactivate previous wcorig LV in writecache detach.Failed to remove previous wcorig LV in writecache detach.Failed to write and commit VG in writecache detach.LV %s segment is unsupported raid for integrity.Removing integrity from raid LV %s %sRemoving integrity layers from %sLV %s segment has no integrity metadata device.LV %s integrity segment has no originFailed to update and reload LV after integrity remove.Deactivating unused integrity layers %s %sFailed to deactivate unused iorig LV %s.Failed to deactivate unused imeta LV %s.Removing unused integrity LVs %s %sFailed to remove unused iorig LV %s.Failed to remove unused imeta LV %s.YUhV0WxU(VVWTunknownnonepublicprivatehistorylinearstripederrorzeromirrorraidthincachesparseoriginthinoriginmultithinoriginthickoriginmultithickorigincacheoriginextthinoriginmultiextthinoriginsnapshotthinsnapshotthicksnapshotpvmoveimagelogmetadatapooldatasparevdovirtualraid0raid0_metaraid1raid10raid4raid5raid5_nraid5_laraid5_raraid5_lsraid5_rsraid6raid6_zrraid6_nrraid6_nclockdsanlockcachevolwritecachewritecacheoriginintegrityintegrityoriginpre-cmdcmdorphanpvlabelvglvshellprocessing_vprint_logfatalerrorwarnnoticeinfodebug/proc/self/stat/run/lvm/hints/run/lvm/nohints/run/lvm/newhints with PV tags: Changing Consideringhistorical Failed to create new nameCannot rename locked LV %s--dry-run--verbose--yes--forcemetadata areaCan't resize reshaping LV %s. resize2fs+crypto_LUKSequal tosmaller thanlarger than cryptsetup, mount, fsck, unmount,ext2ext3ext4xfsFile system %s%s found on %s.reiserfschecksizenochangemanageFile system not reduced./dev/dm-%uLVRESIZE_FS_HELPER_PATH--cryptresize--cryptpath--newsizebytesSkip unmount in test mode.Skip fsck in test mode.Skip mount in test mode.Skip cryptsetup in test mode.Skip fs reduce in test mode.--fsreduce--fstype--lvpath--mountdir--unmount--mount--fsck--remountReduced file system %s on %s.Stack %s:%u[%u] on LV %s:%u.Internal error: Meta le != 0.Failed to suspend %s.Failed to reactivate %s.metadata/pv_manip.cqueue/discard_max_bytesqueue/discard_granularityNo meta_areas for RAID typeFailed to extend %s in %s.Failed to remove LVFailed to commit VG %sup to contiguous metadata/pv_map.cpvl->pv->devdm_pool_begin_object faileddm_pool_grow_object failedCling_to_allocated is %sset %u %s%s of %u extents eachSorting %u log areasSorting %u areascreate_pv_maps alloc failed_cdata_tdatarimagemetadata/pool_manip.c%s_%s%s_%s_%u%s_rmeta_%uFailed to insert layer for %sReducingExtending%s logical volume %s to %s%sHistorical physicallogicalat most and open btrfs filesystem resize xfs_growfsNo size change.locking/lvmlockd.cgfs2ocfs2%s/%s/%sFailed to activate %s.Failed to get LV path %s%s mtab mntpath %s/proc/mounts%4096s %4096s %16slv_info failed: aborting.resize_fsadmFilesystem check failed.Filesystem resize failed.Problem deactivating %s.%s: discarding failed.Found fs %s last_byte %lluFile system not extended.Resized %s to %u extents.metadata/thin_manip.cFile system extend error.Skip fs extend in test mode.--fsextendMemory reallocation for parallel areas failed.PV tags string allocation failed.PV tags string extension failed.%s allocation area %u %s %s start PE %u length %u leaving %u%s%s.LV %s using PV %s is not redundant.Cannot rename "%s": name format not recognized for internal LV "%s"Failed to allocate space for new nameCannot rename "%s". New logical volume name "%s" is invalid.%sLogical Volume "%s" already exists in volume group "%s"Cannot use misconfigured fsadm executable to resize %s.Couldn't create LV path for %s.Couldn't generate new LV size string.Snapshot origin volumes cannot be reduced in size yet.Resize of snapshot origin VDO volume is not supported.Snapshot origin volumes can be resized only while inactive: try lvchange -an.Cannot resize a RAID %s directly for %sCannot resize %s LV %s. Convert to more stripes first.Thin pool volumes %s cannot be reduced in size yet.Thin pool metadata volumes cannot be reduced.Cannot reduce VDO pool data volume %s.Reduce not yet allowed on LVs with writecache attached.RAID module does not support shrinking.Cannot reduce LV with integrity.Support for online metadata resize of %s not detected.Thin target does not support external origin smaller then thin volume.Ignoring PVs on command line when reducing.Internal error: LV is not specified.Can't resize locked logical volume %s.Can't resize logical volume %s while lvconvert in progress.Cannot resize logical volume %s with active component LV(s).Cannot resize logical volume %s while it is tracking a split image.Cannot resize inactive VDO logical volume %s.Cannot resize inactive VDO POOL volume %s.Cannot resize external origin logical volume %s./usr/libexec/lvresize_fs_helperCrypt header requires %s, not enough space left for crypt data.File system size %llub is adjusted for crypt data offset %ub.Found fs %s last_byte %llu new_size_bytes %lluFile system %s%s found on %s mounted at %s.File system reduce for reiserfs requires --fs resize_fsadm.Skipping check used device size for btrfs.File system device usage is not available from libblkid.File system size (%s) is %s the requested size (%s).File system reduce is not needed, skipping.File system reduce is required (see resize2fs or --resizefs.)File system reduce is required (see btrfs-progs or --resizefs.)File system reduce is required and not supported (%s).File system reduce is required using resize2fs.File system reduce is required using btrfs-progs.File system %s: fs reduce not implemented.File system needs to be mounted to reduce fs (see --fsmode).File system needs to be unmounted to reduce fs (see --fsmode).Unknown file system resize options: --fs %s --fsmode %sFile system unmount is needed for reduce.File system fsck will be run before reduce.File system mount is needed for reduce.cryptsetup resize is needed for reduce.Continue with %s file system reduce steps:%s%s%s%s%s? [y/n]:crypt device is already reduced to %llu bytes.crypt reduce is required (see --resizefs or cryptsetup resize.)Failed to resize crypt dev with lvresize_fs_helper.Reducing file system %s to %s (%llu bytes) on %s...Failed to reduce file system with lvresize_fs_helper.Failed to lock VG, cannot reduce LV.VG was changed during fs operations, restarting.File system last byte %llu is greater than new size %llu bytes.Internal error: get_only_segment_using_this_lv() called with NULL LV.%s is expected to have only one segment using it, while %s:%u uses it %d times.%s is expected to have only one segment using it, while it has %d.Internal error: No single component user of logical volume %s.Internal error: alloc_lv_segment: Missing segtype.Internal error: Try to set to high area number (%u >= %u) for LV %s.Failed to allocate widened LV segment for %s.Refusing refresh of partial LV %s. Use '--activationmode partial' to override.Failed to remove temporary SubLVs from %sInternal error: Cannot remove undefined LV.Dropping snapshot merge of %s to removed origin %s.Dropping snapshot merge of removed %s to origin %s.Internal error: Pool size mismatched data size for %sSegment extent reduction %u not divisible by #stripes %uUnable to deactivate spare logical volume %s.Internal error: Removing still active LV %s.discard_pv_segment with unallocated segment: %s PE %uSkipping discard on missing device with uuid %s.Discarding %u extents offset %lu sectors on %s.release_pv_segment with unallocated segment: %s PE %uRemove %s:%u[%u] from the top of LV %s:%u.Failed to unlock vdo pool in lvmlockd.Aborting. Failed to extend %s in %s.Failed to copy tags onto LV %s to clear metadata.Test mode: Skipping wiping of metadata areas.allocate_extents does not handle virtual segmentsInternal error: Missing allocatable pvs.Metadata format (%s) does not support required LV segment type (%s).Consider changing the metadata format by running vgconvert.Internal error: _alloc_init called for virtual segment.Internal error: _alloc_init called for non-virtual segment with no disk space.allocation pool creation failedInternal error: Bad metadata_area_countLog size needs too many extents %lu with region size of %u sectors.Adjusted allocation request to %u logical extents. Existing size %u. New size %u.Mirror log of %u extents of size %u sectors needed for region size %s._allocate called with no work to do!Number of extents requested (%u) needs to be divisible by %u.Couldn't create physical volume maps in %sParallel PVs at LE %u length %u: %sNot enough PVs with free space available for parallel allocation.Consider --alloc anywhere if desperate.Couldn't allocate areas array.Trying allocation using %s policy.Insufficient free space: %lu extents needed, but only %u available%u preferred area(s) to be filled positionally.Areas to be sorted and filled sequentially.Still need %s%u total extents from %u remaining (%u positional slots): %u (%u data/%u parity) parallel areas of %u extents eachFound %u areas for %u parallel areas and %u log areas so far.Filled %u out of %u preferred areas so far.Not using free space on existing parallel PV %s.Internal error: _alloc_parallel_area called without any allocation to do.allocated_area allocation failedMetadata does not fit on a single PV.Allocating parallel metadata area %u on %s start PE %u length %u.Allocating parallel area %u on %s start PE %u length %u.Insufficient suitable %sallocatable extents for logical volume %s: %u more requiredInsufficient suitable %sallocatable extents found for logical volume %s.Found fewer %sallocatable extents for logical volume %s than requested: using %u extents (reduced by %u).Insufficient free space for log allocation for logical volume %s.allocation handle allocation failedInternal error: Mirror layer must be inserted before adding mirrors.Conflicting region_size %u != %u.Adding segment of type %s to LV %s.Internal error: Pool %s already has extents.Name of logical volume %s is too long to be a pool name.%s: Required device-mapper target(s) not detected in your kernel.WARNING: Pool %s is created without initialization.Aborting. Failed to activate pool metadata %s.Aborting. Failed to wipe pool metadata %s.Aborting. Could not deactivate pool metadata %s.Failed to deactivate pool volume %s.Manual intervention may be required to remove abandoned LV(s) before retrying.Internal error: Non-empty LV passed to _lv_insert_empty_sublvFailed to create mapping segment for %s.Failed to create sub LV name for LV %s.Insufficient suitable allocatable extents for logical volume %sextend not needed for imeta LV %sFailed to build list of PVs for extending %s.Failed to extend integrity metadata LV %sUnable to read sync percent while LV %s is not locally active.Do full resync of extended portion of %s? [y/n]: Failed to get sync percent for %s.Skipping initial resync for extended portion of %sLV %s cannot be extended while it is recovering.Size of logical volume %s unchanged from %s (%u extents).Size of logical volume %s changed from %s (%u extents) to %s (%u extents).Cannot rename internal LV "%s".Cannot rename active VDOPOOL volume %s, VDO target feature support is missing.Failed to allocate space for new name.lvresize_extents_from_percent type %d extents %u percent_value %uReducing %u%%VG to remaining free space %s in VG.Specified LV does not have an origin LV.Internal error: Unsupported percent type %u.Converted %u%%%s into %s%u %s extents.Stripe size cannot be larger than %s.Reducing stripe size %s to maximum, physical extent size %s.Stripe size must be power of 2.Can't resize internal logical volume %s.--poolmetadatasize can be used only with thin pools.Extending thin pool metadata to %llu for larger dataLV in VG %s with lock_type %s requires lvmlockd.LV path too long for lvmlockd refresh.Cannot activate to resize %s without using device-mapper kernel driver.Ignoring fs resizing options for LV type %s.The LV must be active to safely reduce (see --fs options.)Failed to activate %s to check for fs.Logical volume %s must be active for file system %s.File system not found for --resizefs or --fs options.LUKS dm-crypt device must be active for fs resize.LV %s mounted at %s also mounted at %s.LV %s mounted at %s may have been renamed (from %s).File system resizing not supported: fs utilities do not support renamed devices.WARNING: Reducing active%s logical volume to %s.THIS MAY DESTROY YOUR DATA (filesystem etc.)Do you really want to reduce %s? [y/n]: Logical volume %s NOT reduced.Name too long - device not discarded (%s)%s: not found: device not discarded.%s: max bytes and granularity query fails.WARNING: %s: Discarding %s at offset %lu, please wait...Resized thin pool metadata %s to %u extents.File system extend for reiserfs requires --fs resize_fsadm.File system extend is not supported (%s).File system must be mounted to extend (see --fsmode).File system type %s not handled.File system fsck skipped for extending mounted fs.File system unmount is needed for extend.File system fsck will be run before extend.File system mount is needed for extend.cryptsetup resize is needed for extend.Continue with %s file system extend steps:%s%s%s%s%s? [y/n]:Internal error: Updated LV %s is not thin pool.Extending file system %s to %s (%llu bytes) on %s...Failed to extend file system with lvresize_fs_helper.Extended file system %s on %s.| D!NONEVGFREELVPVSORIGIN_create_mapspv_list allocation failed merging origin clustered and DISCARD with %u snapshots(s) with snapshot %sLV %s in VG %s is now hidden. persistentHistorical llockd_lvremove_lock %sFailed to remove cachevol %s.Failed to deactivate LV %sFailed to update pool %s.Removing snapshot volume %s.lvremovevgremovePostponing write and commit.lockd_lvremove_done unlock %sWARNING: Failed to unlock %s.cache originexternal originVDO pool (origin only)unlocking on revertRemoving layer %s for %sFailed to find layer %s in %s_mimageCreation of layer LV failedInserting layer %s for %slvol%dsnapshot exception storestart of new LVmetadata/vg.cCreating LV: thin poolCreating LV: thin volumeCreating LV: cow snapshotCreating LV: vdo volumeFailed to find vdo pool %s/%sFailed to lock vdo pool %s/%sCannot find free device_id.Found free pool device_id %u.Adding integrity to new LVCache pool is prepared.Failed to activate thin %s.Failed to activate new LV %s.Aborting. Failed to wipe %s.%s_voriginCouldn't create snapshot.deactivating to revert new lvreverting new lvlvconvertvpool%dLogical volume "%s" created.metadata/merge.cno meta areasnon power of 2 stripe sizenon-zero region_sizenon-zero write behindnon-zero min recovery ratenon-zero max recovery ratereshapenon power of 2 region sizenon-zero stripe sizeDo you really want to remove%s%s%s%s logical volume %s%s? [y/n]: Logical volume %s not removed.WARNING: Read-only activated logical volume %s not zeroed.WARNING: Logical volume %s not zeroed.Signature wiping on logical volume %s not requested.Failed to allocate generic volume list item for indirect glv %sUnable to allocate logical volume structureparallel_areas allocation failedFailed to find segment for %s extent %uLV %s in VG %s is now visible.Can't remove logical volume %s under snapshot.Can't remove external origin logical volume %s.Can't remove logical volume %s used by a mirror.Can't remove logical volume %s used as mirror log.Can't remove logical volume %s used as RAID device.Can't remove logical volume %s used by a pool.Internal error: Thin LV %s without pool.Can't remove locked logical volume %s.lockd_lvremove_lock thin pool %s for %slockd_lvremove_lock skip repeat thin pool %slockd_lvremove_lock cow origin %s for %slockd_lvremove_lock vdo pool %s for %sDetach cachevol before removing.lockd_lvremove_lock cache main %s for %sInternal error: data_lv_from_thin_pool arg not thin pool %sFailed to detach writecache from %sCannot deactivate logical volume %s.Cannot deactivate subvolume %s of logical volume %s.Ignoring update failure of pool %s.Error releasing logical volume %s with pending delete.Unable to deactivate logical volume %s.Releasing %slogical volume "%s"Error releasing %slogical volume "%s"Failed to update thin pool %s.lockd_lvremove_done skip unlock of active thin pool %s for %slockd_lvremove_done unlock thin pool %s for %slockd_lvremove_done skip unlocked thin pool %s for %slockd_lvremove_done skip unlock %s for %slockd_lvremove_done unlock %s for %s%s%sogical volume "%s" successfully removed.Failed to obtain merging snapshot progress percentage for logical volume %s.Can't remove merging snapshot logical volume %s.Removing snapshot %s that failed to merge may leave origin %s inconsistent. Proceed? [y/n]: Removing origin logical volume %s with %u snapshots(s).Removing merging origin logical volume %s.Unable to remove %s, volume is merged to %s.Removing external origin logical volume %s.Unable to fully deactivate unused cache-pool %s.Removal of pool metadata spare logical volume %s disables automatic recovery attempts after damage to a thin or cache pool. Proceed? [y/n]: Removing %s %s will remove %u dependent volume(s). Proceed? [y/n]: Updating logical volume %s on disk(s)%s.Dropping origin_only for %s as lock holds %sFailed to suspend logical volume %s.Failed to revert logical volume %s.Updating logical volume %s in kernel.Problem reactivating logical volume %s.Internal error: Wrong layer %s in %sInvalid %d segments in %s, expected only 1.Invalid %d area count(s) in %s, expected only 1.Invalid seg_type %d in %s, expected LV.Layer doesn't match segment in %s.Inconsistent extent count (%u != %u) of layer %s.Layered name is too long. Please use shorter LV name.Creating transient LV %s for mirror conversion in VG %s.Creation of transient LV %s for mirror conversion in VG %s failed.Aborting. Unable to tag transient mirror layer.Failed to write intermediate VG %s metadata for mirror conversion.Failed to commit intermediate VG %s metadata for mirror conversion.Failed to resume transient LV %s for mirror conversion in VG %s.Internal error: Empty list of LVs given for wiping.Internal error: LVs must be set visible before wiping.Failed to activate locally %s for wiping.ACTIVATION_SKIP flag set for LV %s/%s, skipping activation.Rounding size %s (%u extents) %s to stripe boundary size %s (%u extents).Maximum number of logical volumes (%u) reached in volume group %sMetadata does not support %s segments.Volume group %s does not support tags.Metadata only supports readahead values between 2 and 120.Stripe size may not exceed %s.Can't create %s without using device-mapper kernel driver.WARNING: Skipping zeroing and wiping, compiled without activation support.The extent size in volume group %s is too small to support striped RAID volumes.Reducing requested stripe size %s to maximum, physical extent size %s.Internal error: Unable to create new logical volume with no extents.Unable to create %s smaller than 1 chunk.Number of stripes (%u) must not exceed number of physical volumes (%d)lockd_lvcreate_lock creating_thin_pool %d creating_thin_volume %d created pool %d volume %dlockd_lvcreate_lock invalid thin transition creating p %d v %d created p %d v %dlockd_lvcreate_lock creating_thin_volume locking thin pool %sCouldn't find thin pool %s for creating thin volume.Failed to lock thin pool %s for creating thin volume.lockd_lvcreate_lock creating_cow_snapshot locking origin %sCannot create snapshot without origin LV in shared VG.Failed to find origin LV %s/%sFailed to lock snapshot origin LV %s/%slockd_lvcreate_lock creating_vdo_volume locking vdo pool %sInternal error: Cannot create %s volume without %s pool.Couldn't find volume %s in Volume group %s.Cannot use locked pool volume %s.Rounding size (%d extents) up to chunk boundary size (%d extents).Aborting. Failed to locally activate thin pool %s.Cannot read thin pool %s transaction id locally, perhaps skipped in lvm.conf volume_list?Cannot use thin pool %s with transaction id %lu for thin volumes. Expected transaction id %lu.Deactivating public thin pool %s.Aborting. Could not deactivate thin pool %s.Cannot create new thin volume, free space in thin pool %s reached threshold.Origin volume %s not found in Volume group %s.Caching of origin cache volume smaller then chunk size is unsupported.Internal error: Pool LV for cache is missing.Logical volume %s is not a cache pool.WARNING: New %s won't be synchronized. Don't read what you didn't write!Logical volume %s is not a thin pool.Snapshots of locked devices are not supported.Couldn't find origin volume '%s'.Can't share virtual origins. Use --virtualsize.Virtual size matching available free logical size in VDO pool.Volume group "%s" has insufficient free space (%u extents): %u required.Setting read ahead sectors %u.Setting device number to (%d, %d).Internal error: Segment in %s is not a thin pool segment.Multiple-segment mirror is not supported.lockd_init_lv: unknown lock_type.lockd_init_lv thin invalid without lockd_creating_thin_poollockd_init_lv creating new lock for thin poolTest mode: Skipping activation, zeroing and signature wiping.lockd_creating_thin_pool lockd_lv ex for new thin pool.Failed to lock thin pool after creating it.WARNING: Loss of snapshot %s will cause the activation of the %s LV %s to fail!Aborting. Failed to activate LV %s.Aborting. Failed to activate LV %s locally exclusively.Failed to suspend thin snapshot origin %s.Aborting. Failed to read transaction_id from thin pool %s.WARNING: Metadata for thin pool %s have transaction_id %lu, but active pool has %lu.Restoring previous transaction_id %lu for thin pool %s.Internal error: thin pool not lockedFailed to activate thin pool %s.Cannot activate thin pool %s, perhaps skipped in lvm.conf volume_list?Failed to deactivate thin pool %s.Aborting. Failed to activate snapshot exception store.Aborting. Failed to activate temporary volume for VDO pool creation.Aborting. Couldn't deactivate VDO LV %s with skipped activation.Aborting. Leaving cache pool %s and uncached origin volume %s.Reverting created caching layer.LV %s has no suffix for cachepool (skipping rename).Aborting. Couldn't deactivate snapshot COW area %s.Zero segment type for virtual origin not foundVirtual origin name is too long.Failed to activate sparse volume %s.Aborting. Manual intervention required.Unable to deactivate failed new LV %s. Manual intervention required.Failed to resume thin snapshot origin %s.Internal error: Unsupported creation of cache and cache pool volume.Internal error: Logical volume is not cache %s.Logical volume %s is now cached.Internal error: Creation of pool for unsupported segment type %s.Temporary logical volume "%s" created.LV %s invalid: %s for %s segment.LV %s invalid: %s (is %u) for %s segment.min recovery larger than max recovery_tdata_cdata_corig_wcorig_vdata_tpool%d_tdata_cdata_corig_wcorig_vdata%s: read_ahead is %u sectorsmirror image is not mirroredis not flagged as cache LVis missing cache pool LVsets cleaner_policyis missing cache policy namehas invalid chunk size.sets METADATA_FORMAT flagsets cache metadata formatsets cache modesets policy namesets policy settingslog LV is not a mirror logregion size is zero_mlogregion size is non power of 2zero area countzero areasextents_copied too largenon-zero origin LVnon-zero cow LVnon-zero origin_listno DataLVDataLV size variationsno MetaLVMetaLV size variationsminimum 2 areas requiredminimum 5 areas requiredminimum 4 areas requirednon-zero writebehindbogus RAID segment typeno raid image SubLVvisible raid image LVno raid meta SubLVvisible raid meta LVis missing a pool data LVis missing a pool metadata LVzero_new_blocks is invalidsets zero_new_blockssets discardssets thin_messages listsets CROP_METADATA flagis missing thin pool LVhas too large device idsets device_idsets external LVsets merge LVsets indirect_origin LVis not flagged as VDO pool LVis missing a VDO pool data LVis not VDO pool data LVsets invalid VDO parameter(s)sets vdo_pool_header_sizesets vdo_pool_virtual_extentssets vdo_paramsis not flagged as VDO LVis missing VDO pool LVsets pool LVsets chunk_sizesets transaction_idset segtype_private_cmetapvmove%uLV pvmove %s has no segment.LV %s: has no segment.Name is zero length.vg_remove_mdas %s failed%s: Couldn't get size.Adding PVs to VG %s.Adding PV %s to VG %s.PV %s has wrong block size.2.4.vg_createsnprintf random bit failed.Failed to store lvname.Failed to store lvid.Failed to hash lvname.Failed to store pvid.Failed to allocate uuid hashFailed to allocate pvid hash.Internal error: Referenced LV %s not listed in VG %s.Internal error: Referenced PV %s not listed in VG %s.Internal error: Read ahead data missing.WARNING: Failed to open %s to get readahead %s.WARNING: %s: ioctl BLKRAGET %s.Internal error: Invalid character at index %u of lock_args "%s"Internal error: Invalid colon at index %u of lock_args "%s"LV %s, segment %u invalid: %s for %s segment.is not referencing cache pool LVhas invalid cache metadata formathas invalid cache's feature flagis missing METADATA_FORMAT flagdoes not support flag ERROR_WHEN_FULL.log LV does not point back to mirror segmentregion size is bigger then LV itselflog LV is not a mirror log or a RAID imageLV %s invalid: maximum supported areas %u (is %u) for %s segment.DataLV without RAID image flagMetaLV without RAID metadata flagdata LV does not refer back to pool LVmetadata LV does not refer back to pool LVmust not have pool metadata LV setis not flagged as thin pool LVis a thin volume that must not contain thin pool segmentis not flagged as thin volume LVis a thin pool that must not contain thin volume segmentis not referencing thin pool LVexternal LV is not flagged as a external origin LVmerge LV is not flagged as a thin LVmerge LV is not flagged as mergingis not referencing VDO pool LVLV %s: segment %u mirror image %u missing mirror ptr.LV %s: mirrored LV segment %u has wrong size %u (should be %u).LV %s must have exactly one segment.LV %s: segment 1 pool data LV does not point back to same LV.LV %s: thin pool metadata LV does not use _tmeta.LV %s: cache pool metadata LV does not use _cmeta.LV %s: external origin count does not match.LV %s: external origin can't be writable.LV %s invalid: segment %u is referencing different LV.LV %s invalid: segment %u should begin at LE %u (found %u).LV %s: segment %u with len=%u has inconsistent area_len %u.LV %s: segment %u has same LV %s for both origin and snapshot.LV %s: segment %u has unassigned area %u.LV %s: segment %u has inconsistent PV area %u.LV %s: segment %u has inconsistent LV area %u.LV %s segment %u uses LV %s, but missing ptr from %s to %s.LV %s has duplicated links to LV %s segment %u.LV %s: inconsistent LE count %u != %u.LV %s is used by LV %s:%u-%u, but missing ptr from %s to %s.Reference count mismatch: LV %s has %u links to LV %s:%u-%u, which has %u links.LV %s is indirectly used by historical LV %s but that historical LV does not point back to LV %s.LV %s is indirectly used by LV %s but that LV does not point back to LV %s.LV segment %s:%u-%u is incorrectly listed as being used by LV %s.Physical volume %s not in volume group %sName cannot start with hyphen.Name starts with . or .. and has no following character(s).Name contains invalid character, valid set includes: [a-zA-Z0-9.-_+].Name length exceeds maximum limit of %d.Internal error: Unknown error %d on name validation.New volume group name "%s" is invalid.%s: already exists in filesystemRemoving physical volume "%s" from volume group "%s"Failed to remove physical volume "%s" from volume group "%s"Volume group "%s" successfully removedVolume group "%s" not properly removedPhysical extent size used for volume group %s is less than logical block size (%u bytes) that %s uses.WARNING: Device %s has size of %lu sectors which is smaller than corresponding PV size of %lu sectors. Was device resized?WARNING: PV %s has unknown block size.Devices have inconsistent block sizes (%u and %u)Devices have inconsistent logical block sizes (%u and %u).Adding physical volume '%s' to volume group '%s'Physical volume '%s' is already in volume group '%s'PV %s is used by a VG but its metadata is missing.Physical volume %s is of different format type (%s)Physical volume %s might be constructed from same volume group %sFormat-specific setup of physical volume '%s' failed.Physical volume '%s (%s)' already in the VG.No space for '%s' - volume group '%s' holds max %d physical volume(s).Unable to add %s to %s: new extent count (%lu) exceeds limit (%u).PV %s cannot be added to VG %s.vg->name allocation failed for '%s'pv_list allocation for '%s' failedVolume group %s does not support tagsFailed to add tag %s to volume group %sFailed to duplicate tag %s from %sMajor number %d outside range 0-255.Minor number %d outside range 0-255.Major number %d outside range 0-4095.Ignoring supplied major %d number - kernel assigns major numbers dynamically.Minor number %d outside range 0-1048575.Volume Group allocation policy cannot inherit from anythingPhysical extent size may not be zeroNumber of volumes may not exceed 255Couldn't create uuid for volume group '%s'.Failed to create format instanceFormat specific setup of volume group '%s' failed.Rounding up size to full physical extent %sVolume too large (%s) for extent size %s. Upper limit is less than %s.Failed to allocate bitset for setting random bits.dm_pool_begin_object failed for random list of bits.Failed to generate list of random bits.Failed to finish list of random bits.Selected %u random bits from %u: %sAdjusting ignored mdas for %s: %u of %u mdas in use but %u required. Changing %u mda.Internal error: Unable to find %u metadata areas to unignore on volume group %sCalculated readahead of LV %s is %uInternal error: VG %s allocation policy set to invalid cling_by_tags.Internal error: VG %s has external flag LVM_WRITE_LOCKED set internally.Internal error: VG %s tag %s has invalid form.Internal error: PV list corruption detected in VG %s.Internal error: VG %s PV list entry points to different VG %s.Internal error: VG name for PV %s is corrupted.Internal error: Duplicate PV id %s detected for %s in %s.Internal error: PV %s tag %s has invalid form.Internal error: PV segments corrupted in %s.Internal error: LV %s is not marked as removed while it's part of removed LV list for VG %sInternal error: LV %s is marked as removed while it's still part of the VG %sInternal error: LV %s has external flag LVM_WRITE_LOCKED set internally.Internal error: LV name "%s/%s" length %zu is not supported.Internal error: LV %s has VG UUID %s but its VG %s has UUID %sInternal error: LV %s is extra pool metadata spare volume. %u found but only 1 allowed.Internal error: LV %s is not the VG's pool metadata spare volume.Internal error: LV segments corrupted in %s.Internal error: LV %s allocation policy set to invalid cling_by_tags.Internal error: LV name %s has invalid form.Internal error: LV %s tag %s has invalid form.Internal error: #LVs (%u) != #visible LVs (%u) + #snapshots (%u) + #internal LVs (%u) in VG %sInternal error: Duplicate LV name %s detected in %s.Internal error: Duplicate LV id %s detected for %s in %s.Internal error: Segment in %s is not 2-way.Internal error: Segment in %s has wrong number of areas: %d.Internal error: Volume group %s has limited PV/LV count but limit is not set.Internal error: VG references non pool metadata spare LV %s.Internal error: VG %s with lock_type %s without lock_argsInternal error: VG %s with lock_type %s is clusteredInternal error: VG %s with lock_type %s has system_id %sInternal error: VG %s has unknown lock_type %sInternal error: VG %s has invalid lock_args charsInternal error: VG %s has lock_args %s without lock_typeInternal error: LV %s/%s has invalid lock_args charsInternal error: LV %s/%s has invalid lock_args "%s"Internal error: LV %s has duplicate lock_args %s.lock_args will be ignored on cache volInternal error: LV %s shouldn't have lock_args %s.Internal error: LV %s with no lock_type has lock_args %s.Internal error: LV %s/%s appearing in VG's historical list is not a historical LV.Internal error: Historical LV %s points to different VG %s while it is listed in VG %s.Internal error: Historical LV %s has VG UUID %s but its VG %s has UUID %sFailed to store historical LV name.Internal error: Duplicate historical LV name %s detected in %s.Failed to store historical LV id.Internal error: Duplicate historical LV id %s detected for %s in %s.Internal error: Name %s appears as live and historical LV at the same time in VG %s.Internal error: Historical LV %s is not part of any LV chain in VG %s.Failed to allocate lv_lock_args hashFailed to allocate lv_name hashUnable to split the %s segment at LE %u in LV %s.Couldn't allocate cloned LV segment.LV segment tags duplication failed.Split %s:%u[%u] at %u: %s LE %u.Split %s:%u[%u] at %u: %s PE %u.Unassigned area %u found in segment.Segment with extent %u in LV %s not found. lAllowing forced access to clustered vg %sInvalid index (%u) of mirror image supplied to shift_mirror_images().Device path name too long - log header not written (%s).Writing log header for LV %s to device %s.%s: not found: log header not written.Failed to open %s/%s to write log header.Failed to write log header to %s.WARNING: Couldn't find device with uuid %s.Couldn't find device with uuid %s.WARNING: VG %s was previously updated while PV %s was missing.Fixing up missing size (%s) for PV %sWARNING: Physical Volume %s is too large for underlying deviceFormat does not support writing physical volumesAssertion failed: can't _pv_write non-orphan PV (in VG %s)Internal error: Missing volume group.Volume group %s is not resizeable.Internal error: FID is not defined!metadata_area allocation failed%s ignored flag for mda %s at offset %lu.Automatically removing historical logical volume %s/%s%s.Failed to handle historical LVs in VG %s.Validating volume group structure.Skipping validation of volume group structure.Cannot update partial volume group %s.Cannot update volume group %s while physical volumes are missing.Cannot update volume group %s with duplicate PV devices.Cannot update volume group %s with unknown segments in it!Internal error: Unable to find %u metadata areas to ignore on volume group %sAborting vg_write: No metadata areas to write to!Internal error: lvmcache_get_outdated_devs no vginfo %sInternal error: lvmcache_get_outdated_mdas no vginfoWARNING: wiping mda on outdated PV %sFailed to read outdated pv mda header on %sFailed to write outdated pv mda header on %sWARNING: failed to wipe mda on outdated PV %s_wipe_outdated_pvs no label for %sWARNING: wiping header on outdated PV %sWARNING: failed to wipe header on outdated PV %sInternal error: lvmcache_del_outdated_devs no vginfoInternal error: Writing metadata in critical section.WARNING: updating PV header on %s for VG %s.WARNING: updating old metadata to %u on %s for VG %s.Format does not support writing volume group metadata areas.WARNING: Failed to write an MDA of VG %s.Internal error: LV %s (UUID %s) not found in committed metadata.Internal error: lvmcache_get_mdas no vginfo %sRescan for text mismatch - no mdas.Rescan for text mismatch - no mda dev.bcache_invalidate: block (%d, %llu) still heldRescan for text mismatch - cannot invalidate.Rescan for text mismatch - no mda header.Rescan for text mismatch - bad_fields.Rescan for text checksum mismatch - now %x prev %x.Rescan skipped - unchanged offset %llu checksum %x.Rescan for text offset mismatch - now %llu prev %llu.Failed to read existing physical volume '%s'No cached label for orphan PV %sMust be exactly one data area (found %d) on PV %sMust be at most one bootloader area (found %d) on PV %sWARNING: PV %s is marked in use but no VG was found using it.WARNING: PV %s might need repairing.Failed to allocate pv structure.Volume group name "%s" has invalid characters.Can't allocate DM cache memory for VG %s.WARNING: activating multiple VGs with the same name is dangerous and may fail.Cannot reopen rw device %u:%u with no valid paths di %d fd %d.Cannot reopen rw device %u:%u with no valid name di %d fd %d.Failed to open writable %s index %d fd noneFailed to open writeable %s index none fd %dFailed to open rw %s errno %d di %d fd %d.Internal error: Cannot change not opened DI with FD:%dreopen writeable %s close prev errno %d di %d fd %d.reopen writable %s di %d prev %d fd %dIgnoring metadata for VG %s from missing dev.Reading VG %s metadata from %s %lluWARNING: Reading VG %s on %s failed.WARNING: ignoring metadata seqno %u on %s for seqno %u on %s for VG %s.WARNING: Inconsistent metadata found for VG %s.See vgck --updatemetadata to correct inconsistency.Internal error: lvmcache_update_vg %s no vginfolvmcache_update_vg %s vginfo from metadataWARNING: outdated PV %s seqno %u has been removed in current VG %s seqno %u.See vgck --updatemetadata to clear outdated metadata.lvmcache_update_vg %s no info for %s %sWARNING: PV %s %s belongs to VGID %s, ignoring claim from VGID %s (%s).WARNING: PV %s %s belongs to VG %s, ignoring claim from VG %s.lvmcache_update_vg %s failed to update info for %slvmcache_update_vg %s copy ignored mdas for %slvmcache_update_vg %s failed to update mdas for %svg_read %s ignore mda for outdated dev %sInternal error: Verify PV info in %s: skip, no devVerify PV %s in %s: uncertain, no pvidVerify PV %s %s in %s: uncertain, no vginfoVerify PV %s %s in %s: fail, other VG %sVerify PV %s %s in %s: fail, other vgid %sWARNING: PV %s in VG %s is using an old PV header, modify the VG to update.WARNING: PV %s in VG %s is missing the used flag in PV header.Failed to destroy record about historical LV %s/%s.WARNING: failed to strip outdated historical lvs.Outdated record for historical logical volume "%s" automatically destroyed.VG %s is missing PV %s (last written to %s)WARNING: VG %s is missing PV %s (last written to %s).WARNING: VG %s is missing PV %s.WARNING: VG %s has unused reappeared PV %s %s.WARNING: VG %s was missing PV %s %s.WARNING: One or more devices used as PVs in VG %s have changed sizes.WARNING: Couldn't find all devices for LV %s while checking used and assumed devices.WARNING: Device mismatch detected for %s which is accessing %s instead of %s.Cannot access VG %s with lock type %s that requires lvmlockd.Cannot access VG %s due to failed lock.Test mode is not yet supported with lock type %s.WARNING: Found LVs active in VG %s with foreign system ID %s. Possible data corruption.Cannot access VG %s with system ID %s with unknown local system ID.Cannot access VG %s with system ID %s with local system ID %s.Cannot use VG %s referencing incorrect PVs.(See vgreduce --removemissing with --devices options.)Cannot change VG %s while PVs are missing.See vgreduce --removemissing and vgextend --restoremissing.WARNING: vg_read no vg copy: pool locked.WARNING: vg_read no vg copy: copy exists.WARNING: vg_read no vg copy: pre copy exists.Internal error: Missing committed config tree.Internal error: vg_read vg %p vg_precommitted %pInternal error: vg_read vg %p vg_committed %pCannot change VG %s with unknown segments in it!Reopen writeable %s uncached fd %d di %dFailed to change to rw fd %s di %d fd %d.Failed to find mirror_seg for %sLV %s on %s is not a mirror segments.Internal error: Log LV %s is not top level LV for initialization.Test mode: Skipping mirror log initialisation.Aborting. Unable to create in-sync mirror log while activation is disabled.Aborting. Unable to tag mirror log.Aborting. Failed to activate mirror log.Aborting. Failed to wipe mirror log.Aborting. Failed to write mirror log header.Aborting. Failed to deactivate mirror log. Manual intervention required.Unable to deactivate mirror log LV. Manual intervention required.Manual intervention may be required to remove abandoned log LV before retrying.Manual intervention may be required to remove/restore abandoned log LV before retrying.Unable to determine mirror sync status of %s.Unable to split non-mirrored LV %s.Internal error: split_count is zero!Detaching %d images from mirror %s.Insufficient removable PVs given to satisfy request.Unable to rename newly split LV.Failed to build new mirror, %s.Failed to build new image name for %s.Failed to generate new image names for %s.Failed to group split images into new mirror.Failed to rename newly split LV in the kernelABORTING: Failed to remove orphan volume(s).Please remove orphan volume(s) when possible.Manual intervention may be required to remove/restore abandoned LVs before retrying.Reducing mirror set %s from %u to %u image(s)%s.Incompatible parameters to _remove_mirror_images.Unable to remove primary mirror image while mirror volume %s is not in-sync.%s being removed due to failures.Failed error target substitution for %s.Cannot detach mirror log from %s.Failed to initialize log device %s.Using reduced mirror region size of %sUnable to allocate mirror extents for %s.Failed to split segment at %s extent %u.Failed to add mirror areas to %s.Internal error: Non-pvmove LV, %s, passed as argument.Internal error: Bad segment type for first segment area.Failed to build pvmove LV-type mirror %s.Internal error: Unknown mirror flag.Failed to find segment for %s extent %u.Unable to determine mirror sync status.Full resync required to convert inactive mirror volume %s to core log. Proceed? [y/n]: Logical volume %s NOT converted.Failed to build new mirror log name for %s.Failed to build new mirror image name for %s.Aborting. Failed to create mirror image LV. Remove new LV and retry.Failed to add mirror image segment to %s. Remove new LV and retry.Aborting. Failed to add mirror image segment to %s. Remove new LV and retry.Aborting. Failed to add mirror segment. Remove new LV and retry.Adjusting region_size to %s for mirrored log.Failed to initialise mirror log.Skipping clustered VG %s.Volume group %s is read-onlySettingClearingWriting metadata for VG %s.WARNING: mda without device.Failed to write VG %s.WARNING: Duplicate id found!%s=%s%s=%llu#orphans_lvm2PV %s size is zero.pv allocation failedmissingnaReading orphan VG %s.Can't get lock for %s.VG name not found for vgid %sVolume group "%s" not foundRescanning DM cache.lvmcache_update_vg %s for %sVolume group "%s" not found.Reading VG %s without a lock.Volume group %s is exportedVolume group %s is read-only.Failed to import written VG.vg_devs_checkRescanning devices for %s %sReading VG %s %sLV %s assigned to be split.lv_list alloc failed._mimage_%d%s_mimage_%%dUnable to allocate memory. and no log volumeFailed to add mirror images.All mimages of %s are gone.%u image(s) removed from %s._mimage_0_mlogtmp_%dFailed to create mirror log.Failed to form mirrored log.metadata/pv_list.cAllocation of list failed.rmeta%s_%s_%%dcoreFailed to convert mirror logNot a mirror segment.Discarding message for LV %s.%s_pmsparemetadata/pv.cSkipping invalid tag %s.Failed to clone PV name.pv_segment allocation failed%s %u: %6u %6u: %s(%u:%u)Gap in pvsegs: %u, %uWrong lvseg area typeInconsistent pvseg pointersInconsistent length: %u %uto_go <= pva->countMemory allocation failed.%s_%s%sFailed to allocate new name.raid0_metaFailed to get device count.Failed to get device health.%s called on non-raid1 LV._rimage_0Adding %s to %s.Failed to add %s to %s._rimage_metadata/segtype.cAdding PE range: start PE %u length %u on %s.Overlapping PE ranges specified (%u-%u, %u-%u) on %s.WARNING: Physical volume %s not allocatable.WARNING: Physical volume %s is missing.WARNING: No free extents on physical volume "%s".Unable to allocate physical volume list.Allocation of pe_ranges list failed.PE range error: start extent %u to end extent %u.Physical extent parsing error at %s.Activating logical volume %s before %s in kernel.Failed to activate %s before resuming %s.Internal error: Bad type provided to _alloc_raid_component.Component name for raid %s is too long.Failed to allocate new raid component, %s.Failed to add segment to LV, %s.Unable to allocate extents for mirror(s).Aborting. Unable to inherit tag.WARNING: Can't deactivate temporary volume %s.Mirror %s already has a %s log.Log type "mirrored" creation/conversion is not supported for regular operation!Log type "mirrored" is DEPRECATED. Use RAID1 LV or disk log instead.Unable to allocate extents for mirror log.Removing more than existing: %d <= %d.Persistent log is not supported on segment-by-segment mirroring.Segment is not mirrored: %s:%uSegment status does not match: %s:%u status:0x%lx/0x%lxInternal error: Unable to attach pool metadata LV to %s segtype.Internal error: Logical volume %s is not valid pool.Internal error: Unable to attach pool data LV to %s segtype.Internal error: No pool associated with %s LV, %s.Internal error: Cannot detach pool from LV %s.Internal error: Trying to delete %u again.Internal error: Unsupported message type %u.Failed to create historical LV representation for removed logical volume %s.Initialization of historical LV representation for removed logical volume %s failed.%s is referenced by more than one segment (%s, %s).Pool segment not found for %s.%s on %s is not a %s pool segmentInternal error: %s is not a pool logical volume.No usable device hint found while recalculating pool chunk size for %s.Calculated chunk size %s for pool %s is out of allowed range (%s-%s).Updating chunk size %s for pool %s to %s.Size %s of pool metadata volume %s is bigger then maximum usable size %s.Reducing pool metadata size %s to maximum usable size %s.Can't use volume %s with size %s as pool metadata. Minimal required size is %s.Extending pool metadata size %s to required minimal size %s.Internal error: LV %s is not pool metadata spare.Internal error: LV %s has no suffix for pool metadata spare.Failed to generate unique name for pool metadata spare logical volume.Renaming existing pool metadata spare logical volume "%s" to "%s/%s".Preparing pool metadata spare volume for Volume group %s.Unable to deactivate pool metadata spare LV. Manual intervention required.Can't create pool metadata spare. Name of pool LV %s is too long.Renaming %s as pool metadata spare volume %s.WARNING: recovery of pools without pool metadata spare LV is not automated.Dropping unused pool metadata spare LV %s.Adding new pool metadata spare %u extents.Extending pool metadata spare from %u to %u extents.Internal error: PV %s unexpectedly not in cache.No specified PVs have space available.Failed to create PV entry for missing device.Physical Volume "%s" not found in Volume Group "%s".Segment with extent %u in PV %s not foundMissing PV segment on %s at %u.Internal error: _merge_free_pv_seg called on a segment that is not free.Internal error: WARNING: PV %s is without initialized PE ranges.PV segment pe_count mismatch: %u != %uPV segment pe_alloc_count mismatch: %u != %uPV segment VG pv_count mismatch: %u != %uPV segment VG free_count mismatch: %u != %uPV segment VG extent_count mismatch: %u != %uAllowing allocation on %s start PE %u length %uCannot restripe LV %s from %u to %u stripes during conversion.Adjusting region_size from %s to %s for %s.Region size may not be smaller than stripe size on %s LV %s.Region size is too large for %s LV %s.Adjusting region size of %s LV from %s to %s.Internal error: Missing image sub lv in area %u of LV %s.Failed to prevent PVs holding image components from LV %s being used for allocation.Internal error: LVs must be set visible before removing.Internal error: Unable to remove RAID layer from segment type %s.Internal error: Unable to remove RAID layer when there is more than one sub-lv.Internal error: stripes may not be 0.Can't convert %s LV %s with number of stripes not divisible by number of data copies.Internal error: LV %s is missing stripes.Failed to find a valid mirror in stripe %u!Failed to new raid name for %s.New logical volume name "%s" is not valid.%sLogical Volume %s already exists in volume group %s.Can't remove reshape space from inactive LV %s.Can't get data offset for %s from kernel.Failed to allocate out-of-place reshape space for %s.Checking raid device count for LV %s/%sNo proper new segment length for %s!Failed to build list of PVs for %s.Internal error: Unable to allocate RAID metadata area for non-linear LV %s.Extracting image components %s and %s from %s.Can't change number of mirrors of degraded %s.Please run "lvconvert --repair %s" first.WARNING: %s already has image count of %d.Failed to extract images from %s.Integrity must be removed before converting raid to linear.Are you sure you want to convert %s LV %s to type %s losing all resilience? [y/n]: Logical volume %s NOT converted to "%s".Failed to remove RAID layer after linear conversion.Can't add image to out-of-sync RAID LV: use 'lvchange --resync' first.Can't add image to RAID LV that is still initializing.RAID module does not support rebuild+emptymeta.Unable to add RAID images to %s of segment type %s.Failed to clear REBUILD flag for %s components.Allocation of new meta areas failed.Allocation of new areas failed.%s is out-of-sync! Please try refreshing first.Minimum 3 stripes required for %s LV %s.Internal error: No change of image count on LV %s.Ignoring layout change on device removing reshape.WARNING: Removing stripes from active%s logical volume %s will shrink it from %s to %s!THIS MAY DESTROY (PARTS OF) YOUR DATA!Interrupt the conversion and run "lvresize -y -l%u %s" to keep the current size if not done already!If that leaves the logical volume larger than %llu extents due to stripe rounding,you may want to grow the content afterwards (filesystem etc.)WARNING: to remove freed stripes after the conversion has finished, you have to run "lvconvert --stripes %u %s"Can't remove stripes without --force option.Are you sure you want to remove %u images from %s LV %s? [y/n]: No correct kernel/lvm active LV count on %s.No correct kernel/lvm total LV count on %s.Failed to adjust LV %s to new size!Removing %u data and metadata image LV pair%s from %s.Internal error: Bad return provided to %s.WARNING: ignoring --stripesize on conversion of %s to 1 stripe.%s cannot be merged because --trackchanges was not used.Unable to merge non-raid image %s.Unable to find containing RAID array for %s.Failed to find meta for %s in RAID array %s.Failed to deactivate %s before merging.%s successfully merged back into %s.Allocating metadata LVs for %s.Allocating new metadata LV for %s.Failed to allocate metadata LV for %s.Failed to allocate metadata LVs for %s.Clearing newly allocated metadata LVs for %s.Failed to initialize metadata LVs for %s.Adding newly allocated metadata LVs to %s.Failed to add newly allocated metadata LVs to %s.Internal error: Unrecognised segment type flag 0x%016lxInternal error: No segment for %s.Failed to retrieve raid0 segments from %s._raid_reshape_remove_imagesconsume_pv_areaLogical volume %s is already of requested type %s.An entire mirror group has failed in %s.All components of raid LV %s have failed.More than %u components from %s %s have failed.%s contains a segment incapable of degraded activation.Logical volume %s already is type %s.Converting the segment type for %s from %s to %s is not supported.Converting the segment type for %s from %s to %s is not supported yet.Extracting all MetaLVs of %s to activate as raid0.Deactivating pulled out MetaLVs of %s before initializing.Clearing allocated raid0_meta metadata LVs for conversion to raid4.Failed to initialize metadata LVs.Adding metadata LVs back into %s.%s is not a RaidLV with metadata.Can't clear transiently failed devices on still failed %s.Internal error: Missing metadata areas on %s!Can't %s failed devices with active %s metadata volume %s.Skipping activation of failed devices for degraded %s metadata volume %s.Failed to activate %s metadata volume %s.Skipping clear of failed devices for degraded %s metadata volume %s.Failed to build device path for %s.Failed to %s failed device(s) in superblock of %s metadata volume %s.%s %u failed device(s) in superblock of %s metadata volume %s.The %s volume %s is %s with %u transiently failed device(s).Volume has been restored after clearing %u superblocks(s). Once online please check its content.Cannot determine sync percentage of %s.Unable to determine sync status of %s.WARNING: Sync status for %s is inconsistent.Unable to convert %s while it is not in-sync.Clearing newly allocated metadata LVs.Failed to allocate metadata LV for %s in %s.Failed to allocate meta areas memory.Internal error: Cannot change region size of %s.Region size is already %s on %s LV %s.Region size is already matching %s on %s LV %s due to adjustment.Do you really want to change the region_size %s of LV %s to %s? [y/n]: Region size %s on %s is too small for metadata LV size.Unable to change region size on %s LV %s while it is not in-sync.Converting %s LV %s to regionsize %s.Changed region size on %s LV %s to %s.%s must be active to perform this operation.Internal error: New segtype not specified.Unable to handle raid arrays with more than %u devices.Checking LV %s requested %s segment type for convenienceConvert %s LV %s to 2 images first.WARNING: Converting %s LV %s to %u stripes first.Converting %s LV %s to %u stripes first.Convert %s LV %s to raid4/raid5 first.Convert %s LV %s to 2 stripes first (i.e. --stripes 1).Replaced LV type %s%s with possible type %s.Repeat this command to convert to %s after an interim conversion has finished.Unable to convert LV %s from %s to %s.WARNING: ignoring --stripes option on takeover of %s (reshape afterwards).WARNING: ignoring --stripesize option on takeover of %s (reshape afterwards).Are you sure you want to convert %s LV %s%s%s%s? [y/n]: Can't convert RAID LV %s while under snapshot.RAID module does not support reshape.Region size may not be smaller than stripe size on LV %s.Can't remove stripes from raid10.Unable to convert stacked volume %s.Unable to convert %s containing sub LVs to remove after a reshape.Run "lvconvert --stripes %u %s" first.Internal error: Failed to free reshape space of %s.No change in RAID LV %s layout, freeing reshape space.LV %s does not have reshape space allocated.Can't reshape out of sync LV %s.Device count is incorrect. Forgotten "lvconvert --stripes %d %s" to remove %u images after reshape?Internal error: Bad return=%d provided to %s.Converting stripesize %s of %s LV %s to %s.Ignoring layout change on device adding reshape.Can't reshape %s LV %s to odd number of stripes.WARNING: Adding stripes to active%s logical volume %s will grow it from %u to %u extents!Run "lvresize -l%u %s" to shrink it or use the additional capacity.Are you sure you want to add %u images to %s LV %s? [y/n]: Adding %u data and metadata image LV pair%s to %s.Allocating reshape space for %s.(Re)allocating reshape space for %s.Setting delta disk flag on new data LVs of %s.Converting %s%s LV %s to %s%s.Are you sure you want to convert %s LV %s? [y/n]: %sllocating reshape space for %s.Reshape request failed on LV %s.Invalid conversion request on %s.Can't convert %s LV %s to %s containing sub LVs to remove after a reshape.WARNING: Converting %s LV %s to 2 stripes first.Failed to allocate memory for unknown segtypeWARNING: Unrecognised segment type %sCannot convert striped LV %s with non-power of 2 stripe size %u.Failed to allocate empty image components for raid0 LV %s.Failed to insert linear LVs underneath %s.Internal error: Invalid data lvs for raid0 LV %s.Failed to allocate new raid0 segment for LV %s.Cannot convert striped LV %s with varying stripe count to raid0.Are you sure you want to convert %s back to the older %s type? [y/n]: Internal error: raid1 conversion supported only.can't convert %s to fewer than 2 data_copies.Unable to handle mirrors with more than %u devices.Unable to convert %s LV %s with %u images to %s.At least reduce to the maximum of %u images with "lvconvert -m%u %s".Changing image count to %u on %s.Extracting and renaming metadata LVs.Internal error: Name %s lags image part.Snapshot volume cannot be smaller than 3 chunks (%u extents, %s).an origin that has a merging snapshotWARNING: Snapshots of mirrors can deadlock under rare device failures.WARNING: Consider using the raid1 mirror type to avoid this.WARNING: See global/mirror_segtype_default in lvm.conf.Snapshots of %s are not supported.Failed to deactivate logical volume "%s"Failed to remove internal snapshot LV %sPostponing write and commit for remove of snapshot %s.Failed to refresh %s without snapshot.Internal error: LV %s already has external origin.Setting logical volume "%s" read-only.Internal error: Inconsistent external origin.Internal error: LV %s is not a thin pool.Internal error: Cannot attach message to non-pool LV %s.Message referring LV %s already queued in pool %s.Delete for device %u already queued in pool %s.Failed to allocate memory for message.Internal error: thin_pool_is_active called with non thin pool volume %s.Pool's thin volume %s is active.Internal error: LV %s is not thin pool.WARNING: Thin pool %s%s%s%s%s%s.Threshold configured for free data space in thin pool %s has been reached (%s%% >= %s%%).WARNING: Remaining free space in metadata of thin pool %s is too low (%s%% >= %s%%). Resize is recommended.Threshold configured for free metadata space in thin pool %s has been reached (%s%% > %s%%).WARNING: Thin pool %s has unexpected transaction id %lu, expecting %lu%s. and the size of whole volume group and the amount of free space in volume groupWARNING: Sum of all thin volume sizes (%s) exceeds the size of thin pool%s%s%s (%s).WARNING: You have not turned on protection against thin pools running out of space.WARNING: Set activation/thin_pool_autoextend_threshold below 100 to trigger automatic extension of thin pools before they get full.WARNING: Set activation/thin_pool_autoextend_percent above 0 to specify by how much to extend thin pools reaching the threshold.Can't use "%s" as external origin with "%s" pool. Size %s is not a multiple of pool's chunk size %s.Internal error: Cannot find configuration.Thin pool chunk size calculation policy "%s" is unrecognised.Using metadata size without cropping.Thin pool discards type "%s" is unknown.Thin pool chunk size %s is not in the range %s to %s.Thin pool chunk size %s must be a multiple of %s.Chunk size must be a power of 2 for this thin target version.Internal error: Could not find configuration.WARNING: Chunk size is too small for pool, suggested minimum is %s.WARNING: Chunk size is smaller then suggested minimum size %s.Selected chunk size %s cannot address more than %s of thin pool data space.Thin pool volume with chunk size %s can address at most %s of data.Size of %s data volume cannot be smaller than chunk size %s.WARNING: Pool zeroing and %s large chunk size slows down thin provisioning.WARNING: Consider disabling zeroing (-Zn) or using smaller chunk size (<%s).Preferred pool metadata size %s.Cannot use %s volume %s as external origin.Cannot use active LV for the external origin., perhaps skipped in lvm.conf volume_list?Cannot activate thin pool %s%sPool %s needs to be locally active for threshold check.Free space in pool %s is above threshold, new volumes are not allowed.Failed to suspend %s with queued messages.Internal error: Unrecognized index state: %u.Failed to build VDO DM name %s.Cannot parse %s VDO pool status %s.statistics/logical_blocks_usedclearfully operationalstill failedClearedCountedRemoving mirror log %s.Failed to remove mirror log.Setting new segtype for %s.Renaming %s to %s.Rea--stripes-I/--stripesize-R/--regionsizeLV %s already has %u stripes.Too few stripes requested.Converting %s from %s to %s.Failed to allocate name.Adjust data LVs of %s._mimage_Data LV renamed to %s.raid with integritylocked volumespvmoved volumeshidden volumescache type volumesthin pool type volumesmirror subvolumesraid subvolumesFailed to resume %s.Added %s message. has read-only metadata is erroring needs check is out of data space is failed or lower by 1no free space in volume groupperformanceCropping metadata size to %s.nopassdownSetting chunk size to %s.Setting chunk size %s.Enabling%s pool zeroing on default.internalwritableclosedopeningclosingstatistics/data_blocks_used 0P`@     _raid_reshape@CNew size %lu for %s%s not an exact number of new extents.New extent count %lu for %s%s exceeds 32 bits.Couldn't read 'device_count' or 'stripe_count' for segment '%s'.Only one of 'device_count' and 'stripe_count' allowed for segment '%s'.alloc_time_item: dm_pool_zalloc failedCouldn't read 'mirror_count' for segment '%s'.Couldn't read 'extents_moved' for segment %s of logical volume %s.Couldn't read 'region_size' for segment %s of logical volume %s.Unrecognised mirror log in segment %s of logical volume %s.Missing region size for mirror log for segment %s of logical volume %s.Couldn't find mirrors array for segment %s of logical volume %s.struct mirr_state allocation failedMirrored transient status: "%s"Active mirror has a wrong number of mirror images!Metadata says %u, kernel says %u.Check for existence of mirror log %s failed.Mirror log mismatch. Metadata says %d:%d, kernel says %u:%u.Check for existence of mirror image %s failed.Failed to find image %d (%d:%d).Couldn't read '%s' for segment %s of logical volume %s.Couldn't find RAID array for segment %s of logical volume %s.Bad volume name in areas array for segment %s.Couldn't find volume '%s' for segment '%s'.Missing data device in areas array for segment %s.Incorrect number of areas in area array for segment '%s'.Failed to import RAID component pairs.Target raid does not support %s.RAID target does not support RAID4 for LV %s.Internal error: _raid_add_target_line called with no areas for %s.Unable to handle more than %u devices in a single RAID arrayMissing region size for raid segment in %s.Internal error: Invalid request for delta disks minus and delta disks plus!mirror string list allocation failedraid module string list allocation failedWARNING: Failed to reserve memory, %d bytes missing.Allocation of maps buffer failed.%s area unreadable %s : Skipping.%s ignore filter '%s' matches '%s': Skipping.%s default filter '%s' matches '%s': Skipping.%s_filter '%s' matches '%s': Skipping.%s %10ldKiB %12lx - %12lx %c%c%c%c%sActive raid has a wrong number of raid images!Check for existence of raid meta %s failed.Check for existence of raid image %s failed.Failed to create cache for values used during reporting._get_now: failed to cache current time_preparse_fuzzy_time: dm_pool_alloc failedUnrecognized string in date/time specification at "%s".Unrecognized number in date/time specification at "%s".Mixed absolute and relative date specification found at "%s".Ambiguous date specification found at "%s".Mixed absolute and relative time specification found at "%s".Ambiguous time specification found at "%s"._translate_time_items: invalid time._translate_time_items: dm_snprintf failed_translate_time_items: dm_pool_strdup failed_get_now: dm_pool_zalloc failedFailed to get value for parsed time specification.Failed to allocate space to store time range.Deprecated VDO setting write_policy specified.Deprecated VDO setting use_metadata_hints specified.Sysinfo free:%llu bufferram:%llu sharedram:%llu freehigh:%llu unit:%u.Failing to parse value from %s. %s RAM for physical volume size %s%s %s RAM for virtual volume size %s%s %s RAM for block map cache size %s%sNot enough free memory for VDO target. %s RAM is required, but only %s RAM is available.VDO requires %s RAM, currently available %s RAM.Failed to allocate volume group structureInternal error: global memory pool used for VG %sPhysical Extent size must be a multiple of %s when not a power of 2.Metadata format only supports Physical Extent sizes that are powers of 2.Extent size must be between %s and %sExtent size must be multiple of %sVolume group "%s" must be resizeable to change PE sizeNew extent size is not a perfect fitUnassigned area %u found in segmentVolume group "%s" must be resizeable to change MaxLogicalVolumeMaxLogicalVolume is less than the current number %d of LVs for %sVolume group "%s" must be resizeable to change MaxPhysicalVolumesMaxPhysicalVolume limit is 255MaxPhysicalVolumes is less than the current number %d of PVs for "%s"Internal error: Unable to find configuration for %s options.Too many options for %s command.Invalid string in config file: global/%s_options.Failed to build device path for VDO formatting of data volume %s.Slab size %s converted to %u bits.Internal error: Failed to wipe logical VDO data for volume %s.WARNING: Cannot read output from %s.Logical blocks defaulted to %lu blocksAvailable VDO logical blocks %lu (%s).Number of VDO logical blocks was not provided by vdo_format output.Using bigger VDO virtual size unaligned on extent size by %s.Rounding size up to 4,00 KiB VDO logical extent boundary: %s.Test mode: Skipping formatting of VDO pool volume.Cannot format VDO pool volume %s.Cannot deactivate formatted VDO pool volume %s.Cannot create fully fitting VDO volume, --virtualsize has to be specified.Size %s for VDO volume cannot be smaller then extent size %s.Can't prepare vdo pool name for %s.Can't generate new name for %s.Aborting. Failed to wipe VDO data store %s.Names including "%s" are reserved. Please choose a different LV name.Names starting "%s" are reserved. Please choose a different LV name.Missing region size for mirror segment.Failed to build uuid for log LV %s.Failed to build uuid for mirror LV %s.WARNING: Mirror %s without monitoring will not react on failures.Couldn't find mirror log uuid %s.Internal error: Name is too long.Failed to create udev library context.Lock: Memlock counters: prioritized:%d locked:%d critical:%d daemon:%d suspended:%dSkipping memory locking (reserved memory: %zu stack: %zu).Skipping %slocking of memory maps (running in VALGRIND).Raised task priority %d -> %d.WARNING: setpriority %d failed: %s.Entering critical section (%s).Entering prioritized section (%s).Restoring original task priority %d.WARNING: setpriority %u failed: %s.Unlock: Memlock counters: prioritized:%d locked:%d critical:%d daemon:%d suspended:%dSkipping memory unlocking (reserved memory: %zu stack: %zu).Internal error: Reserved memory (%ld) not enough: used %ld. Increase activation/reserved_memory?Suppressed internal error: Maps lock %ld < unlock %ld, a one-page difference.Internal error: Missing command.wait4 child process %u failed: %sUnexpected errno: %d on lockfile open, returning runningUnexpected errno: %d on lockf, returning runningdbus daemon not running, not notifyingorg.freedesktop.systemd1.NoSuchUnitorg.freedesktop.DBus.Error.ServiceUnknownFailed to parse dbus response message: %dBad return value from dbus service: %ddevice_countstripe_countreport/report.c Mirrors %umirror/mirrored.c Mirror size %u Mirror log volume %s Mirror region size %s Mirror original: Mirror destinations: Raid Data LV%2d Raid Metadata LV%2d %smirror_countextents_movedmirror_count = %uextents_moved = %umirror_log = "%s"region_size = %uFound mirror log at %d:%dStatus of log (%d:%d): %c.Found mirror image at %d:%dStatus of image %d: %c.raid0_lvsstripe_sizemin_recovery_ratemax_recovery_rateNo areas found for segment %s_rmeta_raid4Unsupported raid type %s.locale/locale-archiveUnlmunlockalllseekmunlock%lx-%lx %c%c%c%c%nFailed to parse maps line: %s%socked %ld bytesraid0_lvstripe_count = %ustripe_size = %udevice_count = %uwritebehind = %umin_recovery_rate = %umax_recovery_rate = %udata_offset = %uRaid transient status %s.time_nowdevice_mapper/libdm-report.c@%ld:@%ldasyncasync-unsafeUnknown VDO write policy %s.AnonPagesMemAvailableMemFreeMemTotalShmemSwapFree%s/meminfoParsed %s = %lu KiB. %s RAM for index memoryVDO configuration needs%s.Allocated VG %s at %p.Failed to allocate VG name.Freeing VG %s at %p. free space allocated space PV segment start PV segment length area length extents moved virtual extents pvseg start pvseg length area startMaxLogicalVolume limit is 255STDINmisc/lvm-exec.cwaitpid--logical-size=%luK--slab-bits=%u--uds-memory-size=%u--uds-memory-size=0.%2u--uds-sparseCommand %s failed.Skipping VDO formatting %s._vdata%s_vpool%%dsync_dir failed in strdup%s: write error_undo_flock %sUnlocking %sflock_drop_shared_flock %s.SIG_SETMASKsigprocmasksigaction_block_signals_do_flock %s %c%cGiving up waiting for lock.pvmovelog uuid pool_strdup failedmisc/lvm-wrappers.cCould not get udev state.Assuming udev is not running.read_urandom: /dev/urandomLocking memory%s/self/mapsproc_dir too longgetprioritysuspendingUnlocking memoryExecuting:%sforkexecvpChild %u exited abnormally%s failed: %u/var/lock/lvm/lvmdbusdLVM_DBUSD_LOCKFILEnotify/lvmnotify.cFailed to connect to dbus: %dcom.redhat.lvmdbus1Notify dbus at %s.ExternalEventcom.redhat.lvmdbus1.Manager/com/redhat/lvmdbus1/ManagerWARNING: %s: %s/LC_MESSAGES/gconv/gconv-modules.cache/ld-2./libattr.so./libblkid.so./libbz2.so./libcap.so./libdl-/libdw-/libedit.so./libelf-/libgcrypt.so./libgpg-error.so./liblz4.so./liblzma.so./libmount.so./libncurses.so./libpcre.so./libpcre2-/libreadline.so./libresolv-/libselinux.so./libsepol.so./libsystemd.so./libtinfo.so./libudev.so./libuuid.so./libz.so./libzstd.so./libjson-c.so./libkeyutils.so./libcrypto.so./libnvme.so./etc/selinuxHf]n*9tQ'*  ''''''''' !!" !##$ #%#&#' '( () )* *+,/)0)1)2)3)4)5)6)7)8)9):)cachecrypterrorlinearmirrorsnapshotsnapshot-originsnapshot-mergestriped zero writecache integrity thin-pool thinvdoraid0raid0_metaraid1raid10raid4raid5_nraid5_laraid5_raraid5_lsraid5_rsraid6_n_6raid6_zrraid6_nrraid6_ncraid6_ls_6raid6_rs_6raid6_la_6 raid6_ra_6raid5raid6raid10_nearD-Bus notification failed[vdso][vsyscall][vectors]pvmovesnapshot_cdata_cmeta_corig_cpool_cvol_wcorig_mimage_mlog_rimage_rmeta_tdata_tmeta_vdata_imeta_iorig_pmspare_vorigin0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z- and,,shrinkingrebuild+emptymetreshapingqueueallocatableextendableinitial image syncconvertingallocation lockedfixed minormerge failedsnapshot invalidlive table presentinactive table presentwriteableread-only-overrideFailed to get segtype name.mergingimage syncedactive locallylvname snprintf faileddm_pool_strdup failedsharedunmanagedFailed to allocate buffer.active exclusivelyInternal error: Using string as sort value for numerical field.dm_report_field_string: dm_pool_strdup failedInternal error: Unknown discards type encountered.Kernel reports unknown discards status %u.lvseg_kernel_discards_dup_with_info_and_seg_status: dm_pool_strdup failed.Failed to allocate buffer for host.Failed to create list of writecache settings.Failed to create list of integrity settings.modules str_list allocation failedNo lv_raid found for lv_image %s lv_iorig %sNo raid seg found for lv_raid %s lv_image %s lv_iorig %sNo raid health for seg area %u lv_raid %s lv_image %s lv_iorig %sraid health %c for seg area %u lv_raid %s lv_image %s lv_iorig %sNo seg area found for lv_raid %s lv_image %s lv_iorig %sNo lv_image found for lv_iorig %sFailed to allocate buffer for mode.Failed to allocate buffer for time.Failed to display layout for LV %s/%s.Failed to display role for LV %s/%s.unknown01check neededskip activationhistoricalsnapshot-mergerefresh neededmismatches existwritemostlyout_of_data Device ID %usnapshot/snapshot.cmerging_storecow_storestriped/striped.ccow_store = "%s"merging_store = "%s"thin_pool = "%s"transaction_id = %ludevice_id = %dexternal_origin = "%s"merge = "%s"snapshot-originzero/zero.c Stripes %u Stripe size %s Stripe size %u KB Stripe %d: Discards %s Thin count %u Transaction ID %lu Zero new blocks %sdiscards = "%s"zero_new_blocks = 1crop_metadata = %umessage%d {create = "%s"delete = %d# linearstripeexternal_originMissing metadata uuid %s.Ignoring %lu of device.Missing pool uuid %s.Thin pool delete %u.Thin pool create_%s %s.Missing thin pool uuid %s.abbrev_dup_hexnew UUIDLV percent: %sdataBlocksUsedlogicalBlocksUsedstatsVDO property %s = %lu%llu %llu %llu %lludevice_mapper/libdm-targets.c%llu %llu %15sCached as inactive %s.dev_manager%sblock/dm-%u/holdersCached as not present %s.undefinedqueue when fullqueue if no spaceerror when fullerror if no spacero-overrider-overrideread-writeinactive tableinactivelive tableliveactive remotelyfixedundefUnique identifier.LV layout.LV role.Set if LV is being converted.LV allocation policy.Active state of the LV.Size of LV in current units.Number of segments in LV.The integrity modeThe integrity block sizeTags, if any.Set if the LV is historical.The writecache block sizeLV permissions.Set if LV is suspended.Set if LV device is open.Total cache blocks.Used cache blocks.Dirty cache blocks.Cache read hits.Cache read misses.Cache write hits.Cache write misses.Cache policy used in kernel.LV health status.Set if snapshot merge failed.Total writecache blocks.Total writecache free blocks.Total writecache errors.Type of metadata.Name.Device major number.Device minor number.PV header extension version.Size of PV in current units.Set if PV is used.Device ID such as the WWID.VG permissions.Set if VG is extendable.Set if VG is exported.Set if VG is partial.VG allocation policy.Set if VG is clustered.Set if VG is shared.Number of PVs in VG.Number of LVs.Number of snapshots.Type of LV segment.Number of data copies.Integrity settings.Sparse indexing (vdopool).IO enqueue (vdopool).Number of extents in segment.Description of Device Type.Log sequence number.Log type.Current context.Current object type.Current object name.Current object ID.Current object group.Current object group ID.Log message.Errno.Return code.vg_Logical Volumelv_Logical Volume Device InfoLogical Volume Device StatusPhysical Volumepv_Physical Volume LabelLogical Volume SegmentPhysical Volume Segmentpvseg_Device Typesdevtype_Command LogInternal error: Unrecognized VDO write policy: %u.Couldn't read chunk size for snapshot.Merging store must be a string in segment %s of logical volume %s.Both snapshot cow and merging storage were specified in segment %s of logical volume %s.Cow store must be a string in segment %s of logical volume %s.Snapshot cow storage not specified in segment %s of logical volume %s.Snapshot origin not specified in segment %s of logical volume %s.Snapshot origin must be a string in segment %s of logical volume %s.Unknown logical volume %s specified for snapshot cow store in segment %s of logical volume %s.Unknown logical volume %s specified for snapshot origin in segment %s of logical volume %s.Couldn't read 'stripe_count' for segment '%s'.Target snapshot may leak metadata.snapshot string list allocation failedString list allocation failed for thin_pool.String list allocation failed for thin.zero module string list allocation failedCouldn't read stripe_size for segment %s of logical volume %s.Couldn't find stripes array for segment %s of logical volume %s.Internal error: Invalid discards value %d.Internal error: Invalid zero new blocks value %d.Internal error: LV %s is not a thin volume.Internal error: Passed unsupported message.Metadata must be a string in segment %s of logical volume %s.Unknown metadata %s in segment %s of logical volume %s.Pool must be a string in segment %s of logical volume %s.Unknown pool %s in segment %s of logical volume %s.Could not read transaction_id for segment %s of logical volume %s.Could not read chunk_size segment %s of logical volume %s.Could not read discards for segment %s of logical volume %s.Discards option unsupported for segment %s of logical volume %s.Unsupported value %u for chunk_size segment %s of logical volume %s.Could not read zero_new_blocks for segment %s of logical volume %s.Could not read crop_metadata for segment %s of logical volume %s.Unknown LV %s for create message in segment %s of logical volume %s.Unknown message in segment %s of logical volume %s.Thin pool must be a string in segment %s of logical volume %s.Unknown thin pool %s in segment %s of logical volume %s.Origin must be a string in segment %s of logical volume %s.Unknown origin %s in segment %s of logical volume %s.Merge lv must be a string in segment %s of logical volume %s.Unknown merge lv %s in segment %s of logical volume %s.Could not read device_id for segment %s of logical volume %s.Unsupported value %u for device_id segment %s of logical volume %s.External origin must be a string in segment %s of logical volume %s.Unknown external origin %s in segment %s of logical volume %s.WARNING: Ignoring invalid string in config file %s.Internal error: Thin pool is missing metadata device.Thin pool target does not support %s chunk size (needs kernel >= 3.6).Failed to build uuid for metadata LV %s.Failed to build uuid for pool LV %s.WARNING: Thin pool target does not support discards (needs kernel >= 3.4).WARNING: Thin pool target does not support error if no space (needs version >= 1.10).Internal error: Unsupported message.Thin pool set transaction id %lu.Internal error: Segment %s has no pool.Internal error: Failed to add merged segment of %s.Device id %u is higher then %u.Thin target does not support smaller size of external origin LV %s.Failed to build uuid for external origin LV %s.Missing thin external origin uuid %s.Delaying resume for new external origin %s.Skipping checks for old devices without LVM- dm uuid prefix (kernel vsn %d >= %d).dm_report_set_output_field_name_prefix: dm_pool_strdup failedFailed to mangle new device UUID "%s"New device uuid mangled [%s]: %s --> %sdm_task_set_newuuid: strdup(%s) failedWARNING: Failed to query uuid with LIST.Number of segments in active LV %s does not match metadata.Checking VDO pool stats message for LV %s.Internal error: Corrupted message structure returned: start %d > end %dInternal error: Message response doesn't contain terminating NUL characterCannot parse %s in VDO DM stats message.Get read ahead request failed: device name unrecorded.WARNING: Cannot find matching %s segment for %s.WARNING: Detected %s segment type does not match expected type %s for %s.Failed to parse writecache params: %s.Failed to parse integrity params: %s.Getting device info for %s [%s].WARNING: Using linear target for %s/%s: Striped requires extent size (%u sectors) >= page size (%u).Internal error: striped add_target_line called with no areas for %s.Kernel driver has incomplete udev support so LVM will check and perform some operations itself.sysfs_path dm_snprintf failed.Failed to parse dm device minor number from %s.Checking holder of %s %s (%u:%u) %s.Cannot find holder with device name %s in VG %s.Cached as present %s %s (%d:%d).Volume %s (%u:%u) differs from already active device (%u:%u).The requested major:minor pair (%u:%u) is already used.Failed to add device (%u:%u) to dtree.Tracking pending delete for %s%s%s (%s).Reserved value for undefined numeric value.Name. LVs created for internal use are enclosed in brackets.Full name of LV including its VG, namely VG/LV.Full pathname for LV. Blank for internal LVs.Internal device-mapper pathname for LV (in /dev/mapper directory).For LVs that are components of another LV, the parent LV.Set if mirror/RAID images underwent initial resynchronization.Set if mirror/RAID image is synchronized.Set if snapshot LV is being merged to origin.Set if LV is locked against allocation changes.Set if LV has fixed minor number assigned.Set if LV is skipped on activation.Set if LV autoactivation is enabled.For thin pools, behavior when full.Set if the LV is active locally.Set if the LV is active remotely.Set if the LV is active exclusively.Persistent major number or -1 if not persistent.Persistent minor number or -1 if not persistent.Read ahead setting in current units.For thin and cache pools, the size of the LV that holds the metadata.For snapshots and thins, the origin device of this LV.For snapshots and thins, the UUID of origin device of this LV.For snapshots, the size of the origin device of this LV.LV ancestors ignoring any stored history of the ancestry chain.LV ancestors including stored history of the ancestry chain.LV descendants ignoring any stored history of the ancestry chain.LV descendants including stored history of the ancestry chain.For RAID, number of mismatches found or repaired.For RAID, the current synchronization action being performed.For RAID1, the number of outstanding writes allowed to writemostly devices.For RAID1, the minimum recovery I/O load in kiB/sec/disk.For RAID1, the maximum recovery I/O load in kiB/sec/disk.The number of integrity mismatches.For pvmove, Source PV of temporary LV created by pvmove.For pvmove, the UUID of Source PV of temporary LV created by pvmove.For lvconvert, Name of temporary LV created by lvconvert.For lvconvert, UUID of temporary LV created by lvconvert.For mirrors, the LV holding the synchronization log.For mirrors, the UUID of the LV holding the synchronization log.For cache/thin/vdo pools, the LV holding the associated data.For cache/thin/vdo pools, the UUID of the LV holding the associated data.For cache/thin pools, the LV holding the associated metadata.For cache/thin pools, the UUID of the LV holding the associated metadata.For cache/thin/vdo volumes, the cache/thin/vdo pool LV for this volume.For cache/thin/vdo volumes, the UUID of the cache/thin/vdo pool LV for this volume.Configuration profile attached to this LV.Lock args of the LV used by lvmlockd.Creation time of the LV, if knownRemoval time of the LV, if knownCreation host of the LV, if known.Kernel device-mapper modules required for this LV.Currently assigned major number or -1 if LV is not active.Currently assigned minor number or -1 if LV is not active.Currently-in-use read ahead setting in current units.Set if LV has live table present.Set if LV has inactive table present.For snapshot, cache and thin pools and volumes, the percentage full if LV is active.For snapshots, the percentage full if LV is active.For cache and thin pools, the percentage of metadata full if LV is active.For Cache, RAID, mirrors and pvmove, current percentage in-sync.Cache settings/parameters as set in kernel, including default values (cached segments only).Cache metadata format used in kernel.For thin pools, how discards are handled in kernel.For thin pools and cache volumes, whether metadata check is needed.Set if snapshot LV is invalid.For vdo pools, its current operating mode.For vdo pools, whether compression is running.For vdo pools, state of index for deduplication.For vdo pools, currently used space.For vdo pools, percentage of saved space.Total writecache writeback blocks.Various attributes - see man page.Size of underlying device in current units.Free metadata area space on this device in current units.Size of smallest metadata area on this device in current units.Offset to the start of data on the underlying device.Total amount of unallocated space in current units.Total amount of allocated space in current units.Set if this device can be used for allocation.Set if this device is exported.Set if this device is missing in system.Total number of Physical Extents.Total number of allocated Physical Extents.Number of metadata areas on this device.Number of metadata areas in use on this device.Offset to the start of PV Bootloader Area on the underlying device in current units.Size of PV Bootloader Area in current units.Set if PV is an unchosen duplicate.Type of device ID such as WWID.Set if VG autoactivation is enabled.Total size of VG in current units.Total amount of free space in current units.System ID of the VG indicating which host owns it.Lock type of the VG used by lvmlockd.Lock args of the VG used by lvmlockd.Size of Physical Extents in current units.Total number of unallocated Physical Extents.Maximum number of LVs allowed in VG or 0 if unlimited.Maximum number of PVs allowed in VG or 0 if unlimited.Number of PVs in VG which are missing.Revision number of internal metadata. Incremented whenever it changes.Configuration profile attached to this VG.Number of metadata areas on this VG.Number of metadata areas in use on this VG.Free metadata area space for this VG in current units.Size of smallest metadata area for this VG in current units.Target number of in use metadata areas in the VG.Number of stripes or mirror/raid1 legs.Number of data stripes or mirror/raid1 legs.Size of out-of-place reshape space in current units.Size of out-of-place reshape space in logical extents.Data offset on each image device.New data offset after any reshape on each image device.Number of (rotating) parity chunks.For stripes, amount of data placed on one device before switching to the next.For mirrors/raids, the unit of data per leg when synchronizing devices.For snapshots, the unit of data used when tracking changes.For thin pools, the number of thin volumes in this pool.For thin pools, how discards are handled.For cache, metadata format in use.For cache, how writes are cached.For thin pools and volumes, if zeroing is enabled.For thin pools, the transaction id and creation transaction id for thins.For thin volume, the thin device id.Offset within the LV to the start of the segment in current units.Offset within the LV to the start of the segment in physical extents.Size of segment in current units.Size of segment in physical extents.Ranges of Physical Extents of underlying devices in command line format (deprecated, use seg_le_ranges for common format).Ranges of Logical Extents of underlying devices in command line format.Ranges of Logical Extents of underlying metadata devices in command line format.Underlying devices used with starting extent numbers.Underlying metadata devices used with starting extent numbers.Dmeventd monitoring status of the segment.The cache policy (cached segments only).Cache settings/parameters (cached segments only).Set for compressed LV (vdopool).Set for deduplicated LV (vdopool).Minimum acceptable IO size (vdopool).Allocated caching size (vdopool).Speed of cache writes (vdopool).Allocated indexing memory (vdopool).Increment size for growing (vdopool).Acknowledging threads (vdopool).IO submitting threads (vdopool).CPU threads for compression and hashing (vdopool).Threads for subdivide parts (vdopool).Logical threads for subdivide parts (vdopool).Physical threads for subdivide parts (vdopool).Maximum discard size volume can receive (vdopool).Header size at front of vdopool.Deprecated use of REQ_SYNC for writes (vdopool).Deprecated write policy (vdopool).Physical Extent number of start of segment.Name of Device Type exactly as it appears in /proc/devices.Maximum number of partitions. (How many device minor numbers get reserved for each device.)Logical Volume Device Info and Status Combinednoyesglobal/thin_disabled_featuresdiscardsexternal_originblock_sizediscards_non_power_2 metadata_resize error_if_no_space @external_origin_extendthinthin-poolInternal error: _emit_target cannot handle segment type %s.Failed to build device path for checking cachevol metadata %s.Failed to build device path for checking pool metadata %s.Metadata checking skipped, detected empty disk header on %s.WARNING: Check is skipped, please install recommended missing binary %s!Found version of %s %s is %s then requested %u.%u.%u.WARNING: Cannot parse output '%s' from %s.WARNING: Check is skipped, please upgrade installed version of %s!Check of pool %s failed (status:%d). Manual repair required!WARNING: Integrity check of metadata for pool %s failed.Skipping %s callback registration for command %s.Internal error: Registering unsupported pool callback.Failed to allocated path for callback.Tracking pending delete for %s-%s (%s).Using error for pending delete of %s-%s.Couldn't determine link pathname.The link %s should have been removed by udev but it is still present. Falling back to direct link removal.%s not symbolic link - not removingCouldn't create path for volume group dir %sCouldn't create source pathname for logical volume link %sCouldn't create destination pathname for logical volume link for %sCouldn't create pathname for LVM1 group file for %sNon-LVM1 character device found at %sSymbolic link %s not created: file existsSymlink %s that should have been created by udev does not have correct target. Falling back to direct link creationSymlink %s that should have been created by udev could not be checked for its correctness. Falling back to direct link creation.The link %s should have been created by udev but it was not found. Falling back to direct link creation.Couldn't construct name of volume group directory.Interval string conversion got truncated.Failed to process request with error %s (errno: %d).%s not found in config: defaulting to "%s"Aborting. LV %s is incomplete and --activationmode partial was not specified.Internal error: Unassigned area found in LV %s.Cannot activate %s: pool incomplete.Internal error: _add_error_or_zero_device called with bad segment._add_new_lv_to_dtree: pool alloc failed for %s %s.%soaded thin volume %s with id %u is %smatching id %u.Merging of snapshot volume %s to origin %s is in progress.Postponing pending snapshot merge for origin %s, merge was not started before suspend.Postponing pending snapshot merge for origin %s, origin volume is opened.Postponing pending snapshot merge for origin volume %s, merging thin snapshot volume %s is active.Postponing pending snapshot merge for origin volume %s, merging snapshot volume %s is opened.Internal error: LV %s is not merging snapshot.Couldn't find snapshot origin uuid %s.Couldn't find snapshot for '%s'.Checking kernel supports %s segment type for %s%s%sCan't process LV %s: %s target support missing from kernel?Skipping users for already added external origin LV %s.Adding external origin LV %s and all active users.Finished adding external origin LV %s and all active users.Using error for pending delete %s.Failed to create partial dtree.Failed to add device %s (%u:%u) to dtree.%s: Reserved uuid %s on internal LV device %s not usable.%s: Reserved internal LV device %s/%s%s%s not usable.%s: Reserved uuid %s on %s device %s not usable.No space to stack fs operationInternal error: Cannot create tree for %s.Partial dtree creation failed for %s._clean_tree: Couldn't split up device name %s.Failed to remove all device symlinks associated with %s._create_lv_symlinks: Couldn't split up old device name %s._create_lv_symlinks: Couldn't split up new device name %s.Failed to create symlinks for %s._clean_tree: Failed to duplicate uuid.Successfully connected to lvmpolld on fd %d.WARNING: Failed to connect to lvmpolld. Proceeding with polling without using lvmpolld.WARNING: Check global/use_lvmpolld in lvm.conf or the lvmpolld daemon state.Internal error: Use of lvmpolld requires uuid set.Internal error: Use of lvmpolld requires vgname set.Internal error: Use of lvmpolld requires lvname set.Asking lvmpolld for pvmove%s on %s/%s.Asking lvmpolld for mirror conversion on %s/%s.Asking lvmpolld for snapshot merge on %s/%s.Asking lvmpolld for thin snapshot merge on %s/%s.Internal error: Unsupported poll operation.Internal error: Use of lvmpolld requires uuid being set.Asking lvmpolld for progress status of an operation on %s/%s.Failed to create progress_info request.No polling operation in progress regarding LV %s.Command executed by lvmpolld got terminated by signal (%d).LVM command run by lvmpolld responded with: 'No such command.'LVM command run by lvmpolld failed due to invalid parameters.LVM command executed by lvmpolld failed.lvmpolld failed to duplicate file descriptors.lvmpolld failed to exec() lvm binary.lvmpolld responded with unexpected return code.For more information see lvmpolld messages in syslog or lvmpolld log file.Polling finished successfully.Lockspace for "%s" not stopped on other hosts%s: lock type %s lvmlockd result %dFail to allocate PV list for VG %sFail to allocate PV path for VG %slvmlockd %s %s failed no resultHandle sanlock LV %s path too long.Cannot get size of sanlock LV %s.Refresh sanlock lv %llu dm %lluExtend sanlock LV from %llus (%llu bytes) to %us (%u bytes)Extend sanlock LV %s to size %s failed.Failed to refresh sanlock LV %s after extend.Extend sanlock LV zeroing %u bytes from offset %llu to %lluZeroing %u MiB on extended internal lvmlock LV...Extend sanlock LV %s cannot find device.Extend sanlock LV %s cannot open device.Extend sanlock LV %s cannot zero device at %lu.Invalid host_id %d, use 1-250 (sanlock_align_size is 1MiB).Invalid host_id %d, use 1-500 (sanlock_align_size is 2MiB).Invalid host_id %d, use 1-1000 (sanlock_align_size is 4MiB).Invalid host_id %d, use 1-2000 (sanlock_align_size is 8MiB).Invalid sanlock_align_size %u, use 1,2,4,8.Invalid host_id %d, use 1-2000.VG %s init failed: lvmlockd not availableVG %s init failed: invalid parameters for sanlockVG %s init failed: sanlock cannot open device /dev/mapper/%s-%sCheck that sanlock has permission to access disks.VG %s init failed: lock manager sanlock is not runningVG %s init failed: lock manager sanlock is not supported by lvmlockdVG %s init failed: no disk space for leasesVG %s init failed: a lockspace with the same name existsVG %s init failed: lock_args not returnedVG %s init failed: vg_write vg_commitFailed to deactivate sanlock lv %s/%sVG %s init failed: lock_args alloc failedUsing sector size %u for sanlock LVLV %s/%s must be inactive on all hosts.Force unprotected removal of shared VG? [y/n]: Cannot change VG %s with active LVsCannot free VG sanlock, lvmlockd is not in use.Cannot free VG sanlock, lvmlockd is not connected.Global lock failed: global lock was lost by removing a previous VG._free_vg_sanlock %s no lock_argsLockspace for "%s" is not started._free_vg_sanlock lvmlockd result %dVG %s held the sanlock global lock, enable global lock in another VG.dm_build_dm_name failed-cmeta%s/%s%slv_dmpath snprintf failedRunning check command on %s-Vbetterolderactivate/fs.cRemoving link %s%s/groupCouldn't create path for %s.Removing %sLinking %s -> %ssymlinkCreating directory %smkdirRemoving directory %sLVM_SYSTEM_DIRlvmpolld/lvmpolld-client.clvname = %svgname = %slvid = %scmdline = %sinterval = %sFailed to create %s request.abort = %ldhandle_missing_pvs = %ldsysdir = %sdevicesfile = %smissing_%d_%dPrelAdding new LV %s%s%s to dtreecryptostratisCRYPT-TEMPCRYPT-SUBDEVstratis-Syncing device names origin-onlyCreating %s%s tree for %s.Deleting tracked UUID %s. abortmerge_thinprogress_infoin_progressreasonsignalnot_foundpath_num = %ldFailed to create pvs request.path[%d] = %%slvmlockd is not in use.lvmlockd is not connected.vg_name = %spid = %ldbusy_vgvg_lock_args = %svg_lock_type = %sFail to any PVs for VG %sVG %s find PV device %scmd = %slv_lock_args = %slv_uuid = %slv_name = %sopts = %smode = %slockd %s %s result %d %xNo internal lvmlock LV found.Cannot open sanlock LV %s.Failed to refresh %s.lockd find_free_lock %sfind_free_locklv_size_bytes = %ldUnsupported sector size %u.Failed to create internal lv.init_vgalign_mb = %ldVG %s init failed: %dvg_lock_argsUnknown lock_type.Failed to unlock LV %s/%s.VG not removed.free_vg(PP_busy_vgPRELOADACTIVATEDEACTIVATESUSPENDSUSPEND_WITH_LOCKFSCLEANvdo_poolvdo_offsetvdo_pool = "%s"vdo_offset = %u Virtual size %s Header size %sCompression %s %sDeduplicationMetadata hints Minimum IO size %s Block map cache sz %s Block map era length %uSparse index Index memory size %s Slab size %s # Ack threads %u # Bio threads %u Bio rotation %u # CPU threads %u # Hash zone threads %u # Logical threads %u # Physical threads %u Max discard %u Write policy %sUnknown logical volume %s.block_map_era_lengthheader_size = %uvirtual_extents = %uuse_compression = 1use_deduplication = 1use_metadata_hints = 1minimum_io_size = %ublock_map_cache_size_mb = %ublock_map_era_length = %uuse_sparse_index = 1index_memory_size_mb = %umax_discard = %uslab_size_mb = %uack_threads = %ubio_threads = %ubio_rotation = %ucpu_threads = %uhash_zone_threads = %ulogical_threads = %uphysical_threads = %uwrite_policy = %sV%u %*s %lu %*u %uMissing VDO's data uuid %s.dumpconfig.ccurrentdiffIncorrect version format.Failed to load profile %s.LVM configuration valid.LVM configuration invalid.profilableprofilable-commandprofilable-metadataDumping configuration to %sFailure while writing to %sadopt,adopt_only,nodelay,Options string too long %xstart_vghost_id = %ldversion = %ldvg_uuid = %sVG %s starting %s lockspaceVG %s start failed: %dadoptadopt_onlylockd global disabled %slockd global %slock_gl (host_id %u)lockd global %s already held.Global lock failed: error %dGlobal lock failed: error %d.lockd query LV %s/%squery_lock_lvpersistent,lvextendlvresizelvchangeOptions string too long %x.lockd_lv %s %s/%s %s %sLocking failed for LV %s/%sRefresh lvmlocklockd_lv disabled %s %s/%sfree_lvlockd init_lv %s %sinit_lvprev_lv_args = %slv_lock_argslv_lock_args not returnedSkip LV unlock: no lockspacelockd_lv_thin thin_volumelockd_lv_thin thin_poollockd_lv_thin thin_datalockd_lv_thin thin_metadatalvcreatelockd_lv_thin for %sNo vdo pool for %s/%sno_modelockd_lv %s %sshupdatenorefreshskipglskipvgskiplvautonowaitadoptlsadoptgladoptvgadoptlvnodelayrepairglrepairvgrepairlv_longcommand.cStringSelect--uuidstr prev ... -%c| (, %c%c [ --type %s|%s ] (implied) [ -l|--extents [ [ COMMON_OPTIONS ]lvchange.cMonitoring LV %sUnmonitoring LV %sPolling LV %sdevtypesdumpconfigformatsfullreportDisplay full reporthelpDisplay help for commandslastlogChange logical volume layoutCreate a logical volumelvdisplayAdd space to a logical volumelvmchangelvmconfigManage the devices filelvmdiskscanlvmsadcCollect activity datalvmsarCreate activity reportlvpolllvreducelvrenameRename a logical volumeResize a logical volumelvscanpvchangepvckpvdatapvdisplaypvremovepvresizeResize physical volume(s)pvspvscanList all physical volumessegtypesList available segment typessystemidvgcfgbackupvgcfgrestorevgchangevgckvgconvertCreate a volume groupvgdisplayvgexportvgextendvgimportvgimportcloneImport a VG from cloned PVsvgimportdevicesvgmergeMerge volume groupsvgmknodesvgreduceRemove volume group(s)vgrenameRename a volume groupvgsvgscanSearch for all volume groupsvgsplitERRy|n[+|-]Number[+]Numberpartial|degraded|completey|n|ayauto|1|2passdown|nopassdown|ignorecore|disk[+|-]Size[k|UNIT][+|-]Size[m|UNIT][+]Size[m|UNIT][-]Size[m|UNIT][+|-]Number[PERCENT][+]Number[PERCENT][-]Number[PERCENT]rw|rsanlock|dlm|noneauto|none|Numberall|unmanaged|NumberPV[:t|n|y]check|repairbasic|json|json_stdlog|vg|lv|pv|pvseg|segnone|abbrev|full|0|1|2Couldn't read '%s' for VDO segment.Unknown VDO pool logical volume %s.Internal error: Passed segment is not VDO type.Internal error: Passed segment is not VDO pool.Checking VDO pool table line for LV %s.Failed to parse VDO parameters %s for LV %s.WARNING: Unknown VDO table line version %u.WARNING: Target %s version %u.%u.%u is too old.Target %s %s support disabled by %s.String list allocation failed for VDO module.Only one of --type and --validate permitted.Only one of --type and --list permitted.Only one of --atversion and --sinceversion permitted.--atversion requires --type or --list--sinceversion requires --type newOnly one of --ignoreunsupported and --showunsupported permitted.--atversion has no effect with --type %s--ignoreadvanced and --ignoreunsupported has no effect with --type current--mergedconfig has no effect without --type current or --type fullFailed to merge configuration.--withcomments has no effect with --type list--withlocalpreamble has no effect with --type list--withgeneralpreamble has no effect with --type list--valuesonly has no effect with --type listIncorrect type of configuration specified. Expected one of: current, default, diff, full, list, missing, new, profilable, profilable-command, profilable-metadata.Failed to create default config tree.Failed to create temporary config tree while creating full tree.Failed to clone current config tree.Failed to merge default and current config tree.# This is an example configuration file for the LVM2 system. # It contains the default settings that would be used if there was no # @DEFAULT_SYS_DIR@/lvm.conf file. # # Refer to 'man lvm.conf' for further information including the file layout. # # Refer to 'man lvm.conf' for information about how settings configured in # this file are combined with built-in values and command line options to # arrive at the final values used by LVM. # # Refer to 'man lvmconfig' for information about displaying the built-in # and configured values used by LVM. # # If a default value is set in this file (not commented out), then a # new version of LVM using this file will continue using that value, # even if the new version of LVM changes the built-in default value. # # To put this file in a different directory and override @DEFAULT_SYS_DIR@ set # the environment variable LVM_SYSTEM_DIR before running the tools. # # N.B. Take care that each setting only appears once if uncommenting # example settings in this file. # This is a local configuration file template for the LVM2 system # which should be installed as @DEFAULT_SYS_DIR@/lvmlocal.conf . # # Refer to 'man lvm.conf' for information about the file layout. # # To put this file in a different directory and override # @DEFAULT_SYS_DIR@ set the environment variable LVM_SYSTEM_DIR before # running the tools. # # The lvmlocal.conf file is normally expected to contain only the # "local" section which contains settings that should not be shared or # repeated among different hosts. (But if other sections are present, # they *will* get processed. Settings in this file override equivalent # ones in lvm.conf and are in turn overridden by ones in any enabled # lvm_.conf files.) # # Please take care that each setting only appears once if uncommenting # example settings in this file and never copy this file between hosts. Configuration node %s not foundVG %s start failed: lvmlockd is not enabledVG %s start failed: lvmlockd is not runninglockd start VG %s lock_type %sFailed to activate sanlock lv %s/%sVG %s start failed: lvmlockd not availableVG %s start error: already startedVG %s start error: already startingVG %s start failed: invalid parameters for %sVG %s start failed: invalid sanlock host_id, set in lvmlocal.confVG %s start failed: lock manager %s is not runningVG %s start failed: lock manager %s is not supported by lvmlockdVG %s start failed: sanlock lease needs repairExclusive locks are not allowed with readonly option.WARNING: skipping global lock in lvmlockd.Reading without shared global lock.Global lock failed: check that lvmlockd is running.Retrying global lock: io timeoutRetrying global lock: held by other host%sStart a lock manager, lvmlockd did not find one running.Global lock failed: lockspace is startingGlobal lock failed: check that global lockspace is startedGlobal lock failed: storage errors for sanlock leasesGlobal lock failed: io timeoutGlobal lock failed: sanlock lease needs repairGlobal lock failed: lock manager errorGlobal lock failed: storage failed for sanlock leasesGlobal lock failed: orphan lock needs to be adoptedGlobal lock failed: adopt found no orphanGlobal lock failed: adopt found other modeGlobal lock failed: held by other host%sSkipping global lock: lockspace is startingSkipping global lock: storage %s for sanlock leasesSkipping global lock: io timeoutSkipping global lock: sanlock lease needs repairSkipping global lock: VG with global lock was removedSkipping global lock: orphan lock needs to be adoptedSkipping global lock: adopt found no orphanSkipping global lock: adopt found other modeSkipping global lock: lock manager errorSkipping global lock: held by other host%sSkipping global lock: lockspace not found or startedDuplicate sanlock global locks should be correctedLock query failed for LV %s/%squery_lock_lv lvmlockd result %dquery_lock_lv mode not returnedLV locks are not allowed with readonly option.WARNING: shared LV may require refresh on other hosts where it is active.WARNING: skipping LV lock in lvmlockd.LV %s/%s lock failed: lvmlockd is required for VG lock_type %s.LV %s/%s lock failed: lvmlockd connection is required.Shared activation not compatible with LV type %s of %s/%sFail to find any PVs for %s/%s, try to find PVs from VG insteadFail to allocate PV list for %s/%sFail to allocate PV path for LV %s/%sFind PV device %s for LV %s/%sLV locked by other host: %s/%s%sLV %s/%s lock failed: io timeout.LV %s/%s lock failed: sanlock lease needs repair.LV %s/%s lock failed: orphan lock needs to be adopted.LV %s/%s lock failed: adopt found no orphan.LV %s/%s lock failed: adopt found other mode.WARNING: extending LV with a shared lock, other hosts may require LV refresh.LV is already locked with incompatible mode: %s/%sLV %s/%s lock failed: lockspace is inactiveLV %s/%s lock failed: storage %s for sanlock leasesLV %s/%s lock failed: error %dlockd free LV disabled %s/%s %s lock_args %sLV %s/%s free lock in shared VG: lvmlockd is required.LV %s/%s free lock in shared VG: lvmlockd is not connected.lockd free LV %s/%s %s lock_args %sLV %s/%s free lock in shared VG: lockspace not startedLV %s/%s free lock in shared VG: lvmlockd error %d.Lock already exists for LV %s/%sNo sanlock space for lock for LV %s/%s_init_lv_sanlock lvmlockd result %dlv_lock_args allocation failedlockd_free_lv: unknown lock_type.VG %s init failed: invalid parameters for dlmVG %s init failed: lock manager %s is not runningVG %s init failed: lock manager %s is not supported by lvmlockdLock on incorrect thin lv type %s/%sCannot find thin pool for %s/%slockd_lv_thin creating_thin_poollockd_lv_thin creating_thin_volumelockd_lv_thin creating_thin_pool skip without LDLV_CREATING_THIN_POOLlockd_lv_thin creating_thin_volume skip without LDLV_CREATING_THIN_VOLUMElockd_lv_thin invalid use of LDLV_CREATING_THIN_POOLlockd_lv_thin invalid use of LDLV_CREATING_THIN_VOLUMElockd_lv_thin creating cow snapshot of thin volumelockd_lv_thin for lvcreate_new_plus_old_cachepool_or_lvconvert_old_plus_new_cachepoollockd_lv_thin from lvcreate undefined case.lockd_lv_thin skip unlock for active pool %slockd_lv_thin skip repeated unlock for inactive pool %slockd_lv_thin skip repeated lock for active pool %sLock on incorrect vdo lv type %s/%sSkip LV lock: no lock args for %sIgnoring unknown lockopt value: %sParsing command defs: unknown opt str: "%s"%s%s.Parsing command defs: unknown lv type %s.Parsing command defs: unknown opt arg: %s.Parsing command defs: unknown pos arg: %s.Too many args, increase CMD_RO_ARGS.Too many args, increase CMD_OO_ARGS.Too many args, increase CMD_IO_ARGS.Parsing command defs: option %s must be followed by an arg.Parsing command defs: options must be specified in long form: %s.Parsing command defs: can't parse argc %d argv %s%s%s.Parsing command defs: no OO line found for %s.Updating %s%slogical volume %s on disk(s).Failed to update %smetadata of %s on disk.Logical volume %s is not active.Failed to change monitoring for %s volume.Display and manipulate configuration informationDisplay recognised built-in block device typesList available metadata formatsDisplay last command's log reportChange the attributes of logical volume(s)Display information about a logical volumeWith the device mapper, this is obsolete and does nothing.List devices that may be used as physical volumesContinue already initiated poll operation on a logical volumeReduce the size of a logical volumeRemove logical volume(s) from the systemDisplay information about logical volumesList all logical volumes in all volume groupsChange attributes of physical volume(s)Check metadata on physical volumesInitialize physical volume(s) for use by LVMDisplay the on-disk metadata for physical volume(s)Display various attributes of physical volume(s)Move extents from one physical volume to anotherRemove LVM label(s) from physical volume(s)Display information about physical volumesDisplay the system ID, if any, currently set on this hostList tags defined on this hostDisplay software and driver version informationBackup volume group configuration(s)Restore volume group configurationChange volume group attributesCheck the consistency of volume group(s)Change volume group metadata formatDisplay volume group informationUnregister volume group(s) from the systemAdd physical volumes to a volume groupRegister exported volume group with systemAdd devices for a VG to the devices file.Create the special files for volume group devices in /devRemove physical volume(s) from a volume groupDisplay information about volume groupsMove physical volumes into a new or existing volume groupwritethrough|writeback|passthrough[Number]r|R|h|H|b|B|s|S|k|K|m|M|g|G|t|T|p|P|e|Elinear|striped|snapshot|raid|mirror|thin|thin-pool|vdo|vdo-pool|cache|cache-pool|writecachecontiguous|cling|cling_by_tags|normal|anywhere|inheritpvmove|convert|merge|merge_thincurrent|default|diff|full|list|missing|new|profilable|profilable-command|profilable-metadatapv_header|metadata|label_headerheaders|metadata|metadata_all|metadata_searchرPٹù1-\TTT\TTlT-----abort--activationmode --addtag --adddev --deldev--delnotfound--addpvid--delpvid--aligned --alloc !--atomic --atversion --auto --autoactivation--setautoactivation--binary--bootloaderareasize--cache--cachemetadataformat--cachemode--cachepool--cachevol--cachedevice --cachesize--check--commandprofile--compression--config--configreport+--typeconfig,--dataalignment--dataalignmentoffset --deduplication!--deltag" --detachprofile#--deviceidtype$--devices% --devicesfile&--discards'--driverloaded(--dump).--errorwhenfull*--force+ --foreign,--fs---fsmode.--handlemissingpvs/--headings0/--ignoreadvanced1--ignorelocal2--ignorelockingfailure3--ignoremonitoring4--ignoreskippedcluster5--ignoreunsupported6--importdevices7--journal8--labelsector9--listlvs:--listvg;--checkcomplete<--lockopt=--lockstart>--lockstop?--locktype@"--logonlyA--longhelpB--majoritypvsC--maxrecoveryrateD--mergeE--mergemirrorsF--mergesnapshotG--mergethinH--mergedconfigI--metadataignoreJ--metadataprofileK--metadatasizeL--minorM--minrecoveryrateN--mirrorlogO--mirrorsonlyP--mknodesQ--monitorR--nameprefixesS--noheadingsT--nohintsU--nohistoryV--nolockingW--norestorefileX--nosuffixY--nosyncZ--notifydbus[--noudevsync\--originname]--setphysicalvolumesize^--settings_--poll`--polloperationa'--pooldatasizeb--pooldatavdoc--poolmetadatad--poolmetadatasizee--poolmetadatasparef--profileg--pvmetadatacopiesh%--raidintegrityi--raidintegrityblocksizej--raidintegritymodek--readonlyl--refreshm--removemissingn--rebuildo --repairp--repairtypeq---replacer --reportformats*--restorefilet--restoremissingu--resyncv--rootvgw--rowsx--segmentsy--separatorz--shared{--sinceversion|--splitcache}--splitmirrors~--splitsnapshot--showdeprecated--showunsupported--startpoll--stripes--swapmetadata--syncaction)--sysinit--systemid--thinpool--trackchanges--trustcache--type --udevoutput--unbuffered--uncache--update--cachepolicy--cachesettings--unconfigured--units--unquoted--usepolicies--validate--valuesonly--vdo--vdopool--vdosettings--version--vgmetadatacopies$--vgonline--withsummary--withcomments--withgeneralpreamble--withlocalpreamble--withspaces--withversions--writebehind--writemostly(--corelog--resizable--allocation--available --raidrebuild --raidsyncaction)--raidwritemostly(--raidminrecoveryrate--raidmaxrecoveryrate--raidwritebehind--virtualoriginsize--split--metadatacopies&--activatea --alla--autobackupA--activevolumegroupsA--allpvsA--backgroundb--basevgnamen--blockdeviceb--chunksizec--clusteredc--colonc--columnsC--contiguousC--debugd--exportede--physicalextentE--filef--forcef--fullf--helph--cacheH--historyH--?--importi--intervali--iop_versioni--stripesi--stripesizeI--logicalvolumel--maxlogicalvolumesl--extentsl--listl--lvmpartitionl--sizeL--persistentM--majorj--setactivationskipk--ignoreactivationskipK--integritysettings--mapsm--mirrorsm--metadatatypeM--namen--nofsckn--novolumegroupn--oldpathn--optionso--sortO--maxphysicalvolumesp--permissionp--partialP--physicalvolumeP--quietq--readaheadr#--resizefsr--resetR--regionsizeR--physicalextentsizes--snapshots--shorts--stdins--selectS--testt--thinT--updatemetadata--uuidu--uuidu--uuidlistU--verbosev--volumegroupV--virtualsizeV--wipesignaturesW--allocatablex--resizeablex--yesy--zeroZ---linearstripedsnapshotcachecachepoolintegritymirrorraidraid0 raid1 raid10 raid4 raid5 raid6thinthinpoolthinpooldatavdovdopoolvdopooldatawritecachezeroerrorglobal/vdo_disabled_featuresonline_renameversion4kvdoInternal error: Missing function for command definition %d:%s.Logical volume %s is already read-only. Refreshing kernel state.Logical volume "%s" is already read only.Logical volume %s is already writable. Refreshing kernel state.Logical volume %s is already writable.Setting logical volume %s read/write.Setting logical volume %s read-only.Allocation policy of logical volume %s is already %s.Setting contiguous allocation policy for %s to %s.Updating logical volume %s on disk(s).Error when full is already %sset for %s.Read ahead is already auto for %s.WARNING: Overriding readahead to %u sectors, a multiple of %uK page size.Read ahead is already %u for %s.Setting read ahead to %u for %s.Unable to change write%s on %s while it is not in-sync.%s not found in volume group, %sCan't set all images of %s LV %s to writemostly.Minimum recovery rate cannot be higher than maximum, adjusting.Changing configuration profile for LV %s: %s -> %s.Changing activation skip flag to %s for LV %s.Changing autoactivation flag to %s for LV %s.Unable to change compression for non VDO volume %s.Logical volume %s already uses --compression %c.Unable to change deduplication for non VDO volume %s.Logical volume %s already uses --deduplication %c.Internal error: Failed to check for option %sCannot change support for discards while pool volume %s is active.Logical volume %s already uses --discards %s.Logical volume %s already %szero new blocks.Cannot change existing block size %u bytes.Clear all writecache settings? WARNING: repairing a damaged cachevol is not yet possible.WARNING: cache mode writethrough is suggested for safe operation.Continue using writeback without repair?Cache %s is not clean, refusing to switch cache mode.Cannot change VDO settings for active VDO pool %s.VDO pool %s with all its LVs needs to be deactivated.A raid LV with integrity is required.No integrity found in specified raid LV.LV must be inactive to change integrity settings.Clear all integrity settings? Operation not permitted on hidden LV %s.Do you want to activate component LV in read-only mode? [y/n]: Allowing activation of component LV.Change of snapshot %s will also change its origin %s%s. Proceed? [y/n]: Logical volume %s not changed.Cannot activate LVs in a foreign VG.Cannot change LV properties when activating component LVs.WARNING: Combining activation change with other commands is not advised.Refreshing logical volume %s (if active).Can't resync open logical volume %s.Do you really want to deactivate logical volume %s to resync it? [y/n]: Logical volume %s not resynced.Unable to deactivate %s for resync.Starting resync of %s%s%s%s %s.Failed to reactivate %s to resynchronize mirror.Failed to reattach %s device after clearing.Failed to reactivate %s after resync.RAID logical volume %s cannot be active remotely.Internal error: Missing syncaction arg.Use syncaction check to detect and correct integrity checksum mismatches.Thin pool data or metadata volume must be specified. (E.g. "%s_tdata")%s must be a RAID logical volume to perform this action.Kernel driver does not support this action: %s"%s" is not a supported sync operation.%s state is currently "%s". Unable to switch to "%s".Internal error: %s is not a RAID logical volume.Internal error: Unknown RAID message: %s.Do you really want to rebuild %u PVs of logical volume %s [y/n]: Logical volume %s not rebuild.Cannot convert %s LV %s to %s.Conversion using --type %s is not supported.--mirrorlog and --corelog are incompatible.--mirrors/--type mirror/--type raid* and --splitmirrors are mutually exclusive.Please name the new logical volume using '--name'Internal error: Changing conv_type from %d to %d.--stripes or --stripesize argument is only valid with --mirrors/--type mirror/--type raid*/--type striped/--type linear, --repair and --thinpool--chunksize is only available with snapshots or pools.--zero is only available with snapshots or pools.cannot be used with --type raid0 or --type striped or --type linearInternal error: Wrong params for lvconvert _create_id.Internal error: Name "%s/%s" is too long.Poll operation ID allocation failed.Failed to copy one or more poll operation ID members.lvconvert: layer name creation failed.lvconvert: layer name generation failed.Allocation of list of failed_pvs failed.Allocation of failed_pvs list entry failed.Conversion of tracking raid1 LV %s is not supported.Failed to find RaidLV of RAID subvolume %s.Conversion of tracked raid1 subvolume %s is not supported.--corelog and --mirrorlog are only compatible with mirror devices.Mirror segment type cannot be used for thinpool%s. Try "%s" segment type instead.Mirrors are not yet supported on cache LVs %s.Cannot specify mirrors with linear type.Unable to split mirrors in VG with lock_type %sOnly up to %d images in mirror supported currently.Unable to reduce images by specified amount - only %d in %sAdjusting mirror image count of %sCopying region size %s from existing mirror.Internal error: Unknown mirror log count %d.Mirror log region size cannot be changed on an existing mirror.Logical volume %s has multiple mirror segments.Cannot both allocate and free extents when specifying physical volumes to use.Please specify the operation in two steps.Logical volume %s being converted.Unable to %s images by specified amount.Exactly one image must be split off from %s when tracking changes.--corelog and --mirrorlog are only compatible with mirror devicesSplitting raid image is not allowed with lock_type %s.Integrity must be removed before splitting.Unable to split images from non-mirrored RAID.Unable to split image from %s while not in-sync.Cannot track more than one split image at a time.Are you sure you want to split and track %s LV %s losing resilience for any newly written data? [y/n]: Losing resilience for newly written data on logical volume %s.%s split from %s for read-only purposes.WARNING: Any newly written data will be non-resilient on LV %s during the split!Use 'lvconvert --merge %s' to merge back into %s.Unable to split more than one image from %s.Unable to split logical volume of segment type, %s.%sLogical Volume "%s" already exists in %s.Unable to split %s while it is not in-sync.Are you sure you want to split %s LV %s losing all resilience? [y/n]: Losing all resilience for logical volume %s.Failed to write changes for %s.Failed to suspend %s before committing changes.Failed to commit changes for %s.Failed to resume %s after committing changes.Only up to %u mirrors in %s LV %s supported currently.Cannot add raid images with integrity for this raid level.Are you sure you want to convert %s LV %s to %s%u images %s resilience? [y/n]: Logical volume %s successfully converted.RAID module does not support RAID0.RAID module does not support RAID10.This conversion is not supported for raid with integrity.Unable to find image to satisfy request.Unable to split additional image from %s while tracking changes for %s.Conversions to --type mirror require -m/--mirrorsUnknown operation on mirror LV %s.Unknown operation on raid LV %s.Unknown operation on striped or linear LV %s.Detaching cachevol %s from LV %s.WARNING: writeback cache on %s is not complete and cannot be flushed.WARNING: cannot detach writeback cache from %s without --force.WARNING: Data may be lost by detaching writeback cache without flushing.Detach writeback cache %s from %s without flushing data?LV %s has no suffix for cachevol (skipping rename).%s is not a mergeable logical volume.Cannot merge snapshot %s into the origin %s with merging snapshot %s.Internal error: %s is missing origin.%s is read-only external origin %s.Merging into the old snapshot origin %s is not supported.Delaying merge since snapshot is open.Delaying merge since origin volume is open.Failed to reactivate origin %s.Merging of thin snapshot %s will occur on next activation of %s.Thin repair command is not configured. Repair is disabled.Cannot repair active pool %s. Use lvchange -an first.Failed to build thin metadata path.Failed to build pool metadata spare path.Cannot activate pool metadata spare volume %s.Cannot activate thin pool metadata volume %s.Repair of thin metadata volume of thin pool %s failed (status:%d). Manual repair required!WARNING: Cannot read output from %s %s.Transaction id %lu from pool "%s/%s" does not match repaired transaction id %lu from %s.Cannot deactivate thin pool metadata volume %s.Cannot deactivate pool metadata spare volume %s.Can't prepare new metadata name for %s.WARNING: LV %s holds a backup of the unrepaired metadata. Use lvremove when no longer required.WARNING: New metadata LV %s might use different PVs. Move it with pvmove if required.(inherited)disabled%s:yLogical volume %s changed.No settings changed. and %u other snapshot(s)Failed to prepare message.disk-logged core-logged clustered Failed to clear %s %s for %s.intermediateidlefrozenresyncrecoverNo --rebuild found!raid0lvconvert.cMergedConverted_mimagetmp_%dlayer name creation failed.Failed to insert resync layerNo usable images left in %s.Setting logging type to %s.Logical volume %s converted.raid1 with reducingenhancingLogical volume %s NOT split.Cannot convert LV %s.Conversion aborted.Volume %s replaced origin %s.-i-otransaction="%s_meta%%dǺ԰԰԰԰԰԰԰԰԰԰԰԰԰԰԰԰԰԰԰԰԰԰԰԰԰԰Ǻ԰԰԰԰԰԰a԰԰԰԰԰԰԰԰԰԰԰԰԰԰԰԰԰԰԰԰԰԰԰԰԰H԰԰԰԰԰԰԰԰Hnonedevtypes_generalformats_generalfullreport_generalhelp_generallastlog_generallvchange_activatelvchange_monitorlvchange_persistentlvchange_poll lvchange_properties lvchange_rebuild lvchange_refresh lvchange_resync lvchange_syncactionlvconvert_change_mirrorloglvconvert_change_region_sizelvconvert_combine_split_snapshotlvconvert_integritylvconvert_mergelvconvert_merge_mirror_imageslvconvert_merge_snapshotlvconvert_merge_thinlvconvert_plainlvconvert_raid_typeslvconvert_repairlvconvert_replace_pvlvconvert_split_and_keep_cachelvconvert_split_and_remove_cachelvconvert_split_cow_snapshotlvconvert_split_mirror_imageslvconvert_start_polllvconvert_swap_pool_metadata lvconvert_to_cache_with_cachepool!lvconvert_to_cache_with_cachevol"lvconvert_to_cache_with_device#lvconvert_to_cachepool$lvconvert_to_cachepool_or_swap_metadata%lvconvert_to_thin_with_data&lvconvert_to_thin_with_external'lvconvert_to_thinpool(lvconvert_to_thinpool_or_swap_metadata)lvconvert_to_vdopool*lvconvert_to_vdopool_param+lvconvert_to_writecache,lvconvert_to_writecache_with_device-lvcreate_and_attach_cachedevice_for_cache.lvcreate_and_attach_cachedevice_for_writecache/lvcreate_and_attach_cachepool0lvcreate_and_attach_cachepool_v21lvcreate_and_attach_cachepool_v32lvcreate_and_attach_cachevol_for_cache3lvcreate_and_attach_cachevol_for_writecache4lvcreate_cachepool5lvcreate_cow_snapshot6lvcreate_cow_snapshot_with_virtual_origin7lvcreate_error_vol8lvcreate_linear9lvcreate_mirror:lvcreate_mirror_or_raid1;lvcreate_new_plus_old_cachepool_or_lvconvert_old_plus_new_cachepool<lvcreate_raid_any=lvcreate_striped>lvcreate_thin_snapshot?lvcreate_thin_snapshot_of_external@lvcreate_thin_volAlvcreate_thin_vol_and_thinpoolBlvcreate_thin_vol_with_thinpool_or_sparse_snapshotClvcreate_thinpoolDlvcreate_vdo_volElvcreate_zero_volFlvdisplay_colonGlvdisplay_columnsHlvdisplay_generalIlvextend_policyJlvextend_pool_metadataKlvextend_pvLlvextend_sizeMlvmchange_generalNlvmconfig_generalOlvmdevices_checkPlvmdevices_editQlvmdevices_listRlvmdevices_updateSlvmdiskscan_generalTlvmsadc_generalUlvmsar_generalVlvpoll_generalWlvreduce_sizeXlvremove_generalYlvrename_lv_lvZlvrename_vg_lv_lv[lvresize_pool_metadata\lvresize_pv]lvresize_size^lvs_general_lvscan_general`pvchange_properties_allapvchange_properties_somebpvck_dumpcpvck_generaldpvck_repairepvck_repair_typefpvcreate_generalgpvdata_generalhpvdisplay_colonipvdisplay_columnsjpvdisplay_generalkpvmove_anylpvmove_onempvremove_generalnpvresize_generalopvs_generalppvscan_cacheqpvscan_displayrsegtypes_generalssystemid_generalttags_generaluversion_generalvvgcfgbackup_generalwvgcfgrestore_by_filexvgcfgrestore_by_vgyvgcfgrestore_list_by_filezvgcfgrestore_list_by_vg{vgchange_activate|vgchange_lockstart}vgchange_lockstop~vgchange_locktypevgchange_monitorvgchange_pollvgchange_propertiesvgchange_refreshvgchange_systemidvgck_generalvgck_update_metadatavgconvert_generalvgcreate_generalvgdisplay_colonvgdisplay_columnsvgdisplay_generalvgexport_allvgexport_somevgextend_generalvgimport_allvgimport_somevgimportclone_generalvgimportdevices_allvgimportdevices_rootvgimportdevices_somevgmerge_generalvgmknodes_generalvgreduce_allvgreduce_by_pvvgreduce_missingvgremove_generalvgrename_by_namevgrename_by_uuidvgs_generalvgscan_generalvgsplit_by_lvvgsplit_by_pvcount !*"NDgK#'Manual repair required. and withWITHOUT and metadata volumesMetadata LV %s not found.Unknown pool metadata LV %s.Can't convert locked LV %s.pool_metadata%d_tpool%dConverted %s to %s %s.Logical volume %s not split.WARNING: %s not zeroed.LVM_VG_NAMEvg/lv string alloc failed.Cache pool %s not found.Thin pool %s not found.replaceMerging of volume %s started.Cannot find cache %s.Invalid writecache settings.Failed to update VG.Device %s not found.PV %s not found in VG.%s_cache%s_cache%%dFailed to create cachevol LVLV %s is already in use.%s_cvolUse cache metadata format 2.Only inactive cache can be repaired.Cache repair command is not configured. Repair is disabled.Failed to build cache metadata path.Cannot activate cache pool metadata volume %s.Repair of cache metadata volume of cache %s failed (status:%d). Manual repair required!Cannot deactivate pool metadata volume %s.WARNING: If everything works, remove %s volume.WARNING: Use pvmove command to move %s on the best fitting PV.Can't use same LV %s for thin pool and thin volume.Can't use lock_type %s LV as external origin.Failed to activate %s. Conversion cannot proceed.Aborting. Failed to deactivate new thin LV. Manual intervention required.Aborting. Failed to swap identifiers. Manual intervention required.Aborting. Failed to attach external origin. Manual intervention required.Converted %s to thin volume with external origin %s.Failed to deactivate thin LV %s.Failed to deactivate thin LV. Manual intervention required.Internal error: LV %s is already a pool.Cannot convert logical volume %s.Can't use same LV for pool data and metadata LV %s.Use a different LV for pool metadata %s.Mirror logical volumes cannot be used for pool metadata.Try "%s" segment type instead.Pool metadata LV %s is of an unsupported type.Pool metadata LV %s is too small (%u extents) for required metadata (%u extents).WARNING: Volume of "%s" segtype cannot store ANY real data!THIS WILL DESTROY CONTENT OF LOGICAL VOLUME (filesystem etc.)WARNING: Using mismatched cache pool metadata MAY DESTROY YOUR DATA!Do you really want to convert %s? [y/n]: Aborting. Failed to deactivate %s.Aborting. Failed to activate metadata lv.Aborting. Failed to wipe metadata lv.Failed to set up spare metadata LV for pool.Volume %s is already VDO volume, skipping VDO conversion.Aborting. Failed to deactivate metadata lv. Manual intervention required.Failed to create internal lv names, %s name is too long.Cannot allocate lock for new pool LV.Failed to lock new pool LV %s.Failed to activate pool logical volume %s.Manual intervention may be required to handle reported errors.Failed to unlock pool data LV %s/%sFailed to free lock for pool data LV %s/%sFailed to unlock pool metadata LV %s/%sFailed to free lock for pool metadata LV %s/%sWARNING: Converting %s to fully provisioned thin volume.Pool metadata extents %u chunk_size %uWARNING: Converting %s to %s pool's data%s %s metadata wiping.Internal error: Invalid lvconvert pool commandLV %s could not be converted to a thin volume.Failed to get '--replace' argumentInternal error: Unknown pool conversion.Failed to initialize processing handle.Internal error: Volume %s is not a COW.Unable to split off snapshot %s with virtual origin.Unable to split snapshots in VG with lock_type %s.Do you really want to split off active logical volume %s? [y/n]: Splitting snapshot %s from its origin.Logical Volume %s split from its origin.Unable to combine split snapshots in VG with lock_type %sUnable to use %s as both snapshot and origin.Chunk size must be a power of 2 in the range 4K to 512K.Couldn't find origin volume %s in Volume group %s.Cannot use logical volume %s with active component LVs for snapshot origin.WARNING: Converting logical volume %s to snapshot exception store.Couldn't deactivate logical volume %s.Aborting. Failed to wipe snapshot exception store.Logical volume %s converted to snapshot.LV %s with type %s cannot be converted to a cache pool.LV %s is already used as a cachevol.Use a different LV for cache pool LV and cache LV %s.LV %s could not be converted to a cache pool.Cache pool %s is already in use.Do you want wipe existing metadata of cache pool %s? [y/n]: To preserve cache metadata add option "--zero n".WARNING: Reusing mismatched cache pool metadata MAY DESTROY YOUR DATA!WARNING: Reusing cache pool metadata %s for volume caching.Redirecting operation to data sub LV %s.LV %s with type %s cannot be converted to a thin pool.Use a different LV for thin pool LV and thin LV %s.LV %s could not be converted to a thin pool.Internal error: LV %s cannot be found.Cannot convert cache volume %s with %s cache mode to external origin.To proceed, run 'lvchange --cachemode writethrough %s'.Cache %s is not clean, refusing to convert to external origin.LV %s with type %s cannot be used as a metadata LV.Cannot convert pool %s with active volumes.Failed to create internal lv names, pool name is too long.New pool metadata LV %s cannot be locked.Do you want to swap metadata of %s pool with metadata volume %s? [y/n]: Chunk size can be only changed with --force. Conversion aborted.WARNING: Changing chunk size %s to %s for %s pool volume.Do you really want to change chunk size for %s pool volume? [y/n]: Internal error: Invalid lvconvert pool command.LV %s with type %s cannot be used as a %s pool LV.Cannot convert logical volume %s under snapshot.The --poolmetadata option is required to swap metadata.Internal error: Cannot detach writecache.Detaching writecache interrupted - locking VG failed.detach writecache check clean reading vg %sDetaching writecache interrupted - reading VG failed.Detaching writecache interrupted - reading VG error %x.Detaching writecache interrupted - LV not found.Detaching writecache interrupted - LV not active.Detaching writecache cleaning %llu blocksThis command can be cancelled and rerun to complete writecache detach.Detaching writecache completed cleaning.Detaching writecache cachevol failed.Removing the writecache cachevol failed.Logical volume %s write cache has been detached.Convert poll ID list allocation failed.Logical volume %s must be active to perform this operation.Can't clear %u failed superblock(s) in %s volume %s.The maximum number of degraded devices allowed is %u.Attempt to clear %u transiently failed %s superblock(s) in %s? [y/n]: Logical volume %s with %u transiently failed %s superblock(s) NOT repaired.Clearing %u transiently failed %s superblock(s) in %s.Attempt to replace failed RAID images (requires full device resync)? [y/n]: Failed to replace faulty devices in %s.Faulty devices in %s successfully replaced.Use 'lvconvert --repair %s' to replace failed device.Volume %s is consistent. Nothing to repair.Mirror status: %d of %d images failed.Mirror log status: %d of %d images failed.Attempt to replace failed mirror log? [y/n]: Attempt to replace failed mirror images (requires full device resync)? [y/n]: WARNING: Trying to up-convert to %d images, %d logs.WARNING: Failed to replace %d of %d images in volume %s.WARNING: Failed to replace %d of %d logs in volume %s.Conversion starts after activation.WARNING: %d missing and now unallocated Physical Volumes removed from VG.Unsupported volume type for repair of volume %s.Internal error: Cannot get origin from %s COW.Cannot merge snapshot %s into the read-only external origin %s.Cannot merge snapshot %s into the read-only origin %s. (Use lvchange -p rw).Unable to merge invalidated snapshot LV %s.Can't initialize snapshot merge. Missing support in kernel?Delaying merge since origin is open.Merging of snapshot %s will occur on next activation of %s.Cannot find LV with cache from %s.WARNING: writecache on %s is not complete and cannot be flushed.WARNING: cannot detach writecache from %s without --force.WARNING: Data may be lost by detaching writecache without flushing.Detach writecache %s from %s without flushing data?Detaching writecache skipping cleaner...Detaching writecache without cleaner...Failed to activate LV to clean writecache.Detaching writecache already clean.Detaching writecache setting cleaner.Failed to set writecache cleaner for %s.Failed to set cleaner cachesettings to flush cache.See lvchange --cachesettings cleaner=1Detaching writecache finished cleaning.Failed to monitor writecache cleaner progress.Logical volume %s writecache has been detached.Logical volume %s is not cached and %s is removed.Logical volume %s is not cached and %s is unused.Internal error: Unknown cache split command.WARNING: Cache origin logical volume %s is missing.WARNING: Cache pool data logical volume %s is missing.WARNING: Cache pool metadata logical volume %s is missing.Cannot uncache writeback cache volume %s without --force.WARNING: Uncaching of partially missing %s cache volume %s might destroy your data.Do you really want to uncache %s with missing LVs? [y/n]: Logical volume %s is not cached.Detaching cachepool %s from LV %s.Cannot split cache pool while PVs are missing, see --uncache to delete cache pool.No cachedevice specified to create a cachevol.With tag as cachedevice, --cachesize is required.PV %s is in use, --cachesize is required.Use all %s from %s for cache? [y/n]: Use --cachesize SizeMB to use a part of the cachedevice.Cannot allocate from more than %u cache devices.cachedevice not found in VG %s.Failed to create cachevol LV name.Failed to generate cachevol LV format.Failed to generate cachevol LV name.Creating cachevol LV %s with size %s.Erase all existing data on %s? [y/n]: Can't prepare new cachevol name for %s.Internal error: Extend size can't be 0.The minimum cache size is two extents (%s bytes).Rounding down metadata size to max size %sRounding up metadata size to min size %sRounding up metadata size to full physical extent %sCache data blocks %llu and chunk size %u exceed max chunks %llu.Use smaller cache, larger --chunksize or increase max chunks setting.Internal error: Missing cache policy name.Setting LV %s cache on %s meta start 0 len %llu data start %llu len %llu sectorsSetting LV %s cache format %u policy %s chunk_size %u sectorsWARNING: thin pool data will not be automatically extended when cached.WARNING: manual splitcache is required before extending thin pool data.Failed to unlock fast LV %s/%sThere's no 'lvmsadc' command in LVM2.Please use the superior 'dmstats' facilities instead.There's no 'lvmsar' command in LVM2.There's no 'pvdata' command in LVM2.Use lvs, pvs, vgs instead; or use vgcfgbackup and read the text file backup.There's no 'lvmchange' command in LVM2.Use 'dmsetup' commands to reset the kernel device-mapper driver.The vgconvert command has been removed along with the lvm1 format.Use a previous version of lvm to convert the lvm1 format to lvm2.%s and %s are synonyms. Please only supply one.Operation not permitted on LV %s type %s.Conversion of LV %s to vdo pool is not supported.Writecache requires consistent logical block size for LV devices.Writecache block size %u not allowed with device logical block size 4096.Using writecache block size %u for thin pool data, logical block size %u, physical block size %u.Path name too long to get LV block size %sTest mode skips checking fs block size.Using writecache block size %u for unknown file system block size, logical block size %u, physical block size %u.WARNING: unable to detect a file system block size on %sWARNING: using a writecache block size larger than the file system block size may corrupt the file system.Use writecache block size %u? [y/n]: Writecache block size %u cannot be larger than file system block size %u.Unknown memory usage for unknown writecache block_size_sectors %uWARNING: writecache size %s will use %llu GiB of system memory (%llu GiB).Continue adding writecache? [y/n]: LV %s must be linear to use as a writecache.LV %s must be inactive to attach.Failed to activate LV to check block size %sFailed to deactivate LV after checking block size %sCannot initialize readonly LV %sFailed to activate LV %s for zeroing.Failed to deactivate LV %s for zeroing.Logical volume %s now has writecache.Failed to find mirrored LV for %s.Not collapsing %s: out-of-sync.Failed to release mirror imagesFailed to remove temporary sync layer.%s: Failed query for merging percentage. Aborting merge.%s: Merging snapshot invalidated. Aborting merge.%s: Merge failed. Retry merge or inspect manually.Mirror log type "%s" is unknown.%s%s/%s:%s:%lu:%d:-1:%d:%lu:%d:-1:%d:%d:%d:%dSize may not be relative/signed.Region size may not be negative.Region size is too big (max %u).Region size must be a multiple of machine memory page size (%d bytes).Region size must be a power of 2.Extents may not be relative/signed../configure --build=x86_64-redhat-linux-gnu --host=x86_64-redhat-linux-gnu --program-prefix= --disable-dependency-tracking --prefix=/usr --exec-prefix=/usr --bindir=/usr/bin --sbindir=/usr/sbin --sysconfdir=/etc --datadir=/usr/share --includedir=/usr/include --libdir=/usr/lib64 --libexecdir=/usr/libexec --localstatedir=/var --sharedstatedir=/var/lib --mandir=/usr/share/man --infodir=/usr/share/info --with-default-dm-run-dir=/run --with-default-run-dir=/run/lvm --with-default-pid-dir=/run --with-default-locking-dir=/run/lock/lvm --with-usrlibdir=/usr/lib64 --enable-fsadm --enable-write_install --with-user= --with-group= --with-device-uid=0 --with-device-gid=6 --with-device-mode=0660 --enable-pkgconfig --enable-cmdlib --enable-dmeventd --enable-blkid_wiping --with-udevdir=/usr/lib/udev/rules.d --enable-udev_sync --with-thin=internal --with-cache=internal --enable-lvmpolld --enable-lvmlockd-dlm --enable-lvmlockd-dlmcontrol --enable-lvmlockd-sanlock --enable-dbus-service --enable-notify-dbus --enable-dmfilemapd --with-writecache=internal --with-vdo=internal --with-vdo-format=/usr/bin/vdoformat --with-integrity=internal --with-default-use-devices-file=1 --disable-silent-rules --enable-app-machineid --enable-editline --disable-readlineFailed to swap %s with merging %s.Logical volume %s is no longer merging origin, polling has finished.Merge of snapshot into logical volume %s has finished.Could not remove snapshot %s merged into %s.Inconsistent volume group names given: "%s" and "%s"WARNING: Converting logical volume %s to VDO pool volume %s formatting.WARNING: Using invalid VDO pool data MAY DESTROY YOUR DATA!Converted %s to VDO pool volume and created virtual %s VDO volume.Cannot add integrity while LV is missing PVs.Cannot add integrity to non raid type LV %s.Logical volume %s has added integrity.LV %s does not have integrity.Cannot remove integrity from non raid type LV %s.Logical volume %s has removed integrity.Internal error: Buffer is too small for dm_snprintf().Cannot zero %slogical volume with option -Zy or -Wy.Ignoring option -Zy or -Wy for unzeroable %s volume.Option --minor may not be repeated.Snapshot origin LV %s not found in Volume group %s.Thin pool volume %s not found in Volume group %s.Logical volume %s is not a thin pool volume.Please specify either size or extents with snapshots.Logical volume %s is not a thin volume. Thin snapshot supports only thin origins.Switching from snapshot to thin segment type.Change of volume permission is unsupported with cache conversion, use lvchange.is unsupported with cache conversionSkipping activation of cache origin %s.Cannot activate cache origin %s.Cannot deactivate activate cache origin %s.Unable to create RAID LV: requires minimum VG extent size %sUnable to create RAID(1)0 LV: insufficient number of devices.Segment type 'raid0' requires 2 or more stripes.Number of stripes must be at least %d for %sPlease either create snapshot or thin volume.Please specify device size(s).is only available when creating thin poolOnly specify Physical volumes when allocating thin pool.Please either create VDO or snapshot.Maximal supported VDO virtual size is %s.Please express size as %%FREE%s, %%PVS or %%VG.Internal error: Couldn't find origin volume.Can't use %s size. Maximal supported VDO POOL volume size with slab size %s is %s.Using maximal supported VDO POOL volume size %s (with slab size %s).Calculated size of logical volume is 0 extents. Needs to be larger.Converted %u%% of %s (%u) extents into %u (with mimages %u and stripes %u for segtype %s).Internal error: Missing snapshot chunk size.Reducing COW size %s down to maximum usable size %s.Rounding size (%d extents) down to stripe boundary size (%d extents)Not enough space for thin pool creation.Adjusted size of logical volume is 0 extents. Needs to be larger.Internal error: --thinpool not identified.Internal error: Inconsistent snapshot and origin parameters identified.Internal error: Failed to identify what type of thin target to use.Making pool %s in VG %s using segtype %sMaking thin LV %s in pool %s in VG %s%s%s using segtype %s.Use lvconvert to create thin pools and cache pools in a shared VG.lockd_lvcreate_prepare find_free_lock skipped for thin volumelockd_lvcreate_prepare find_free_lock skipped for cow snap of thin volumeNo space for sanlock lock, extend the internal lvmlock LV.Removal of created spare volume failed. Manual intervention required.lockd_lvcreate_done missing name %slockd_lvcreate_done cannot find thin pool %slockd_lvcreate_done hold lock for active thin poolAmbiguous syntax, please create --type cache-pool %s separately.Failed to find LV %s to add writecache.Removing new LV after failing to add writecache.Failed to deactivate new LV %s.Failed to find LV %s to add cache.Removing new LV after failing to add cache.Selected cache metadata format %d is not supported.Command definition index %d enum %d id %sInternal error: Command %s not found. Special options for command: [ --extents Number[PERCENT] ] The --extents option can be used in place of --size. The number allows an optional percent suffix. [ --name String ] The --name option is not required but is typically used. When a name is not specified, a new LV name is generated with the "lvol" prefix and a unique numeric suffix. Common variables for lvm: Variables in option or position args are capitalized, e.g. PV, VG, LV, Size, Number, String, Tag. PV Physical Volume name, a device path under /dev. For commands managing physical extents, a PV positional arg generally accepts a suffix indicating a range (or multiple ranges) of PEs. When the first PE is omitted, it defaults to the start of the device, and when the last PE is omitted it defaults to the end. PV[:PE-PE] ... is start and end range (inclusive), PV[:PE+PE] ... is start and length range (counting from 0). LV Logical Volume name. See lvm(8) for valid names. An LV positional arg generally includes the VG name and LV name, e.g. VG/LV. LV followed by _ indicates that an LV of the given type is required. (raid represents raid type). The _new suffix indicates that the LV name is new. Tag Tag name. See lvm(8) for information about tag names and using tags in place of a VG, LV or PV. Select Select indicates that a required positional arg can be omitted if the --select option is used. No arg appears in this position. Size[UNIT] Size is an input number that accepts an optional unit. Input units are always treated as base two values, regardless of capitalization, e.g. 'k' and 'K' both refer to 1024. The default input unit is specified by letter, followed by |UNIT. UNIT represents other possible input units: BbBsSkKmMgGtTpPeE. (This should not be confused with the output control --units, where capital letters mean multiple of 1000.) Use --longhelp to show all options and advanced commands.Use 'lvm help ' for more informationArgument%s%c%s%s cannot be used in interactive mode.Option%s%c%s%s may not be repeated.Unable to allocate memory for command line arguments.--partial and --activationmode are mutually exclusive argumentsPARTIAL MODE. Incomplete logical volumes will be processed.Invalid activation mode given.WARNING: Ignoring unknown search_for_devnames setting, using %s.A --devices list cannot be used with --devicesfile.Failed to read --devices args.Failed to copy devices file name.lvdisplay.cstub.hlvmcmdline.csystem ID: %sMemTotal:%*s%llu%*sInvalid cachevol LV.LV %s could not be zeroed._wcoriglvconvert_poll.c%s: %s: %s%%LV %s is not merged.lnyljsonpvsegpv_headerlabel_headerheadersmetadata_allmetadata_searchmetadata_areabackup_to_rawlvcreate.cVirtualLogical--- Segments ---%s extents %u to %u: Type %s Monitoring %sSize may not be negative.Size may not be positive.Region size may not be zero.Extents may not be negative.Extents may not be positive.LVM version: %s1.02.207-RHEL9 (2025-09-25)Library version: %sDriver version: %sConfiguration: %spvmove_tmetaOption %s %s.skipped from activation inactive auto activated read-only origin %s%s%s%s%s%s%s, %ORIGINwith generated name as snapshot of toollib.cFailed to unlock thin pool %sFailed to remove new LV %s.Number may not be negative. Common options for lvm: Common options for command:%s: no such command.%s - %s Available lvm commands:%-16.16s%s -Option requires argument.Invalid argument for %s: %sUnrecognised option %d (%c).Invalid devices file name.Invalid units specificationlT$,L\> l l l l l l l l l l ? Filtering devices (no data) for pvid searchFiltering devices (with data) for pvid searchPVID %s not found on any devices.WARNING: PVID %s found on %s which is excluded: %sFailed to create the devices file.Checking filters with data for %sfilter result: %s in devices file is excluded by filter: %s.IDTYPE=%s IDNAME=%s DEVNAME=%s PVID=%s%s: remove multipath componentAdding multipath device %s for multipath component %s.Missing multipath device %s for multipath component %s.PRODUCT_UUID=%s (old %s): updateIDTYPE=%s IDNAME=%s DEVNAME=%s PVID=%s%s: device not foundIDTYPE=%s IDNAME=%s DEVNAME=%s PVID=%s%s: no changeIDTYPE=%s IDNAME=%s DEVNAME=%s (old %s) PVID=%s (old %s)%s: updateIDTYPE=%s IDNAME=%s DEVNAME=%s (old %s) PVID=%s%s: updateIDTYPE=%s IDNAME=%s DEVNAME=%s PVID=%s (old %s)%s: updateIDTYPE=%s IDNAME=%s (old %s) DEVNAME=%s (old %s) PVID=%s%s: updateIDTYPE=%s IDNAME=%s (old %s) DEVNAME=%s PVID=%s%s: updateIDTYPE=%s (%s) IDNAME=%s (%s) DEVNAME=%s (%s) PVID=%s%s: device not foundIDTYPE=%s (old %s) IDNAME=%s (old %s) DEVNAME=%s (old %s) PVID=%s%s: updateIDTYPE=%s (old %s) IDNAME=%s (old %s) DEVNAME=%s PVID=%s%s: updateIDTYPE=%s IDNAME=%s DEVNAME=%s PVID=%s%s: indeterminateIDTYPE=%s IDNAME=%s DEVNAME=%s PVID=%s%s: old entryIDTYPE=%s IDNAME=%s DEVNAME=%s PVID=%s%s: new entryIDTYPE=%s IDNAME=%s DEVNAME=%s PVID=%s%s: deleteUpdated devices file to version %sNo update for devices file is needed.Updates needed for devices file.Hash update needed for devices file.WARNING: adding device %s that is excluded: %s.PVID already exists in devices file for %s.WARNING: to remove a device by device id, include --deviceidtype.Device %s is used by an active LV, continue to remove? WARNING: to remove a device by name, do not include --deviceidtype.Device %s IDTYPE=%s IDNAME=%s DEVNAME=%s PVID=%s%sNo devices file entry with device id %s %s.Multiple devices file entries for PVID %s (%s %s), remove by device name.PVID not found in devices file.WARNING: only considering LVM devices%d LVM physical volume whole disk%sWARNING: Ignoring lvscan --cache because lvmetad is no longer used.Please enter one or more logical volume paths or use --select for selection.Removing devices file entry for device_id %sExisting logical volume "%s" not found in volume group "%s"Cannot rename a RAID %s directlyCannot rename %s while it is tracking a split imageRenamed "%s%s" to "%s%s" in volume group "%s"Existing historical logical volume "%s" not found in volume group "%s"Please use a single volume group name ("%s" or "%s")Old and new logical volume names requiredPlease provide a valid volume group nameLogical volume names must have the same volume group ("%s" or "%s")Old name references live LV while new name is for historical LV.New logical volume name "%s" may not exceed %zu characters.New logical volume name may not be blankNew logical volume name "%s" is invalidOld and new logical volume names must differInternal error: unknown lvresize typeOptions --fs and --resizefs cannot be used together.--resizefs is equivalent to --fs resize.The --fsmode option does not apply to resize_fsadm.Please specify either size or extents but not both.Ignoring type, stripes, stripesize and mirrors arguments when reducing.Mirrors argument may not be signed.Stripes argument may not be negative.Cannot use stripes with linear type.Stripesize may not be negative.Logical volume %s successfully resized.lvextend policy is supported only for snapshot, thin pool and vdo pool volumes.lvextend using policy requires the volume to be active.WARNING: Thin pool autoextend threshold %d%% is set below minimum supported 50%%.WARNING: VDO pool autoextend threshold %d%% is set below minimum supported 50%%.WARNING: Snapshot autoextend threshold %d%% is set below minimal supported value 50%%.lvextend policy disabled by threshold 100Can't extend %s with %s autoextend percent set to 0%%.Can't read state of locally inactive LV %s.lvextend policy calculated percentages main %u meta %u from threshold %d percent %dVG changed during file system resize, LV not resized.Refreshing LV %s on other hosts...Failed to refresh LV on all hosts.Manual lvchange --refresh required on all hosts for %s.ABORTING: Mirror percentage check failed.Failed to generate list of copied LVs: can't abort.ABORTING: Failed to generate list of copied LVsABORTING: Segment progression failed.Can't reread VG for %s error flags %x%s: No pvmove in progress - already finished or aborted.Can't find LV in %s for %s. Already finished or removed.%s: Interrupted: No longer active.ABORTING: Polling interrupted for %s.ABORTING: Can't lock VG for %s.Can't find VG %s. No longer active.ABORTING: Can't reread VG for %s error flags %x.--polloperation parameter is mandatoryArgument to --interval cannot be negativePoll ID list allocation failed.Internal error: Wrong params for _copy_poll_operation_id.Failed to copy one or more poll_operation_id members.Internal error: Handle is undefined.Device name for LV %s not found in metadata. (unfinished pvmove mirror removal?)%s: Skipping inactive LV. Try lvchange or vgchange.Failed to create poll_id_list.Resolve duplicate PV UUIDs with vgimportclone (or filters).Volume group containing %s does not support tagsVolume group containing %s has active logical volumesCan't change tag on Physical Volume %s not in volume groupCan't change PV '%s' without -ff.Allocatability not supported by orphan %s format PV %sPhysical volume "%s" is already allocatable.Physical volume "%s" is already unallocatable.Override preferred number of copies of VG %s metadata? [y/n]: Metadata areas on physical volume "%s" already ignored.Metadata areas on physical volume "%s" already marked as in-use.Physical volume "%s" has no metadata areas.Cannot disable all metadata areas in volume group %s.WARNING: Changing preferred number of copies of VG %s metadata from %u to %uSetting mda_copies to %u for VG %sFailed to generate new random UUID for %s.pv_write with new uuid failed for %s.Physical volume %s not changedFailed to store physical volume "%s" in volume group "%s"Failed to store physical volume "%s"Failed to set pvid for devices file.Failed to update devices file.Marking metadata areas on physical volume "%s" as %s.Setting physical volume "%s" NOT allocatableSetting physical volume "%s" allocatablePlease give one or more of -x, -uuid, --addtag, --deltag or --metadataignorePlease give a physical volume path or use --select for selection.Option --all and PhysicalVolumePath are exclusive.%d physical volume%s changed / %d physical volume%s not changedCommand profile '%s' requested via environment variable.Only one of --profile or --metadataprofile allowed.Only one of --profile or --commandprofile allowed.Argument to --interval cannot be negative.Checking progress %s waiting every %u seconds.devicefile name too long for lvmpolldForking background process from command: %sWARNING: Failed to set SIGCHLD action.Background process failed to setsid: %slvresize.clvmdevices.cFound PVID %s on %s.Devices file not enabled.Devices file does not exist. PART=%dPRODUCT_UUID=%s: addPRODUCT_UUID=%s: removeHOSTNAME=%s (old %s): updateHOSTNAME=%s: addHOSTNAME=%s: removeNo device found for %s.Failed to read %s.Invalid PVID.Device not removed.No devices file entry for %s.Unknown device_id type.lvmdiskscan.cdev_iter_create failedCouldn't get size of "%s"%-*s [%15s] %sLVM physical volume%d disk%s%d partition%s%d LVM physical volume%slvscan.clvremove.cFailed to read devices fileFailed to write devices filelvrename.cUnknown --fs value.Unknown --fsmode value.lvextend policy not needed.refresh_lvpath = %sLV refresh failed for LV %sACTIVE OriginalSnapshot %s%s '%s%s/%s' [%s] %spolldaemon.cCan't find LV in %s for %s.lvpoll.cProvide LV nameMovedUnknown polling operation %sMissing LV uuid within: %s/%spvchange.cChanging uuid of %s to %s.Updating physical volume "%s"Physical volume "%s" changedin-useignoredafterfork failed: %sredirectLVM_EXPECTED_EXIT_STATUS(lvm2)pvck.cHEF0H`E`E`E`E`E`E`E`E`E`ExH`E`E`EEFH/dev/nullFailed to write devices file.Failed to apply %s %s.Setting global %s "%s".Failed to add %s %s.command profilemetadata profileGiving preference to command profile specified on command line over the one specified via environment variable.LVM_COMMAND_PROFILECHECK: failed to read mda_header_%d at %lluWriting metadata at %llu length %llu crc 0x%08x mda%dWriting mda_header at %llu mda%dWrite new LVM metadata to %s? Failed to write new mda headerFailed to clone VG or LV name.Please enter a physical volume pathWARNING: skipping global lock for force.--uuid is required with --restorefile--restorefile is required with --uuidCan only set uuid on one volume at oncePhysical volume size may not be negativeUnable to read volume group from %sCan't find uuid %s in backup file %sDevice "%s" has a capacity of %sPhysical volume "%s" of volume group "%s" is exported"%s" is a new physical volume of "%s"%s:%s:%lu:-1:%lu:%lu:-1:%u:%u:%u:%u:%sPV Size %s / not usable %sPlease supply physical volume(s)%d physical volume(s) resized or updated / %d physical volume(s) not resizedOptions -e and -n are incompatibleWARNING: only considering physical volumes %sNo matching physical volumes foundTotal: %d [%s] / in use: %d [%s] / in no VG: %d [%s]Internal error: %s is not a proper mirror imageInternal error: %s is not a pvmove mirror of LV-typeInternal error: Mirror image %u not found in segment--name takes a logical volume name.Named LV and old PV must be in the same VG.Incomplete LV name supplied with --name.Logical volume name %s is invalid.pvmove not allowed on raid LV with integrity.pvmove in a shared VG requires a named LV.pvmove not allowed on internal sanlock LV.pvmove in a shared VG requires exclusive lock on named LV.Detected pvmove in progress for %s.WARNING: Ignoring remaining command line arguments.ABORTING: Failed to generate list of moving LVs.ABORTING: Temporary mirror activation failed.Creation of temporary pvmove LV failed.lvs_changed list struct allocation failed.Unable to pvmove when %s volume %s is present.Unable to pvmove device used for writecache.Unable to pvmove device used for raid with integrity.Internal error: LV name %s is too long.Can't find rimage or rmeta suffix.Can't find '_' after suffix %s.Internal error: Unexpected LV index %s.Raid sublv for name %s too long.Removing PV %s from trim list.Skipping LV %s which is not locally exclusive%s.Skipping LV %s which cannot be activated.Matched PE range %s:%u-%u against %s %u len %uFailed to insert segment in layer LV %s under %s:%u-%uMoving %u extents of logical volume %s.All data on source PV skipped. It contains locked, hidden or non-top level LVs only.Failed to convert pvmove LV to mirrored.Incompatible layer boundary: %s:%u[%u] on %s:%u.Failed to split segments being moved.ABORTING: Temporary pvmove mirror activation failed. Run pvmove --abort.Unable to move device used for writecache cachevol %s.Inserting layer %s for segments of %s on %slayer segment for %s:%u not found.No extents available for allocation.Removing layer %s for segments of %sLayer status does not match: %s:%u status: 0x%lx/0x%lxLayer boundary mismatch: %s:%u-%u on %s:%u / %u-%u / ABORTING: Removal of temporary pvmove mirror %s failed.ABORTING: Unable to deactivate temporary volume %s.ABORTING: Removal of temporary volume %s failed.Writing out final volume group after pvmove.ABORTING: Failed to write new data locations to disk.ABORTING: Failed to remove temporary logical volume(s).Please remove orphan temporary logical volume(s) when possible.Internal error: Invalid resize params.Physical volume %s format does not support resizing.WARNING: %s: Overriding real size %s. You could lose data.%s: Requested size %s exceeds real size %s. Proceed? [y/n]: Physical Volume %s not resized.%s: Requested size %s is less than real size %s. Proceed? [y/n]: %s: Size is already %s (%lu sectors).WARNING: %s: Pretending size is %lu not %lu sectors.Resizing volume "%s" to %lu sectors.Size must exceed minimum of %lu sectors on PV %s.Size must exceed physical extent start of %lu sectors on PV %s.Format specific resize of PV %s failed.Size must leave space for at least one physical extent of %u sectors on PV %s.No change to size of physical volume %s.Resizing physical volume %s from %u to %u extents.%s: cannot resize to %u extents as there is only room for %lu.%s: cannot resize to %u extents as %u are allocated.%s: cannot resize to %u extents as later ones are allocated.Use pvcreate and vgcfgrestore to repair from archived metadata.PV %-*s is in exported VG %s [%s / %s free]PV %-*s VG %-*s %s [%s / %s free]CHECK: failed to read mda_header at %llumda_header_%d at %llu # metadata areaCHECK: mda_header_%d.checksum expected 0x%xCHECK: mda_header_%d.magic expected 0x%sCHECK: mda_header_%d.version expected %uCHECK: mda_header_%d.start does not match pv_header.disk_locn.offset %lluCHECK: mda_header_%d.size does not match pv_header.disk_locn.size %lluCHECK: failed to read metadata area at offset %llu size %lluFailed to write file %s metadata area size %llu.CHECK: mda_header_%d.raw_locn[%d] no mem for metadata text size %lluCHECK: failed to read metadata text at mda_header_%d.raw_locn[%d].offset %llu size %llu part_a %llu %lluCHECK: failed to read metadata text at mda_header_%d.raw_locn[%d].offset %llu size %llu part_b %llu %lluCHECK: failed to read metadata text at mda_header_%d.raw_locn[%d].offset %llu size %lluCHECK: metadata text at %llu crc does not match mda_header_%d.raw_locn[%d].checksumCHECK: failed to set up metadata parsingCHECK: failed to parse metadata text at %llu size %llumetadata text at %llu crc 0x%x # vgname %s seqno %uFailed to parse UUID from pv_uuid setting.Invalid raw text metadata in file. File size is too small.Invalid raw text metadata in file.(pvck stdout is not valid input, see pvck -f.)(metadata backup file is not valid input.)WARNING: unexpected final bytes of raw metadata, expected \n\n\0.Invalid raw text metadata in file. (No VG UUID found.)WARNING: file data does not begin with a VG name and may be invalid.Write input file data to disk?Failed to read the first 4096 bytes of device %s.Specify at least two values from: mda_num, mda_offset, mda_size.Ignoring mda2 values from settings.Specify at least two values from: mda_num, mda2_offset, mda2_size.Invalid mda_num=1 and mda2 settings.Using common defaults for first mda: offset %llu size %llu.Override defaults with --settings "mda_offset= mda_size="Using defaults for second mda: offset %llu size %llu.Ignoring mda1_offset %llu mda1_size %llu from pv_header.Ignoring mda2_offset %llu mda2_size %llu from pv_header.Searching for metadata at offset %llu size %lluFound bad header or metadata values.CHECK: mdas have different raw_locn[0].checksum valuesSet backup file in --settings backup_file=pathFile does not appear to contain a metadata backup.WARNING: No LVM label found on %s. It may not be an LVM device.Failed to read label_header at %lluWriting label_header.crc 0x%08xFound label on %s, sector %llu, type=LVM2 001Could not find LVM label on %sFound text metadata area: offset=%llu, size=%lluMetadata text %llu too large for mda_size %llu max %lluInternal error: Wrong params for _pvmove_create_id.Failed to allocate poll identifier for pvmove.Required device-mapper target(s) not detected in your kernel.Enable lvmpolld when using lvmlockd.Specify pvmove args when using lvmlockd.Failed to write lookup entry %s %spvscan[%d] Failed to write lookup entry %s %spvdisplay.cSkip writing in test mode.Failed to write new mda textpvmove.cpvremove.cpvcreate.cNEW (exported)(but full)--- %sPhysical volume ---PV Name %sVG Name %s%sPV Size %sAllocatable yes %sAllocatable NOPE Size %sPE Size (KByte) %uTotal PE %uFree PE %uAllocated PE %u--- Physical Segments ---Physical extent %u to %u: Logical volume %s%s/%s Logical extents %d to %d FREEpvresize.cof exported volume group(s)in no volume grouppvscan.cpvmove_poll.cFailed to find an LV name.Logical volume %s not found.pvmove%dCan't find sub LV %s.Can't find PVs for sub LV %s.Skipping locked LV %s.Inserting %s:%u-%u of %s/%sNo data to move for %s.Failed to activate %sanyLayer is not linear: %s:%uMissing error segtypelv_list alloc failedRemoving temporary pvmove LV.Layer segment found: %s:%u%-*s with UUID %sInvalid PV name with uuid.PV %-*s %-*sPV %-*s VG %-*sPV %-*s %-*s %-10s %sPV %-*s VG %-*s %-10s %sPV %-*s %-*s %s [%s]?mda_header_%d.checksum 0x%xmda_header_%d.magic 0x%smda_header_%d.version %umda_header_%d.start %llumda_header_%d.size %llu LVM2 x[5A%r0N*>Failed to create file %sFailed to set up device %s.Cannot use %s: %s.Cannot access %s. %63[^=]=%63s %nInvalid setting at: %smetadata_offsetbackup_filemda_offsetmda_sizemda2_offsetmda2_sizedevice_sizemda_numInvalid setting: %sCannot open file: %sCannot access file: %sEmpty file: %sCannot read file: %s# Generatedid = No mda location.zero metadata copiesUnknown dump value.Write LVM header to device? Write new LVM header to %s? Failed to write new headerUnknown repair value.Failed to allocate lvid.Failed to clone LV name.Remove pv online devno %u:%uUnlink pv online %sDid not create %s: %dwrite_lookup_file %s LVM2 x[5A%r0N*>pvscan[%d] %s: autoactivation failed.Wrong VG found for %d:%d PVID %s: %s vs %spvscan[%d] Wrong VG found for %d:%d PVID %s: %s vs %sNo device set up for online PV %d:%d %s PVID %spvscan[%d] No device set up for online PV %d:%d %s PVID %sPVID %s read from %s last written to %s.pvscan[%d] PVID %s read from %s last written to %s.pvscan using %s for PVID %s in VG %sIgnoring pvscan --cache -aay because event_activation is disabled.Ignoring pvscan with --checkcomplete because event_activation is disabled.pvscan[%d] Ignoring pvscan with --checkcomplete because event_activation is disabled.Both --major and --minor required to identify devices.pvscan_cache_all: label scan allpvscan_cache_all: create list of devicesIgnoring pvscan --cache because event_activation is disabled.Skip pvscan for unknown autoactivation value.pvscan[%d] Skip pvscan for unknown autoactivation value.Skip pvscan for event with event_activation=0.pvscan[%d] Skip pvscan for event with event_activation=0.pvscan[%d] Failed to set up devices.WARNING: Failed to parse major:minor from %s, skipping.WARNING: Invalid major:minor %d:%d, skipping.No device set up for arg %s %u:%u.pvscan[%d] No device set up for arg %s %u:%u.pvscan_cache_args: filter devs nodataFinding symlink names from DEVLINKS for filter regex.Finding symlink names from /dev for filter regex.pvscan_cache_args: read and filter devspvscan[%d] %s cannot read label.pvscan[%d] %s not an lvm device.%s excluded by devices file (checking PVID).pvscan[%d] %s excluded by devices file (checking PVID).pvscan_cache_args: label scan devspvscan[%d] Failed to initialize processing handle.pvscan[%d] VG %s skip autoactivation.pvscan[%d] VG %s run autoactivation.VG %s not using quick activation.pvscan[%d] VG %s not using quick activation.activation for VG %s failed to lock VG.pvscan[%d] activation for VG %s failed to lock VG.activation for VG %s failed to find vgid.pvscan[%d] activation for VG %s failed to find vgid.activation for VG %s cannot read (%x).pvscan[%d] activation for VG %s cannot read (%x).activation for VG %s found different devices.pvscan[%d] activation for VG %s found different devices.Merge is in progress, reporting merged LV %s. and also its SubLV(s) with option '-a'WARNING: RaidLV %s needs to be refreshed! See character 'r' at position 9 in the RaidLV's attributes%s.Internal error: _report_all_in_vg: incorrect report type %u.Unknown report specifier in report option list: %s.Internal error: _set_report_prefix_and_name: no prefix found for report type 0x%x_set_report_prefix_and_name: dm_strncpy failedWARNING: devtypes currently ignores command line arguments.Internal error: _do_report: full report requested at incorrect levelInternal error: _do_report: unknown report type.Failed to compact report output.dm_report: Unrecognized field: %.*sFailed to compact given columns in report output.No physical volume label read from %s.set_pv_devices_online vg %s pv %s missing flag already setset_pv_devices_online vg %s pv %s no online fileWARNING: VG %s PV %s wrong vgname in online file %sVG %s PV %s no device found for online PV %d:%d %spvscan[%d] VG %s PV %s no device found for online PV %d:%d %sset_pv_devices_online vg %s pv %s is online %sInternal error: _report_all_in_lv: incorrect report type %u.Internal error: _report_all_in_pv: missing pv.Internal error: _report_all_in_pv: incorrect report type %u.Internal error: report_for_selection: incorrect report type %uInternal error: _report: unknown report type.Failed to create temporary mempool to process report options.Failed to set selection for log report.Failed to add main report section to report group.Failed to finalize main report section in report group.Radix character for current locale is '%s', json_std requires '.', overriding LC_NUMERIC locale to 'C'Supported report formats: %s, %s, %s.dm_report: incompatible locale used for DM_REPORT_GROUP_JSON_STD, radix character is '%s', expected '.'dm_report: dm_report_init_group: failed to allocate mem poolFailed to create report group.Failed to add log report to report group.Failed to set log report name for command context.dm_report: failed to allocate root report group itemdm_report: failed to allocate report group structureskip_dev_dir: Couldn't split up device name %s.See lvmlockd(8) for changing a clvm/clustered VG to a shared VG.WARNING: Skipping clustered VG %s.Skipping exported volume group %sCannot access VG %s with system ID %s with %slocal system ID%s%s.Skipping foreign volume group %sCannot process standalone physical volumesCannot process volume group %sCannot access clustered VG %s."%s": Invalid path for Logical Volume."%s": Invalid environment var LVM_VG_NAME set for Volume Group.Path required for Logical Volume "%s".Skipping activation of cache pool %s.Skipping deactivation of used cache pool %s.Refusing to activate merging volume %s while snapshot volume %s is still active.Cannot fully deactivate merging origin volume %s while snapshot volume %s is still active.Activating raid LV %s requires the removal of partial snapshot %s.Cannot activate LVs in VG %s while PVs appear on duplicate devices.Cannot activate uninitialized integrity LV %s from pvscan.Cannot activate uninitialized integrity LV %s without lock.Updating VG to complete initialization of integrity LV %s.Invalid LV type for clearing integrityWARNING: failed to clear integrity recalculate flag for %sSpawning background pvmove process for %s.Spawning background lvconvert process for %s.Failed to allocate poll identifier for lvconvert.Delaying merge for origin volume %s since snapshot volume %s is still active.Setting pool chunk size to %s.Please specify either metadata logical volume or its size.Negative stripesize is invalid.Number of stripes (%d) must be between %d and %d.Ignoring stripesize argument for %s devices.Ignoring stripesize argument with single stripe.Cache mode "writeback" is not compatible with cache policy "cleaner".pvscan autoactivating VG %s.%s: autoactivation failed.LVM_EVENT_ACTIVATION=0pvscan_recreate_hints_beginDEVLINKSDEVLINKS %spvscan[%d] %s excluded: %s.%s cannot read label.%s not an lvm device.No VGs to autoactivate.VG %s skip autoactivation.VG %s run autoactivation.autoactivate quickautoactivate slowreporter.c and its SubLV(s)successfailureInterrupted.Failed to find device "%s".dev_iter creation failed.report_optionsInvalid options string: %sUnknown --headings value.No log report stored.%s: unknown report format.report_groupFailed to create log report.unknown Skipping volume group %sAllocation of vg_name failed.Disabling%s pool zeroing.Setting pool discards to %s.may not be negativemay not be zeroUsing default stripesize %s.Invalid stripe size %s.use_Show help.reportUnknown VDO setting "%s".Failed to get tag.Failed to add tag %s to %s/%sProcessing each VGstrlist allocation failed.Skipping invalid tag: %sInvalid volume group name %s.No volume groups found.Processing VG %s %sSelection failed for VG %s.Running command for VG %s %sSelection failed for LV %s.Processing LV %s in VG %s.Processing each PVCannot use %s: %sProcessing PVs in VG %sSelection failed for PV %s.Skipping PV %s in VG %s.Processing PV %s in VG %s.Processing device %s.device_id_list alloc failed.Setting fua and nofua cannot both be set.Setting %s is not recognized. Only one unrecognized setting is allowed.WARNING: Unrecognized writecache setting "%s" may cause activation failure.Use unrecognized writecache setting? [y/n]: Aborting writecache conversion.WARNING: Using unrecognized writecache setting: %s = %s.Ignoring deprecated --vdosettings option "%s" and its value.Invalid argument for VDO setting "vdo_%s".Cannot change VDO setting "vdo_%s" in existing VDO pool.Invalid lvm.conf writecache setting value for %s.High watermark must be greater than low watermark.Invalid raid integrity journal size %d MiB (use 4-1024 MiB).Logical volume %s/%s does not support tagsFailed to add tag %s to physical volume %s.Failed to duplicate tag %s from %s/%sPlease use a single volume group name ("%s" or "%s").Logical volume name "%s" is invalid._init_processing_handle: failed to allocate memory for processing handle_init_selection_handle: failed to allocate memory for selection handleSetting LC_NUMERIC locale back after finished json_std report.Multiple VGs found with the same name: skipping %sUse --select vg_uuid= in place of the VG name.Use VG uuid in place of the VG name.Processing VG %s because of matching UUID %sVG name on command line not found in list of VGs: %sObtaining the complete list of VGs to processRepeat lock and read for local to shared vgIgnoring virtual origin logical volume %s.Adding %s to the list of LVs to be processed.Invalidating devs for any PVs on LVs.Internal error: Command %d:%s arg position %d does not permit an LV (%llx)WARNING: Command on LV %s does not accept LV type %s.WARNING: Command on LV %s does not accept LV type unknown (%d).Command not permitted on LV %s.WARNING: Command on LV %s has invalid use of option %s.WARNING: Command on LV %s requires option %s.WARNING: Command on LV %s uses options invalid with LV type %s.WARNING: Command on LV %s with invalid LV type %s.WARNING: Command on LV %s uses options that require LV types %s.WARNING: Command on LV %s does not accept LV type %s. Required LV types are %s.WARNING: Command on LV %s uses options that are invalid with LV properties: %s.WARNING: Command on LV %s is invalid on LV with properties: %s.WARNING: Command on LV %s uses options that require LV properties: %s.WARNING: Command on LV %s requires LV with properties: %s.Processing historical LV %s in VG %s.Failed to free lock for LV %s/%s in lvmlockd.Failed to find logical volume "%s/%s"Failed to allocate final LV list item.Processing lockd_sanlock_lv %s/%s.Tags cannot be used with this command.ignoring claim of PV %s by VG %s.Cannot use PV %s in exported VG %s.Cannot use PV %s in foreign VG %s.Cannot use PV %s in shared VG %s.device_list element allocation failedProcessing duplicate device %s.Internal error: No info for pvidFailed to find physical volume "%s".Processing devices that are not PVslabelsector must be less than %lu.metadataignore only applies to metadatacopies > 0.Physical volume data alignment may not be negative.Physical volume data alignment is too big.Physical volume data alignment offset may not be negative.Physical volume data alignment offset is too big.WARNING: Ignoring data alignment %s incompatible with restored pe_start value %s.Metadata size may not be negative.Bootloader area size may not be negative.Can't initialize PV '%s' without -ff.Can't initialize physical volume "%s" of volume group "%s" without -ffUnable to add physical volume '%s' to volume group '%s'Really INITIALIZE physical volume "%s" of volume group "%s" [y/n]? WARNING: Forcing physical volume creation on %s of volume group "%s"WARNING: Faking size of PV %s. Don't write outside real device.WARNING: %s: device size %s does not match requested size %s. Proceed? [y/n]: PV %s is used by VG %s so please use vgreduce first.(If you are certain you need pvremove, then confirm by using --force twice.)WARNING: PV %s is used by VG %s.Really WIPE LABELS from physical volume "%s" of volume group "%s" [y/n]? WARNING: prompt answer yes is overridden by prompt answer no.%s: physical volume not initialized.%s: physical volume label not removed.WARNING: Wiping physical volume label from %s of volume group "%s".Volume group allocation policy is already %svgchange_metadata_copies new %u vg_mda_copies %u D %uWARNING: Number of metadata copies for VG %s is already unmanaged.WARNING: Number of metadata copies for VG %s is already %u.Volume group "%s" is already resizeableVolume group "%s" is already not resizeableVolume group autoactivation is already %s.Error processing filename template %sVGs must be backed up into different files. Use %%s in filename for VG name.No backup taken: specify filename with -f to backup with missing PVs.Volume group "%s" successfully backed up.No backup taken: specify filename with -f to backup with unknown segments.Volume group name "%s" is invalid.Please specify a *single* volume group to restore.Internal error: VG name is not set.WARNING: Failed to check for active volumes in volume group "%s".WARNING: Found %u active volume(s) in volume group "%s".Restoring VG with active LVs, may cause mismatch with its metadata.Do you really want to proceed with restore of volume group "%s", while %u volume(s) are active? [y/n]: Unable to lock volume group %s.WARNING: Physical extent size cannot be larger than %s.WARNING: Physical extent size of VG %s is already %s.Failed to change physical extent size for VG %s.Volume group has active logical volumes.Failed to generate new random UUID for VG %s.Changing configuration profile for VG %s: %s -> %s.Ignoring invalid string in lock_start list.Ignoring empty string in config file.Cannot change system ID without the majority of PVs (found %d of %d).Volume Group system ID is already "%s".WARNING: Removing the system ID allows unsafe access from other hosts.Remove system ID %s from volume group %s? [y/n]: System ID of volume group %s not changed.Logical Volumes in VG %s must be deactivated before system ID can be changed.WARNING: Requested system ID %s does not match local system ID %s.WARNING: No local system ID is set.WARNING: Volume group %s might become inaccessible from this machine.Set foreign system ID %s on volume group %s? [y/n]: Volume group %s system ID not changed.Changing system ID for VG %s from "%s" to "%s".Volume group "%s" successfully changed.WARNING: New lock type %s matches the current lock type %s.Cannot change lock type directly from "%s" to "%s".First change lock type to "none", then to "%s".Changing VG %s lock type not allowed with active LVsFailed to initialize lock args for lock type %sFailed to allocate LV lock on diskCannot change to unknown lock type %sForcibly change VG lock type to %s? [y/n]: Using lock type requires lvmlockd.Not starting %s since it does not pass lock_start_listNot starting %s since it does not pass auto_lock_start_listVG %s stop failed: LVs must first be deactivatedlockd_stop_vg deactivate sanlock lvUsing lock start and lock stop requires lvmlockd.No global lock for lock start.Starting locking. VG can only be read until locks are ready.Starting locking. Waiting for sanlock may take a few seconds to 3 min...Starting locking. Waiting until locks are ready...Starting background polling for volume group "%s".Background polling started for %d logical volume(s) in volume group "%s"Internal error: lvmcache_get_bad_mdas no vginfo %sWARNING: not repairing bad metadata (0x%x) for mda%d on %sWARNING: repairing bad metadata (0x%x) in mda%d at %llu on %s.WARNING: failed to write VG %s metadata to bad mda%d at %llu on %s.WARNING: failed to precommit VG %s metadata to bad mda%d at %llu on %s.WARNING: failed to commit VG %s metadata to bad mda%d at %llu on %s.The volume group is missing %d physical volumes.Scanning and filtering device args (%u).Command requires all devices to be found.WARNING: Unknown block size for device %s.WARNING: Unknown logical_block_size for device %s.WARNING: Devices have inconsistent physical block sizes (%u and %u).See lvm.conf allow_mixed_block_sizes.Check pvremove arg %s no PVID foundCheck pvremove arg %s device is not a PV.Check pvremove arg %s found vg %s.Check pvremove arg %s found EXT_USED flag.Check pvremove arg %s is orphan.Check pvcreate arg %s no PVID foundCannot use device %s with duplicates.Failed to read lvm info for %s PVID %s.Check pvcreate arg %s found vg %s.Check pvcreate arg %s found EXT_USED flag.Check pvcreate arg %s is orphan.UUID %s already in use on "%s".Check pvremove arg %s device is a duplicate.Failed to reacquire global lock after prompt.Rescanning and filtering device args with exclusive openWiping signatures on new PV %s.Using existing orphan PVs in %s.Failed to create random uuid for %s.WARNING: %s: Overriding real size. You could lose data.%s: Pretending size is %lu sectors.%s: Size must exceed minimum of %lu sectors.Set up physical volume for "%s" with %lu available sectors.Format-specific initialisation of physical volume %s failed.Failed to add metadata area for new physical volume %sFailed to setup physical volume "%s".Failed to wipe existing label on %s.Writing physical volume data to disk "%s".Failed to write physical volume "%s".Physical volume "%s" successfully created.Failed to wipe existing label(s) on %s.Labels on physical volume "%s" successfully wiped.delete dev from initial duplicates %sdelete dev from unused duplicates %sDuplicate device name found on input: %s.Checking %s for pvremove %.32s.Checking %s for pvcreate %.32s.pv_list allocation in pv_create failedNeed one or more command options.Only one of --metadataprofile and --detachprofile permitted.Only one of -a and --refresh permitted.Only -a permitted with --ignorelockingfailure and --sysinit.Only -ay* allowed with --monitor or --poll.Only one of --poll and --sysinit permitted.MaxPhysicalVolumes may not be negative.Physical extent size may not be negative.Change clustered property of all volumes groups? [y/n]: Skip vgchange for unknown autoactivation value.Skip vgchange for event and event_activation=0.Failed early VG locking for autoactivation.Finding online devices to scanNo device found for quick mapping of online PV %u:%u %s PVID %s.Repeat dev cache scan to translate devnos.No device found for %u:%u PVID %s.label_scan_vg_online: read and filter devsMatch device_id %s %s to %s: matching PVIDIncomplete PV list from online files %d metadata %d.PVs online error%s%s, using all devices.PVs online not found for VG %s, using all devices.PVs online incomplete for VG %s, using all devices.Physical extent size must be smaller than %s.Max Logical Volumes may not be negative.Max Physical Volumes may not be negative.WARNING: VG with system ID %s might become inaccessible as local system ID is %sWARNING: A VG without a system ID allows unsafe access from other hosts.The --shared option requires lock type sanlock, dlm or idm.Failed to get result from lvmlockdFailed to find a running lock manager.Found multiple lock managers, select one with --lock-type.Failed to detect a running lock manager to select lock type.Using a shared lock type requires lvmlockd (lvm.conf use_lvmlockd.)Using a shared lock type requires lvmlockd.Option -j|--major may not be repeated.Options --major and --minor are incompatible with -Mn.Please specify minor number with --minor when using -My.Please specify major number with --major when using -My.WARNING: Ignoring supplied major number %d - kernel assigns major numbers dynamically. Using major number %d instead.Autoactivation is disabled for VG %s.Can't deactivate volume group "%s" with %d open logical volume(s)%d logical volume(s) in volume group "%s" already active%d existing logical volume(s) in volume group "%s" %smonitored%sctivated %d logical volumes in volume group %s.%d logical volume(s) in volume group "%s" now active%d logical volume(s) in volume group "%s" %smonitoredvgchange.cFailed to allocate filename.vgcfgbackup.cvgcfgrestore.cNo archives found in %s.Restore aborted.Restore failed.Restored volume group %s.(no profile)Unable to set system ID.VG lock type not changed.lockd stop VG %s lock_type %sstop_vgVG %s stop failed: %dFailed to write VG.vgck.cFailed to commit VG.No PV found on device %s.Can't get device size of %s.No devices to process.Failed to rescan devs exclCannot read orphans VG %s.alloc pvl failed.Using existing orphan PV %s.Creating a new PV on %s.Zeroing start of device %s.%s not wiped: aborting.%s: command failed for %s.strdup failed.Failed to find PV %sFound root dm_uuid %s%s/devices/auto-import-rootvg for VG No volume groups changed.Skipping device_id filteringrunning_lmlvmlockd found sanlocklvmlockd found dlmlvmlockd found idmlock_type %s is invalidSetting lock_type to %sDeaVG %s is incomplete.Found %s creating %s/run/lvm/lvm-devices-importfailed to create %sRefreshing volume group "%s"Physical extent size may not be negative.Please provide volume group name and physical volumesThe clustered option is deprecated, see --shared.Cannot create VG with lock_type %s without lvmlockd.lockd global create disabled %slockd global create lock_type %sGlobal lock failed: check that VG holding global lock exists and is started.Global lock failed: check that global lockspace is started.Global lock failed: lockspace is starting.VG create failed: lock manager %s is not supported by lvmlockd.A volume group called %s already exists.WARNING: Setting maxlogicalvolumes to %d (0 means unlimited)WARNING: Setting maxphysicalvolumes to %d (0 means unlimited)Volume group "%s" successfully created%s%sStarting locking. VG is read-only until locks are ready.Failed to allocate memory for system_id in vg_set_system_id.Global lock failed: start existing sanlock VGs to access global lock.(If all sanlock VGs are started, enable global lock with lvmlockctl.)WARNING: Partial LV %s needs to be repaired or removed. There are still partial LVs in VG %s.To remove them unconditionally use: vgreduce --removemissing --force.To remove them unconditionally from mirror LVs use: vgreduce --removemissing --mirrorsonly --force.WARNING: Proceeding to remove empty missing PVs.Volume Groups must always contain at least one PV.Removing PV with UUID %s from VG %s.LVs still present on PV with UUID %s: Can't remove from VG %s.%s:%s:%lu:-1:%u:%u:%u:-1:%u:%u:%u:%lu:%u:%u:%u:%u:%sFound %svolume group "%s" using metadata type %s"%s" %-9s [%-9s used / %s free]VG Access %s%s%s%sVG Status %s%sresizableOption -A is not allowed with volume group namesPlease supply volume groups or use --select for selection or use -a for all.No arguments permitted when using -a for all.Please supply volume groups or -S for selection or use -a for all.WARNING: Volume groups with missing PVs will be imported with --force.Please enter one or more volume group paths or use --select for selection.Volume group "%s" has active logical volumesLV %s/%s must be inactive on all hosts before vgexport.Volume group "%s" successfully exportedWARNING: PV %s not found in VG %sWARNING: PV %s was not missing in VG %sVolume group "%s" successfully extendedVolume group "%s" will be extended by %d new physical volumesPlease enter volume group name and physical volume(s)Volume group "%s" is not exportedVolume group "%s" is partially missingVolume group "%s" successfully importedChecking for volume group "%s"vgmerge not allowed for lock_type %sDevices file not enabled, ignoring importdevices.Devices file does not exist, ignoring importdevices.Failed to find PVID for device %s.Devices must be from the same VG.Temporary vg name %s1 is too long.Internal error: Old vg name %s is too long.Failed to generated temporary vg name, %s%u is too long.Can't get lock for new VG name %sFailed to read VG %s from devices being imported.Error reading VG %s from devices being imported.VG %s is exported, use the --import option.VG %s is partial, it must be complete.Device %s has active LVs, deactivate first.PV with UUID %s is part of VG %s, but is not included in the devices to import.All PVs in the VG must be imported together.Device %s was not found in VG %s.The devices to import must match the devices in the VG.Failed to add device id for %s.Failed to update VG on devices being imported.Not importing devices for VG %s with missing PV %s.Failed to write device ids in VG metadata.Root VG auto import is not enabled.Failed to set up devices file.Failed to create devices file.Failed to write the devices file.Added %u devices to devices file for root VG %s.Added %u devices to devices file.Please enter 2 or more volume groups to mergeDuplicate volume group name "%s"Removing pool metadata spare %s.Marking PV %s as moved to VG %sFailed to generate new random LVID for %sWriting out updated volume groupVolume group "%s" successfully merged into "%s"Physical volume "%s" still in useCan't remove final physical volume "%s" from volume group "%s"Cannot remove final metadata area on "%s" from "%s"Removal of physical volume "%s" from "%s" failedFailed to clear metadata from physical volume "%s" after removal from "%s"Removed "%s" from volume group "%s"Removing "%s" from volume group "%s"Internal error: %s is not a partial LV.Attempting to remove missing devices from %s LV, %s.Partial raid image %s iorig %sPartial raid image %s imeta %sPartial raid image %s rmeta %sRemoving integrity layer from partial raid image %s %s %sFound %d partial integrity images to remove from %sFailed to remove integrity from partial raid LV %s.Replacing %s segments with error target.Failed to replace %s's extents with error target.Non-mirror-image LV %s found: can't remove.WARNING: Removing partial LV %s.Failed to write out a consistent VG for %sPlease give volume group name and physical volume paths.Please give volume group name.--mirrorsonly requires --removemissing.Please enter physical volume paths or option -a.Option -a and physical volume paths mutually exclusive.Please only specify the volume group.Volume group "%s" is already consistent.Wrote out consistent volume group %s.WARNING: %d physical volumes are currently missing from the system.Do you really want to remove volume group "%s" containing %u logical volumes? [y/n]: Volume group "%s" not found, is inconsistent or has PVs missing.Consider vgreduce --removemissing if metadata is inconsistent.Volume group "%s" still contains %u logical volume(s)New VG name must differ from the old VG name.New VG name "%s" already existsNew VG name "%s" matches the UUID of existing VG %sLVs must be inactive before vgrename.Cannot rename VG %s with active LVslockd_rename_vg_before lvmlockd result %dlockd_rename_vg_before deactivate sanlock lvRenaming path is too long %s/%s %s/%slockd_rename_vg_final lvmlockd result %dFailed to start VG %s lockspace.Volume group "%s" successfully renamed to "%s"Failed to restart VG %s lockspace.Old and new volume group names need specifyingNew volume group path exceeds maximum length of %d!Old and new volume group names must differCannot notify dbus: notify_dbus is disabled in lvm config.WARNING: Ignoring vgscan --cache command because lvmetad is no longer used.Logical volume %s (part of %s) must be inactive.Logical volume %s must be inactive.Can't split LV %s between two Volume Groupsvgdisplay.c with system ID vgcreate.cEnabling sanlock global lockFailed to get tagFailed to start lockingvgreduce.cr/wexported vgscan.cexported/--- Volume group ---VG Name %sSystem ID %sFormat %sMetadata Areas %dMetadata Sequence No %dClustered yesShared %sMAX LV %uCur LV %uOpen LV %uMax PV %uCur PV %uAct PV %uVG Size %sAlloc PE / Size %u / %sFree PE / Size %u / %sVG UUID %s--- Physical volumes ---vgexport.cvgimport.cvgremove.cvgextend.cNo PV has been restored.Volume group %s not changedvgmerge.cvgimportclone.cFailed to find device %s.scan new devsDevice %s is excluded: %s.No VG found on devices.get other devicesscan other devicesBase vg name %s is too long.%s1%s%uUsing new VG name %s.import vg on new devicesCan't get lock for VG name %sVG is missing a device.vgimportdevices.cFailed to unlink %sFailed to find root VG.No devices to add.vgsplit.cChanged LVID for %s to %sRefresh failed for %s.vgmknodes.cNo device found for PV.vgreduce_single VG %s PV %sVolume group "%s" not removedvgrename.cCan't get lock for %srename_vg_beforeRenaming "%s" to "%s"Test mode: Skipping rename.Renaming "%s" to "%s" failedrename_vg_finalExistingNewInvalid vg name %s.Failed to create new VG %s.Failed to read VG %s.Physical Volume %s not found\x5cx#+-.:=@_%2x%128s/proc/devices%u %255s %s: No entry for %s found%s: Wrong inode typeDM_DEBUG_WITH_LINE_NUMBERS%s:%d /run/lvm/lvmlockd.socketHandle initialisation failed.lvmcmdlib.cCmdline copy failed.No command supplied_memlock_inc_memlock_dec_dmeventd_thin_command_dmeventd_vdo_commandTZ:/etc/localtimeCouldn't copy command line.Version: %sParsing: %sCorrect command syntax is:Command requires options: %sMESSAGE=lvm command %sCODE_LINE=907PRIORITY=%iLVM_CMD_ID=%sLVM_CMD_NAME=%sIgnore opt %dProcessing command: %sCommand pid: %dSystem ID: %sO_DIRECT will be usedmpath pool creation failed.LVM_LVMLOCKD_SOCKETCompleted: %s/run/lvmlockd.pidconfig-util.c%.*s= %ld %.*s= "%s" %b%.*s%s ## daemon-client.crequestFailed to duplicate node key._control_fdcontrol/proc/miscCreating device %s (%u, %u)mknod) UUID DM_DEVICE_RESUMEDM_DEVICE_REMOVEDM_DEVICE_RENAMEkey setenablechecks ima_measurement securedata deferredremove retryremove skiplockfs readonly noflush noopencount reload %u:%u diff type %s %sreload params1 %sreload params2 %sget_timestampclock_gettime(unknown version)DM_DEFAULT_NAME_MANGLING_MODEExisting VG, new VG and either physical volumes or logical volume required.A logical volume name cannot be given with physical volumes.Failed to lock new VG name %s.Volume group "%s" exists, but new VG option specifiedLogical volume %s not in volume group %sCannot move PV(s) from non resize volume group %s.Cannot move PV(s) to non resize volume group %s.Can't split mirror %s between two Volume GroupsCan't split external origin %s and pool %s between two Volume Groups.Can't split pool data and metadata %s between two Volume Groups.Cannot split cache origin %s and its cache pool data %s into separate VGs.Cannot split cache origin %s and its cache pool metadata %s into separate VGs.Cannot split cache pool data %s and its metadata %s into separate VGs.Cannot split cache origin %s and its cachevol %s into separate VGs.Can't split snapshot %s between two Volume GroupsCannot split: Nowhere to store metadata for new Volume GroupWriting out updated volume groups%s volume group "%s" successfully split from "%s"Can't split Logical Volume %s between two Volume GroupsThe %s "%s" seems to be mangled more than once. This is not allowed in auto mode.The %s "%s" should be mangled but it contains blacklisted characters._do_dm_ioctl_unmangle_string: failed to unmangle %s "%s"Hex encoding mismatch detected in %s "%s" while trying to unmangle it.%s: Wrong device number: (%u, %u) instead of (%u, %u)Too many arguments. Limit is %d.Internal error: _memlock_inc_daemon used in critical section.memlock_count_daemon inc to %dInternal error: _memlock_count_daemon has dropped below 0.memlock_count_daemon dec to %dError during parsing of command line.No command with matching syntax recognised. Run '%s --help' for more information.Nearest similar command has syntax:Command does not accept option: %s%s%s.Command does not accept argument: %s.Command does not accept option combination: %s with %sCommand does not accept options: %sRecognised command %s (id %d / enum %d).MESSAGE_ID=3ca432788c374e4ba684b834188eca36Internal error: config_file_changed: expected file config source, found %s config source.Config file %s has disappeared!Failed to reload configuration filesConfiguration file %s is not a regular fileDetected config file change to %sUpdated config file invalid. Aborting.DEGRADED MODE. Incomplete RAID LVs will be processed.--ignoremonitoring or --sysinit option not allowed with --monitor option.%s: Command not permitted while global/metadata_read_only is set.WARNING: see lvmlockd(8) for information on using cluster/clvm VGs.WARNING: locking_type (%d) is deprecated, using --nolocking.WARNING: locking_type (%d) is deprecated, using --sysinit --readonly.WARNING: locking_type (%d) is deprecated, using file locking.LVM_SUPPRESS_LOCKING_FAILURE_MESSAGESFile locking settings: readonly:%d sysinit:%d ignorelockingfailure:%d global/metadata_read_only:%d global/wait_for_locks:%d.Path for locking_dir %s is invalid.File locking initialisation failed.WARNING: Ignoring unknown md_component_checks setting, using auto.Using md_component_checks %s use_full_md_check %dmpath hash table creation failed.multipath wwids file disabled.Ignore lvmlockd for pvscan cache.Ignore lvmlockd for lvmdevices.WARNING: lvmlockd process is not running.Should not connect to lvmlockd with use_lvmlockd=0.lvmlockd is already connected.Successfully connected to lvmlockd on fd %d.WARNING: lvmlockd connect failed.Run `%s --help' for more information.Failed to strdup command basename.Internal error: Bad format string at '%s'Internal error: Do not use %%d and use correct 64bit formInternal error: Daemon send: socket fd cannot be negative %dInternal error: Daemon send: no memory availableInternal error: Bad format string '%s'Target type name %s is too long.create_target: malloc(%zu) failedcreate_target: strdup(params) failedcreate_target: strdup(type) failedCould not determine kernel version used.Failed to set up list of device-mapper major numbersFailure to communicate with kernel device-mapper driver.Check that device-mapper is available in the kernel.Internal error: unknown device-mapper task %dFailed to revert device creation.Failed to create device-mapper task structreload %u:%u diff start %llu %llu type %s %sreload %u:%u diff length %llu %llu type %s %sreload %u:%u diff params ignore for type %sreload %u:%u diff params for type %sInternal error: Performing unsafe table load while %d device(s) are known to be suspended: %s%s%s %s%.0d%s%.0d%s%sInternal error: dm '%s' ioctl should not define parameters.targets and message are incompatibletargets and rename are incompatibletargets and geometry are incompatiblemessage and rename are incompatiblegeometry and rename are incompatiblegeometry and message are incompatiblemessage is required with sectorOverriding major number of %d with %u for persistent device.Missing major number for persistent device.device (%u:%u) is %s for compatibility with old kernelUnable to find name for device (%u:%u)No flush flag unsupported by kernel. Buffers will be flushed.Secure data flag unsupported by kernel. Buffers will not be wiped after use.WARNING: Inactive table query unsupported by kernel. It will use live table.Setting UUID unsupported by kernel. Aborting operation.IMA measurement unsupported by kernel. Aborting operation.Ran out of memory building ioctl parameterCouldn't create ioctl argument.Cookie value is not set while trying to call %s ioctl. Please, consider using libdevmapper's udev synchronization interface or disable it explicitly by calling dm_udev_set_sync_support(0).Switching off device-mapper and all subsystem related udev rules. Falling back to libdevmapper node creation.dm %s %s%s %s%s%s %s%.0d%s%.0d%s%s[ %s%s%s%s%s%s%s%s%s%s] %.0lu %s [%u] (*%u)device_mapper/libdm-timestamp.cdevice-mapper: %s ioctl on %s %s%s%.0d%s%.0d%s%s failed: %sUevent not generated! Calling udev_complete internally to avoid process lock-up.WARNING: libdevmapper buffer too small for dataFailed to get device-mapper versionIncompatible libdevmapper %s%s and kernel driver %s.Attempting to suspend a device that is already suspended (%u:%u)Internal error: Attempt to suspend device %s%s%s%.0d%s%.0d%s%sthat uses already-suspended device (%u:%u)dm_task_set_message: strdup failed&%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%'/'''['P'E':'q'|'f'''&|ǃ||k|||Y| ||create8reload 8remove8remove_all8suspend8resume8info8deps 8rename8version8status 8table 8waitevent8names8clear 8mknodes8versions 8message8setgeometry8armpoll8$target-version8)log_commandAttempted to decrement suspended device counter below zero.Suspended device counter reduced to %dParse error at byte %td (line %d): expected a string token.Device %s (%u:%u) appears to be mounted on %s.Failed to clone string config value.dm_pool_grow_object failed for config linevsnprintf failed for config linedm_vasprintf failed for config line_write_value: Unknown value type: %ddm_pool_begin_object failed for config lineWARNING: Invalid creation_time found in metadata (repaired with next metadata update).Parse error at byte %td (line %d): unexpected tokenParse error at byte %td (line %d): expected a valueFailed to allocate type value._create_dm_tree_node alloc failed.dtree node hash insertion faileddtree uuid hash insertion faileddm_task_create: malloc(%zu) failed%sdev/block/%u:%u/bdi/read_ahead_kbEmpty device name passed to BLKRAGET%s: %s NODE_ADD (%u,%u) %u:%u 0%o%s%s%s: %s NODE_READ_AHEAD %u (flags=%u)%s%s%s: retaining kernel read ahead of %u (requested %u)%s (%d:%d): Setting read ahead to %uKernel not configured for semaphores (System V IPC). Not using udev synchronization code.Udev is not running. Not using udev synchronization code.Could not get udev state. Assuming udev is not running.Udev is running and DM_DISABLE_UDEV environment variable is set. Bypassing udev, device-mapper library will manage device nodes in device directory.Could not continue to access notification semaphore identified by cookie value %u (0x%x). Incorrect cookie prefix.Could not find notification semaphore identified by cookie value %u (0x%x)No permission to access notification semaphore identified by cookie value %u (0x%x)Failed to access notification semaphore identified by cookie value %u (0x%x): %scookie dec: semid %d: sem_ctl GETVAL failed for cookie 0x%x: %scookie dec: semid %d: semop failed for cookie 0x%x: incorrect semaphore statecookie dec: semid %d: semop failed for cookie 0x%x: %sUdev cookie 0x%x (semid %d) decremented.Udev cookie 0x%x (semid %d) decremented to %dCould not cleanup notification semaphore identified by cookie value %u (0x%x): %sUdev cookie 0x%x (semid %d) destroyedFailed to open /dev/urandom to create random cookie valueFailed to initialize notification cookieNot enough memory to create notification semaphoreLimit for the maximum number of semaphores reached. You can check and set the limits in /proc/sys/kernel/sem.Failed to create notification semaphore: %sUdev cookie 0x%x (semid %d) createdcookie create: semid %d: semctl failed: %scookie create: semid %d: sem_ctl GETVAL failed for cookie 0x%x: %sUdev cookie 0x%x (semid %d) incremented to %dcookie inc: semid %d: semop failed for cookie 0x%x: %sCould not set notification semaphore identified by cookie value %u (0x%x)cookie inc: semid %d: sem_ctl GETVAL failed for cookie 0x%x: %sUdev cookie 0x%x (semid %d) incremented.Udev cookie 0x%x (semid %d) assigned to %s task(%d) with flags%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s (0x%x)Deactivation dm_task creation failed for %sThe %s "%s" contains mixed mangled and unmangled characters or it's already mangled improperly.Mangled form of the %s too long for "%s".Failed to mangle device name "%s".Device name mangled [%s]: %s --> %s_dm_task_set_name: strdup(%s) failedName "%s" invalid. It contains "/".Couldn't create /dev path for %sFailed to parse mountinfo line.Mount info task creation failed.Replacing mountinfo device (%u:%u) with matching DM device %s (%u:%u).WARNING: sysfs_path dm_snprintf failed.Failed to mangle device uuid "%s".Device uuid mangled [%s]: %s --> %sdm_task_set_uuid: strdup(%s) failedFailed to allocate config pool.Failed to allocate config tree.WARNING: Ignoring duplicate config node: %s (seeking %s)Parse error at byte %td (line %d): empty section identifierWARNING: Ignoring duplicate config value: %sCannot clone NULL config node.dtree uuid hash creation failedMatched uuid %s %s in deptree.Matched uuid %s %s (missing suffix -%s) in deptree.Matched uuid %s %s (missing prefix) in deptree.Not matched uuid %s in deptree.Cannot add device without name and uuid._node_clear_table failed: missing nameFailed to obtain dependencies for %s before clearing table.Clearing inactive table %s (%u:%u)Table clear dm_task creation failed for %s_node_clear_table failed: info missing after running task for %sFailed to deactivate no-longer-used device %s (%u:%u)Suspend dm_task creation failed for %s.Failed to set device name for %s resumption.Suspend dm_task creation failed for %sSuspended device counter increased to %dExpected thin-pool target for %s and got %s.Found transaction id %lu for thin pool %s with status line: %s.Failed to process message "%s".Node %s must have only one segment.Cannot use same device id for origin and its snapshot.New transaction id must be sequential.Current transaction id is different from thin pool.Failed to allocate thin message.dm_tree_node_add_target_area called without deviceDevice %s is not a block device.Thin pool %s transaction_id matches %lu, skipping messages.Thin pool %s transaction_id is %lu, while expected %lu.Cannot send messages to thin pool %s%s%s%s.Thin pool %s already contain thin device with device_id %u.Manual intervention may be required to remove device dev_id=%u in thin pool metadata.Optionally new thin volume with device_id=%u can be manually added into a volume group.WARNING: When uncertain how to do this, contact support!Thin pool %s transaction_id is %lu and does not match expected %lu.Sent messages to thin-pool %s and skipping suspend of its children.Unable to deactivate open %s (%u:%u).Node %s %d:%d has open_count %dUnable to deactivate %s (%u:%u).Failed to duplicate token.Failed to clone config value.%f0%lo%s}[%s,%sFailed to read int token.Failed to read float token.dtree link allocation failedname pool_strdup failedFailed to build sysfs_path.%s (%d:%d): read ahead is %uBLKRAGET%s: read ahead is %u [trust_udev] [verify_udev]%s: %s NODE_DEL%s%s%s: %s NODE_RENAME to %s%s%sProcessingFailed to build size in kB.BLKRASETSkipping SUBSYSTEM_7 SUBSYSTEM_6 SUBSYSTEM_5 SUBSYSTEM_4 SUBSYSTEM_3 SUBSYSTEM_2 SUBSYSTEM_1 SUBSYSTEM_0 PRIMARY_SOURCE DISABLE_LIBRARY_FALLBACK LOW_PRIORITY DISABLE_OTHER_RULES DISABLE_DISK_RULES DISABLE_SUBSYSTEM_RULES DISABLE_DM_RULESCREATERELOADREMOVE_ALLINFODEPSWAITEVENTLISTCLEARMKNODESLIST_VERSIONSTARGET_MSGSET_GEOMETRYRemoving %s (%u:%u)\x%02xName "%s" too long.Couldn't create path for %sDevice %s not found%s/../%s%*u %*u %u:%u %4096s %4096s%sfs%sfs/%s/%sconfig_outputFailed to allocate valuetruefalseFailed to clone config node.dtree hash creation failedFailed to allocate dtree.Resuming %s (%u:%u). with device flushSuspending %s (%u:%u)%s%s with filesystem syncno targetNode %s is missing a segment.Dropping callback for %s.Reverting %s.Unable to deactivate %s.Node %s has segment type %s.Unsupported message type %d.Couldn't find area uuid %s. in failed state which needs check first with read only metadataUUID "%s" does not match.create_snap %u %ucreate_thin %udelete %uset_transaction_id %lu %lureserve_metadata_snaprelease_metadata_snapUnable to suspend %s (%u:%u)is used by another devicecontains a filesystem in useDevice %s (%u:%u) %s.qvvvvތvvv֋&֋Dv֋֋֋֋֋֋֋֋֋֋vvvMvvvvvvvvvvvvvvvvvvvvvvvvvvvvvYvevvvvvvvvvvvvvvvvvvvvvvvvvvvvvvrdp|(4@LX<t/proc/self/mountinfodevice_mapper/libdm-file.cSpecialstring listunselectable %s Fields%*.*s %sall%-*s - %sAll fields in this section. %-*s - %s%s%s%s%stype-specificfield-specificreport selection regex\=~All fields must match&&Selection operandsReserved values %-*s - %s [%s]Selection operators------------------- Comparison operators: %6s - %s %4s - %s": [%-*.*sCreating directory "%s"Unsupported selection typeselectedUnrecognised field: %.*sExpecting field nameMissing value after operatorSpecified month out of range.Specified day out of range.Incorrect date format.Specified hours out of range.Incorrect time format.report selectionExpecting logical operatorspecial_dm_report_init: malloc failed||At least one field must matchLogical negationLeft parenthesisRight parenthesisList startList endList subset startList subset end!~!=>=<=sinceuntilExisting path %s is not a directory.-------------------------------------------------------------------------------Internal error: Field type undefined.dm_report: field not match: %sdm_report: struct field_properties allocation failed_add_item_to_string_list: memory allocation failed for string list itemInternal error: %s reserved value handler for field %s has missing implementation of DM_REPORT_RESERVED_PARSE_FUZZY_NAME actionError occurred while processing %s reserved value handler for field %sFailed to create report selection regex memory pool.dm_report: Unable to extend output lineMatching regular expression. [regex] field - Reporting field. number - Non-negative integer value. size - Floating point value with units, 'm' unit used by default if not specified. percent - Non-negative integer with or without %% suffix. string - Characters quoted by ' or " or unquoted. string list - Strings enclosed by [ ] or { } and elements delimited by either "all items must match" or "at least one item must match" operator. regular expression - Characters quoted by ' or " or unquoted._display_selection_help: dm_pool_begin_object failed Logical and grouping operators:dm_report: Could not allocate memory for output line buffer.dm_report: left-aligned snprintf() faileddm_report: right-aligned snprintf() failedFailed to duplicate directory name.%s failed to allocate sort value structure%s failed to allocate report string structure%s failed to allocate temporary array for processing%s failed to allocate array of items inside sort value structuredm_report_field_percent: dm_pool_alloc failed for sort_value.dm_report_field_percent: dm_pool_alloc failed for percent report string.dm_report_field_percent: percentage too large._compare_selection_field: field without value :%dInternal error: _compare_selection_field: regex: incorrect type %u for field %sInternal error: _cmp_field_int: unsupported number comparison type for field %sInternal error: _cmp_field_double: unsupported number comparison type for selection field %sInternal error: _cmp_field_string: unsupported string comparison type for selection field %sInternal error: _cmp_field_time: unsupported time comparison type for field %sInternal error: _compare_selection_field: incorrect type %u for field %sdm_report_enable_compact_output: dm report handler is NULL.dm_report: dm_report_output: interleaved reports detected for JSON outputdm_report: dm_report_output: unfinished JSON output detecteddm_report: sort array allocation faileddm_report: Unable to allocate output linedm_report: Failed to extend row for field namedm_report: Failed to extend row with separatordm_report: Failed to terminate rowdm_report: dm_pool_begin_object failed for headingsdm_report: Could not allocate memory for heading buffer.dm_report: snprintf heading faileddm_report: Failed to generate report headings for printingdm_report: Unable to terminate output lineInternal error: _do_report_object: dm_report handler is NULL.Internal error: _do_report_object: output not requested and selected output variable is NULL too._do_report_object: no data assigned to field %s_do_report_object: report function failed for field %s_do_report_object: struct dm_report_field allocation failed_do_report_object: row sort value structure allocation failed_do_report_object: struct row allocation failedUnrecognised selection field: %sSelection field is uncomparable: %s.Unrecognised comparison operator: %sOperator can be used only with string or string list fields: %sOperator can be used only with number, size, time or percent fields: %sOperator can be used only with time fields: %sFailed to parse regex value for selection field %s.Failed to parse string value for selection field %s.Invalid operator in selection list.List ended with incorrect character, expecting '%s'.Only one type of logical operator allowed in selection list at a time.Internal error: _tok_value_string_list: list has no items_tok_value_string_list: memory allocation failed for sort arrayFailed to parse string list value for selection field %s.Failed to parse numeric value for selection field %s.Found percent value but %s value expected for selection field %s.Found size unit specifier but %s value expected for selection field %s.Specified minutes out of range.Specified seconds out of range.Full date specification needed.Failed to parse time value for selection field %s.Internal error: _tok_value: Forbidden NULL custom parameter detected.Unable to create selection with field '%s' which is not included in current report.dm_report: incompatible comparison type for selection field %sInternal error: %s reserved value handler for field %s has missingimplementation of DM_REPORT_RESERVED_GET_DYNAMIC_VALUE actiondm_report: could not get reserved value while processing selection field %sdm_report: malloc failed to store regex value for selection field %sdm_report: failed to create regex matcher for selection field %sdm_report: malloc failed for regex array for selection field %sInternal error: _create_field_selection: regex: incorrect type %u for field %sString value %s found in selection is reserved.Numeric value %lu found in selection is reserved.Size value %f found in selection is reserved.Percent value %s found in selection is reserved.String list value found in selection is reserved.Time value found in selection is reserved.Internal error: _create_field_selection: incorrect type %u for field %sdm_report: struct field_selection_value allocation failed for selection field %sInternal error: _create_field_selection: Forbidden NULL custom detected.dm_report: struct selection_node allocation faileddm_report: dm_pool_strndup for value of selection field %sdm_report: struct field_selection allocation failed for selection field %sRegular expression expected for selection field %s_tok_value_string_list: memory allocation failed for selection list._tok_value_time: dm_pool_strndup failedtok_value_time: dm_pool_strndup failedMissing list end for selection field %sFailed to allocate report selection structure.dm_report: Missing sort field namedm_report: Ignoring duplicate sort field: %s.dm_report: Unrecognised field: %.*sInternal error: dm_report_init: definition of report types given contains reserved identifierdm_report_init: allocation of memory pool failed_canonicalize_field_ids: dm_pool_alloc failedInternal error: _check_reserved_values_supported: global reserved value for type 0x%x not supportedInternal error: _check_reserved_values_supported: field-specific reserved value of type 0x%x for field %s not supportedInternal error: dm_report_init_with_selection: trying to register unsupported reserved value type, skipping report selection_canonicalize_field_dup: dm_pool_alloc failed.dm_report: unable to add more than one report to current report groupdm_report: can't use unnamed object at top level of JSON outputdm_report: failed to duplicate json item namedm_report: dm_report_group_push: group item allocation faileddm_report: dm_report_group_pop: group has no itemsSet if item passes selection criteria.Not matching regular expression. [regex]Equal to. [number, size, percent, string, string list, time]Not equal to. [number, size, percent, string, string_list, time]Greater than or equal to. [number, size, percent, time]Greater than. [number, size, percent, time]Less than or equal to. [number, size, percent, time]Less than. [number, size, percent, time]Since specified time (same as '>='). [time]After specified time (same as '>'). [time]Until specified time (same as '<='). [time]Before specified time (same as '<'). [time]rkvvzvxxjkFailed to parse string list value for selection field %s.Field selection value %s out of supported range for field %s.Use 'help' for selection to get more help.Selection syntax error at '%s'.Syntax error: right parenthesis expected at '%s'Syntax error: left parenthesis expected at '%s'_display_selection_help: dm_pool_grow_object failed_report_field_string_list: <`?Y@.AWARNING: Unknown mirror health status char: %cOut of memory. Requested %zu bytes.(rx->type != OR) || (rx->left && rx->right)Failed to parse invalid thin params.Failed to parse thin pool params: %s.build_dm_name: Allocation failed for %zu for %s %s %s.no memory for size display bufferInternal error: Inconsistent units: %c and %c.device_mapper/regex/parse_rx.cInternal error: pool_free asked to free pointer not in poolFailed to parse invalid snapshot params.Failed to parse snapshot params: %s.Failed to allocate snapshot status structure. <#devices> and and Failed to parse %sraid params: %s %u %lu/%lu %u %lu/%lu %lu %lu %lu %lu %lu %lu %lu %dFailed to parse cache params: %sFailed to allocate thin_pool status structure.Failed to parse thin params: %s.Failed to allocate thin status structure.Internal error: More than 8 reported in mirror status.Allocation of log type string failed.Failed to parse mirror status %s.Failed to alloc mem pool to parse mirror status.missing ')' in regular expressiondevice_mapper/raid/raid_parser.cFailed to allocate RAID superblock bufferFailed to open RAID metadata volumeFailed to read RAID metadata volumeFailed to seek RAID metadata volumeFailed to clear RAID metadata volumeRegex charset allocation failedInternal error: Unknown calc node typedevice_mapper/vdo/vdo_reader.cFailed to open VDO backend %s.Found mismatching VDO magic header in %s.Expected geometry VDO block instead of block %u.Unsupported VDO version %u.%u.File/Device is shorter and can't provide requested VDO volume region at %lu > %lu.Unknown VDO component version %u.VDO metadata has mismatching VDO nonces %lu != %lu.VDO minimum io size %u is unsupported [512, 4096].device_mapper/vdo/vdo_target.cVDO block map cache size %u MiB is out of range [%u..%u].VDO block map era length %u is out of range [%u..%u].VDO index memory size %u MiB is out of range [%u..%u].VDO slab size %u MiB is out of range [%u..%u].VDO max discard %u is out of range [%u..%u].VDO ack threads %u is out of range [0..%u].VDO bio threads %u is out of range [%u..%u].VDO bio rotation %u is out of range [%u..%u].VDO cpu threads %u is out of range [%u..%u].VDO hash zone threads %u is out of range [0..%u].VDO logical threads %u is out of range [0..%u].VDO physical threads %u is out of range [0..%u].Internal error: VDO write policy %u is unknown.Value of vdo_hash_zone_threads(%u), vdo_logical_threads(%u), vdo_physical_threads(%u) must be all zero or all non-zero.VDO logical size is larger than limit %lu TiB by %lu KiB.Failed to allocate memory for hash.Failed to allocate slots for hash.Couldn't create memory pool %s (size %zu)./base/data-struct/radix-tree-adaptive.cFailed to allocate command contextFailed to allocate line buffer.LVM_SYSTEM_DIR environment variable is too long.Failed to create LVM2 system dir for metadata backups, config files and internal cache.Set environment variable LVM_SYSTEM_DIR to alternative location or empty string.Library memory pool creation failedCommand memory pool creation failedInternal error: Failed to parse command definitions.Volume group %s has active volume: %s.device_mapper/mm/pool-fast.ccouldn't get token for '%s'couldn't parse '%s'device_mapper/regex/matcher.cErrorFail%lu %lu/%lu %lu/%lu%nout_of_data_spacero Failed to duplicate lvm name.device_mapper/libdm-string.cMissing lvm name for split.0%s%s%.*f%s%lu/%lu %luInvalidMerge failedOverflow<#devs> %lu/%luwritethrough writeback passthrough metadata2 no_discard_passdown Unknown feature in status: %s ro needs_checkAllocation of devs failed.%u:%u %nAllocation of logs failed.userspaceBadly formed 'or' expressionNo RAID signature on %s.(.*(%s)%c)Parse error in regexCouldn't parse regexdevice_mapper/regex/ttree.cRegex optimisation errorout of memoryoperating modeindex statecompression stateused blockstotal blockstoo many tokenscouldn't get token for devicefstatbase/data-struct/hash.chead1->nn4 != NULLn16 != NULLn48 != NULLsetlocale failedsetvbuf/etc/lvmLVM_RUN_BY_DMEVENTDpending_deleteNo devices found.PPPPPPPPPPPPPPPΉ܉,tL""l"\""L"D""4"\ܔ"""""""""""""L""̔"""""""\|h <=16EiB).Can't parse size argument.is only available with poolsis unsupported with cacheis supported only with cacheis unsupported with snapshotsis unsupported with mirrorsis unsupported with raidsis supported only with raidsis unsupported with thinsis supported only with thinsis unsupported with VDOsSetting logging type to %sUsing 2 stripes for %s.Using 3 stripes for %s.Setting chunksize to %s.No conversion is requested.position%s device number not changed.Cannot deactivate %s.%s: reactivation failed.WARNING: Path %s/%s is too long.checking all pvid files using lookup file for %sWARNING: Failed to strdup vgname.pvscan[%d] ignore %s with no lvm info.pvscan[%d] failed to create format instance.pvscan[%d] PV %s has no VG metadata.pvscan[%d] PV %s not found in VG %s.pvscan[%d] PV %s missing device size.pvscan[%d] ignore md component %s.pvscan[%d] PV %s ignore shared VG.pvscan[%d] PV %s ignore foreign VG.pvscan[%d] PV %s ignore exported VG.PV %s failed to create online file.pvscan[%d] PV %s failed to create online file.checking all pvid files from vg %srechecking all pvid files from vg %spvscan[%d] VG %s complete after recheck.checking all pvid files from lookup filepvscan[%d] PV %s online, VG unknown.PV %s online, VG %s incomplete (need %d).pvscan[%d] PV %s online, VG %s incomplete (need %d).PV %s online, VG %s is complete.pvscan[%d] PV %s online, VG %s is complete.Cannot list LVs from device without metadata.pvscan[%d] Cannot list LVs from device without metadata.pvscan[%d] Failed to find LVs using %s.pvscan[%d] Failed to check partial lvs.Ignore PV %s with VG system id %s with our system id %sCHECK: failed to read label_header at %lluCHECK: label_header.id expected %sCHECK: label_header.sector expected %dCHECK: label_header.crc expected 0x%xCHECK: label_header.offset expected 32CHECK: label_header.type expected %sCHECK: pv_header.pv_uuid invalid formatpv_header.disk_locn[%d] at %llu # location of data areapv_header.disk_locn[%d].offset %llupv_header.disk_locn[%d].size %llupv_header.disk_locn[%d] at %llu # location list endCHECK: problem with pv_header.disk_locn[%d] offset calculationpv_header.disk_locn[%d] at %llu # location of metadata areaWARNING: pv_header.disk_locn[%d].offset %llu is unexpected # for first mdapv_header_extension.version %upv_header_extension.disk_locn[%d] at %llu # bootloader areapv_header_extension.disk_locn[%d].offset %llupv_header_extension.disk_locn[%d].size %llupv_header_extension.disk_locn[%d] at %llu # location list endCHECK: problem with pv_header_extension offset calculationMetadata input file is required.See --repairtype pv_header to repair headers.No metadata areas on device to repair.No metadata areas found on device.WARNING: Cannot get device size.Skipping mda2 (wrong mda_header.version)Skipping mda2 (no matching VG UUID in metadata area)Skipping mda2 (wrong mda_header.start)Found mda2 header at offset %llu size %lluWARNING: PV will have no metadata with zero metadata areas.WARNING: no previous metadata areas found on device.Should a metadata area be included? To repair with zero metadata areas, use --settings "mda_offset=0 mda_size=0".mda2_offset setting %llu does not match mda2_offset found on disk %llu.mda2_size setting %llu does not match mda2_size found on disk %llu.WARNING: device_size setting %llu bytes does not match device size %llu bytes.Metadata input file is needed for pv_header info.See pvck --dump to locate and create a metadata file.WARNING: existing PV UUID %s does not match pv_uuid setting %s.PV UUID %s not found in metadata file.PV UUID %s in existing pv_header not found in metadata file.PV name %s not found in metadata file.No valid PV UUID, specify a PV UUID from metadata in --settings.Scanning failed to get devices.Failed to scan devices to check PV UUID.Cannot use PV UUID %s which exists on %sWriting label_header.crc 0x%08x pv_header uuid %s device_size %lluWriting data_offset %llu mda1_offset %llu mda1_size %llu mda2_offset %llu mda2_size %llumda_header_%d.raw_locn[%d] at %llu # %s%smda_header_%d.raw_locn[%d].offset %llumda_header_%d.raw_locn[%d].size %llumda_header_%d.raw_locn[%d].checksum 0x%xmda_header_%d.raw_locn[%d].flags 0x%x # RAW_LOCN_IGNOREDmda_header_%d.raw_locn[%d].flags 0x%xCHECK: mda_header_%d.raw_locn[%d] for precommit not emptyCHECK: mda_header_%d.raw_locn[%d].size larger than metadata area sizePercentage is too big (>=%d%%).Multiple sign symbols detected.Size requires number argument.Can't parse size argument at '%c'.%s%sSize is not a multiple of 512. Try using %lu or %lu.Segment type %s cannot use pool %s.Logical volume %s already exists in Volume group %s.Persistent major and minor numbers are unsupported with pools.Ambiguous --readahead parameter specified. Please use either with pool or volume.Please specify name of existing pool.Pool %s not found in Volume group %s.Unable to create LV with unknown segment type %s.is unsupported with cache poolsCannot create read-only cache pool.Snapshot segment type is incompatible with thin pools.is unsupported with snapshots and --thinpoolSnapshot segment type requires size or extents.is supported only with sparse snapshotsis supported only with mirrorsPlease specify either size or pooldatasize.is supported only with thin pool creationThin segment type requires --virtualsize.Switching from thin to thin pool segment type.is unsupported with thin poolsCannot create read-only thin pool.is supported only with VDO pool creationis supported only with mirrors or raids--mirrors is supported only with mirrors or raidsis supported only with pools and snapshotsis supported only with vdo, sparse snapshots and thinsSegment type %s does not support --errorwhenfull.Please specify a logical volume to act as the cache pool or origin.Unsupported syntax, cannot use cache origin %s and --cachepool %s.The cache pool or cache origin name should include the volume group.Creation of cached volume and cache pool in one command is not yet supported.Please specify a logical volume to act as the snapshot origin.The origin name should include the volume group.Ambiguous %s name specified, %s and %s.The %s name should include the volume group.Please provide a volume group nameVolume group name expected (no slash)Logical volume name %s and pool name must be different.Volume group name %s has invalid charactersPlease specify either size or extents (not both).Please specify either size or extents.Dropping VDO pool header size to 0 to support maximal size %s.RAID10 currently supports only 2-way mirroring (i.e. '-m 1')--mirrors must be at least 1 with segment type %s.Redundant mirrors argument: default is 0Only up to %u stripes in %s supported currently.Only up to %u mirrors in %s supported currently.nosync option prohibited on RAID6.regionsize in configuration file is invalid.Please use only one of --corelog or --mirrorlog.Minimum of 2 stripes required for %s.Stripes argument cannot be used with segment type, %sMinimum of 3 stripes required for %s.Stripe size argument cannot be used with segment type, %sMirror argument cannot be used with segment type, %sAdjusting %s %s region size to required minimum of stripe size %s.Conflicting contiguous and alloc arguments.Unable to allocate memory for tag %s.WARNING: Logical volume %s is already not mirrored.Cannot convert logical volume %s with active component LV(s).Can't add mirror to out-of-sync mirrored LV: use lvchange --resync first.Can't add additional mirror images to mirror %s which is under snapshots.%s is already being converted. Unable to start another conversion.Failed to insert resync layer.ABORTING: Failed to remove temporary mirror layer %s.Manual cleanup with vgcfgrestore and dmsetup may be required.--trackchanges is not available to 'mirror' segment type.%sLogical Volume "%s" already exists in volume group "%s".Unable to split mirror %s that is not in-sync.One LV position arg is required.VG name mismatch from %s arg (%s) and option arg (%s).Cannot find VG name for LV %s.Obtaining the complete list of VGs before processing their LVsMinor number is already not persistent for %s.Disabling persistent device number for %s.Logical volume %s will be deactivated temporarily. Continue? [y/n]: Setting persistent device number to (%d, %d) for %s.Re-activating logical volume %s.lv_is_lockedlv_is_partiallv_is_virtuallv_is_merginglv_is_merging_originlv_is_convertinglv_is_external_originlv_is_virtual_originlv_is_not_synced lv_is_pending_delete lv_is_error_when_full lv_is_pvmove lv_is_removed lv_is_vg_writablelv_is_writablelv_is_thinpool_datalv_is_thinpool_metadatalv_is_cachepool_datalv_is_cachepool_metadatalv_is_mirror_imagelv_is_mirror_loglv_is_raid_imagelv_is_raid_metadatalv_is_originlv_is_thick_originlv_is_thick_snapshotlv_is_thin_originlv_is_thin_snapshotlv_is_errorlv_is_zerolv_is_cache_originlv_is_cow lv_is_merging_cow!lv_is_cow_covering_origin"lv_is_visible#lv_is_historical$lv_is_raid_with_tracking%lv_is_raid_with_integrity&dkmgtpebs`Crequest = %sOO_ALL:DESC:AUTOTYPE:FLAGS:SECONDARY_SYNTAXPREVIOUS_SYNTAXRULE:lv_is_Cannot find command %s.Failed to duplicate name %s.Failed to duplicate line %s.OO_ALLlockd VG %s %slock_vgVG %s lock failed: removedVG %s lock failed: io timeoutVG %s lock skipped: error %dVG %s lock failed: error %dlockd VG disabled %s%s: field name too long.Missing end quote.Failed to create path %s%s/%s%s/%u/fd/%ufputsfflushFailed to add sublv %s.raid5_nimagesrebuildExtracting %u %s from %s.Failed to extract %s from %s.Shifting images in %s.Shifting %s and %s by %u.Post callout function failed.lvs list alloc failed.Extending %u mirror images.Using default stripesize %sNew size of 0 not permitted.%s_imetacrc32cLV update and reload failedFailed to add integrity.pipePiping:%sSTDOUT/dev/nullpipe[0]pipe[1] by historical LVCreating logical volume %ssnapshot%dCan't move snapshot segment.sigfillsetParsing command defs: too many rules for cmd, increase CMD_MAX_RULES.Parsing command defs: too many cmd_rule options for cmd, increase MAX_RULE_OPTS.Parsing command defs: unknown lv property %s.Parsing command defs: invalid OO definition.Parsing command defs: no memory.Parsing command defs: can't process input line %s.WARNING: skipping VG lock in lvmlockd.Retrying lock on VG %s: io timeoutRetrying lock on VG %s: held by other host%sVG %s lock skipped: lock start in progressVG %s lock failed: lock start in progressVG %s lock skipped: storage %s for sanlock leasesVG %s lock failed: storage %s for sanlock leasesVG %s lock skipped: io timeoutVG %s lock skipped: sanlock lease needs repairVG %s lock failed: sanlock lease needs repairVG %s lock skipped: held by other host%sVG %s lock failed: held by other host%sVG %s lock skipped: orphan lock needs to be adopted.VG %s lock failed: orphan lock needs to be adopted.VG %s lock skipped: adopt found no orphan.VG %s lock failed: adopt found no orphan.VG %s lock skipped: adopt found other mode.VG %s lock failed: adopt found other mode.VG %s lock skipped: lock manager error.VG %s lock failed: lock manager error.Duplicate sanlock global lock in VG %sCreating lvmlock LV for sanlock with size %um %llub %u extentsFailed to create sanlock lv %s in vg %sdm_tree_node_add_null_area() called on an unsupported segment typeTest mode: Skipping creation of provisioned thin pool metadata.Cannot create temporary file to prepare metadata. Preparing thin-pool metadata with thin volume mapping: %sLV %s has to be of type raid4 or raid5_n to allow for this conversion.Are you sure you want to convert %s%s LV %s to %s%s type? [y/n]: Converting LV %s from %s to %s.Failed to rename %s LV %s MetaLVs.Unable to remove primary RAID image while array resyncing.Unable to remove RAID image while array is performing "%s"Internal error: RAID LV area_count differs from number of health charactersUnable to remove all primary source devicesUnable to remove %d images: Only %d device%s given.%s has components with error targets that must be removed first: %s.Try removing the PV list and rerun. the command.LVs with error segments to be removed: %s %sInternal error: Metadata segment area. #%d should be AREA_UNASSIGNED.Failed to shift and rename image components.Unable to extract enough images to satisfy request.Internal error: Bad type provided to %s.Extracting image component %s from %s.Internal error: Pre callout function failed.Clearing any flags for %s passed to the kernel.Updating metadata mappings for %s.Direct conversion of %s LV %s is not possible.Converting %s from %s%s is directly possible to the following layout%s:Logical volumes in "%s" must be inactiveExtent sizes differ: %d (%s) and %d (%s)Maximum number of physical volumes (%d) exceeded for "%s" and "%s"Maximum number of logical volumes (%d) exceeded for "%s" and "%s"Metadata types differ for "%s" and "%s"Duplicate logical volume name "%s" in "%s" and "%s"Physical volume %s might be constructed from same volume group %s.pv->vg_name allocation failed for '%s'Rounding size to boundary between physical extents: %s.VolumeType does not match (%s).Logical volume %s is using mixing segment types %s and %s.Cannot vary number of mirrors in LV yet.Internal error: Missing mirror segments for %s.Please specify number of stripes (-i) and stripesize (-I)Unable to extend "%s" segment type with different number of stripes.Using stripesize of last segment %sStripesize for striped segment should not be 0!Increasing incremental size from %s to %s to fit new VDO slab.Unable to extend %s by %u logical extents: exceeds limit (%u).Reached maximum COW size %s (%u extents).Reached maximum pool metadata size %s (%u extents).Thin pool will use metadata without cropping.Unable to reduce %s below 1 extent.New size (%d extents) matches existing size (%d extents).Rounding size (%d extents) up to stripe boundary size for segment (%d extents).Rounding size (%d extents) down to stripe boundary size for segment (%d extents)New size given (%d extents) not larger than existing size (%d extents)New size given (%d extents) not less than existing size (%d extents)New size (%d extents) matches existing size (%d extents)New size for %s: %u. Existing logical extents: %u / physical extents: %u.Integrity can only be added to top level raid LV.Integrity can only be added to raid1,4,5,6,10.raid image must be linear to add integrityFailed to create metadata LV name.Round integrity meta size up to one extent.Creating integrity metadata LV %s with size %s.Failed to create integrity metadata LVFailed to activate LV %s to zeroFailed to zero LV for integrity metadata %sFailed to deactivate LV %s after zeroIntegrity requires consistent logical block size for LV devices.Invalid integrity block size, possible values are 512, 1024, 2048, 4096Integrity block size %u not allowed with device logical block size 4096.Using integrity block size %u with unknown device logical block size.Cannot use integrity block size %u with unknown file system block size, logical block size %u, physical block size %u.Using integrity block size %u for unknown file system block size, logical block size %u, physical block size %u.Limiting integrity block size to 512 because the LV is active.Using integrity block size %u for file system block size %u.Integrity block size %u cannot be larger than file system block size %u.Adding integrity to raid image %sWriting VG and updating LV with new integrity LV %sWriting VG with new integrity LV %sActivating to start integrity initialization for LV %sFailed to activate integrity LV to initialize.Writing VG with initialized integrity LV %sNew integrity metadata LV may require manual removal.Can't convert non-striped segment to mirrored.Can't convert striped segment with multiple areas to mirrored.Couldn't allocate converted LV segment.Failed to generate unique name for unused logical volume.Missing segtype in lv_add_segment().lv_add_segment cannot handle virtual segmentsLog segments can only be added to an empty LVCouldn't allocate new LV segment.Couldn't merge segments after extending logical volume.Failed to generate new unique name for unused LV %slockd_free_lv_queue: unknown lock_type.Failed to generate unique name for the new logical volumeUnable to create LV %s in Volume Group %s: name already in use%s.'%s' is already in use as a snapshot.Snapshot and origin LVs must differ.Failed to find snapshot segtypeCouldn't allocate new snapshot segment.Couldn't allocate new %s segment.Using %s chunk size instead of default %s, so cache pool has less than %lu chunks.Chunk size %s is less than required minimal chunk size %s for a cache pool of %s size and limit %lu chunks.To allow use of more chunks, see setting allocation/cache_pool_max_chunks.Internal error: Cache mode is not determined.Internal error: Resource name %s is too long.Operation prohibited while --readonly is set.Allowing activation with --readonly --sysinit.Operation prohibited while global/metadata_read_only is set.Bƒ„pppppppppp@_extract_image_component_error_segOO_ALL: --commandprofile String, --config String, --debug,--driverloaded Bool, --help, --nolocking, --lockopt String, --longhelp, --profile String, --quiet,--verbose, --version, --yes, --test, --devicesfile String, --devices PV, --nohints --journal StringOO_REPORTING: --configreport ConfigReport, --foreign,--ignorelockingfailure, --logonly, --readonly, --reportformat ReportFmt,--select String, --shared, --units UnitsOO_REPORT: OO_REPORTING, --all, --aligned, --binary,--headings HeadingsType, --nameprefixes, --noheadings,--nosuffix, --options String, --rows, --separator String,--sort String, --unbuffered, --unquotedOO_CONFIG: --atversion String, --typeconfig ConfigType, --file String, --ignoreadvanced,--ignoreunsupported, --ignorelocal, --list, --mergedconfig, --metadataprofile String,--sinceversion String, --showdeprecated, --showunsupported, --validate, --valuesonly,--withsummary, --withcomments, --withgeneralpreamble, --withlocalpreamble, --withspaces,--unconfigured, --withversionsOO_LVCHANGE: --autobackup Bool, --force, --ignoremonitoring,--noudevsync, --reportformat ReportFmt, --select StringOO_LVCHANGE_META: --addtag Tag, --deltag Tag,--alloc Alloc, --contiguous Bool,--compression Bool, --deduplication Bool,--detachprofile, --metadataprofile String,--permission Permission, --readahead Readahead, --setactivationskip Bool,--setautoactivation Bool, --errorwhenfull Bool, --discards Discards, --zero Bool,--cachemode CacheMode, --cachepolicy String, --cachesettings String,--minrecoveryrate SizeKB, --maxrecoveryrate SizeKB,--vdosettings String, --integritysettings String,--writebehind Number, --writemostly WriteMostlyPV, --persistent nlvchange OO_LVCHANGE_META VG|LV|Tag|Select ...OO: --activate Active, --poll Bool, --monitor Bool, OO_LVCHANGEIO: --ignoreskippedclusterID: lvchange_propertiesDESC: Change a general LV attribute.DESC: For options listed in parentheses, any one isDESC: required, after which the others are optional.RULE: all not lv_is_pvmove lv_is_mirror_log lv_is_mirror_imageRULE: all and lv_is_vg_writableRULE: --contiguous not --allocRULE: --profile not --detachprofileRULE: --metadataprofile not --detachprofileRULE: --minrecoveryrate --maxrecoveryrate and LV_raidRULE: --writebehind --writemostly and LV_raid1RULE: --cachemode --cachepolicy --cachesettings and LV_cache LV_cachepool LV_writecacheRULE: --errorwhenfull --discards --zero and LV_thinpoolRULE: --permission not lv_is_external_origin lv_is_raid_metadata lv_is_raid_image LV_thinpoolRULE: --alloc --contiguous --metadataprofile --persistent --profile --readahead not lv_is_thick_originRULE: --alloc --discards --zero --cachemode --cachepolicy --cachesettings not lv_is_partiallvchange --resync VG|LV_raid_mirror|Tag|Select ...OO: --activate Active, OO_LVCHANGEIO: --ignoreskippedclusterID: lvchange_resyncDESC: Resynchronize a mirror or raid LV.DESC: Use to reset 'R' attribute on a not initially synchronized LV.RULE: all not lv_is_pvmove lv_is_locked lv_is_raid_with_integrityRULE: all not LV_raid0lvchange --syncaction SyncAction VG|LV_raid|Tag|Select ...OO: OO_LVCHANGEIO: --ignoreskippedclusterID: lvchange_syncactionDESC: Resynchronize or check a raid LV.RULE: all not LV_raid0lvchange --rebuild PV VG|LV_raid|Tag|Select ...OO: OO_LVCHANGEIO: --ignoreskippedclusterID: lvchange_rebuildDESC: Reconstruct data on specific PVs of a raid LV.RULE: all not LV_raid0lvchange --activate Active VG|LV|Tag|Select ...OO: --activationmode ActivationMode, --partial, --poll Bool, --monitor Bool,--ignoreactivationskip, --ignorelockingfailure, --sysinit, --readonly, OO_LVCHANGEIO: --ignoreskippedclusterID: lvchange_activateDESC: Activate or deactivate an LV.lvchange --refresh VG|LV|Tag|Select ...OO: --activationmode ActivationMode, --partial, --poll Bool, --monitor Bool, OO_LVCHANGEIO: --ignoreskippedclusterID: lvchange_refreshDESC: Reactivate an LV using the latest metadata.lvchange --monitor Bool VG|LV|Tag|Select ...OO: OO_LVCHANGEIO: --ignoreskippedclusterID: lvchange_monitorDESC: Start or stop monitoring an LV from dmeventd.RULE: all not lv_is_pvmovelvchange --poll Bool VG|LV|Tag|Select ...OO: --monitor Bool, OO_LVCHANGEIO: --ignoreskippedclusterID: lvchange_pollDESC: Start or stop processing an LV conversion.lvchange --persistent y --minor Number LVOO: --major Number, --activate Active, --poll Bool, --monitor Bool, OO_LVCHANGEIO: --ignoreskippedclusterID: lvchange_persistentDESC: Make the minor device number persistent for an LV.RULE: all not LV_thinpool LV_cachepool LV_vdopoolOO_LVCONVERT_POOL: --chunksize SizeKB, --poolmetadata LV,--poolmetadatasize SizeMB, --poolmetadataspare Bool, --metadataprofile String,--readahead Readahead, --wipesignatures Bool, --zero BoolOO_LVCONVERT_CACHE: --cachemetadataformat CacheMetadataFormat,--cachemode CacheMode, --cachepolicy String,--cachesettings String, --zero BoolOO_LVCONVERT_VDO: --compression Bool, --deduplication Bool, --vdosettings StringOO_LVCONVERT_VDO_POOL: OO_LVCONVERT_VDO, --metadataprofile String,--readahead Readahead, --wipesignatures Bool, --zero BoolOO_LVCONVERT_THINPOOL: --discards Discards, --errorwhenfull Bool, --pooldatavdo Bool,OO_LVCONVERT_VDO, OO_LVCONVERT_POOLOO_LVCONVERT: --alloc Alloc, --background, --force, --noudevsynclvconvert --type linear LVOO: OO_LVCONVERTOP: PV ...ID: lvconvert_raid_typesDESC: Convert LV to linear.RULE: all not lv_is_locked lv_is_pvmovelvconvert --type striped LVOO: --stripes_long Number, --stripesize SizeKB, --regionsize RegionSize, --interval Number, OO_LVCONVERTOP: PV ...ID: lvconvert_raid_typesDESC: Convert LV to striped.RULE: all not lv_is_locked lv_is_pvmovelvconvert --type mirror LVOO: --mirrors SNumber, --stripes_long Number, --stripesize SizeKB, --regionsize RegionSize, --interval Number, --mirrorlog MirrorLog, OO_LVCONVERTOP: PV ...ID: lvconvert_raid_typesDESC: Convert LV to type mirror (also see type raid1),RULE: all not lv_is_locked lv_is_pvmovelvconvert --type raid LVOO: --mirrors SNumber, --stripes_long Number, --stripesize SizeKB, --regionsize RegionSize, --interval Number, OO_LVCONVERTOP: PV ...ID: lvconvert_raid_typesDESC: Convert LV to raid or change raid layoutDESC: (a specific raid level must be used, e.g. raid1).RULE: all not lv_is_locked lv_is_pvmoveRULE: lv_is_raid_with_integrity not --stripes_long --stripesize --regionsize --intervallvconvert --mirrors SNumber LVOO: --regionsize RegionSize, --interval Number, --mirrorlog MirrorLog, OO_LVCONVERTOP: PV ...ID: lvconvert_raid_typesDESC: Convert LV to raid1 or mirror, or change number of mirror images.RULE: all not lv_is_locked lv_is_pvmovelvconvert --stripes_long Number LV_raidOO: OO_LVCONVERT, --interval Number, --regionsize RegionSize, --stripesize SizeKBOP: PV ...ID: lvconvert_raid_typesDESC: Convert raid LV to change number of stripe images.RULE: all not lv_is_locked lv_is_pvmove lv_is_raid_with_integrityRULE: all not LV_raid0 LV_raid1lvconvert --stripesize SizeKB LV_raidOO: OO_LVCONVERT, --interval Number, --regionsize RegionSizeID: lvconvert_raid_typesDESC: Convert raid LV to change the stripe size.RULE: all not lv_is_locked lv_is_pvmove lv_is_raid_with_integrityRULE: all not LV_raid0 LV_raid1lvconvert --regionsize RegionSize LV_raidOO: OO_LVCONVERTID: lvconvert_change_region_sizeDESC: Change the region size of an LV.RULE: all not lv_is_locked lv_is_pvmove lv_is_raid_with_integrityRULE: all not LV_raid0FLAGS: SECONDARY_SYNTAXlvconvert --splitmirrors Number --name LV_new LV_raid1_mirror_cacheOO: OO_LVCONVERTOP: PV ...ID: lvconvert_split_mirror_imagesDESC: Split images from a raid1 or mirror LV and use them to create a new LV.RULE: all not lv_is_locked lv_is_pvmove lv_is_raid_with_integritylvconvert --splitmirrors Number --trackchanges LV_raid1_cacheOO: OO_LVCONVERTOP: PV ...ID: lvconvert_split_mirror_imagesDESC: Split images from a raid1 LV and track changes to origin for later merge.RULE: all not lv_is_locked lv_is_pvmove lv_is_raid_with_integritylvconvert --mergemirrors LV_linear_raid|VG|Tag ...OO: OO_LVCONVERTID: lvconvert_merge_mirror_imagesDESC: Merge LV images that were split from a raid1 LV.RULE: all not lv_is_locked lv_is_pvmove lv_is_merging_origin lv_is_virtual_origin lv_is_external_origin lv_is_merging_cow lv_is_raid_with_integritylvconvert --mirrorlog MirrorLog LV_mirrorOO: OO_LVCONVERTOP: PV ...ID: lvconvert_change_mirrorlogDESC: Change the type of mirror log used by a mirror LV.RULE: all not lv_is_locked lv_is_pvmoveFLAGS: SECONDARY_SYNTAXlvconvert --type thin --thinpool LV LV_linear_striped_raid_cache_thin_error_zeroOO: --thin, --originname LV_new, OO_LVCONVERT_POOL, OO_LVCONVERTOP: PV ...ID: lvconvert_to_thin_with_externalDESC: Convert LV to a thin LV, using the original LV as an external origin.RULE: all and lv_is_visibleRULE: all not lv_is_locked lv_is_raid_with_integrityRULE: --poolmetadata not --readahead --stripesize --stripes_longlvconvert --thin --thinpool LV LV_linear_striped_raid_cache_thin_error_zeroOO: --originname LV_new, OO_LVCONVERT_POOL, OO_LVCONVERTOP: PV ...ID: lvconvert_to_thin_with_externalDESC: Convert LV to a thin LV, using the original LV as an external origin.FLAGS: SECONDARY_SYNTAXAUTOTYPE: thinRULE: all and lv_is_visibleRULE: all not lv_is_locked lv_is_raid_with_integrityRULE: --poolmetadata not --readahead --stripesize --stripes_longlvconvert --type thin LV_linear_striped_raid_cache_writecache_vdo_error_zeroOO: --thin, OO_LVCONVERT_POOL, OO_LVCONVERTOP: PV ...ID: lvconvert_to_thin_with_dataDESC: Convert LV to a thin LV, using LV as thin-pool data volume.RULE: all and lv_is_visibleRULE: all not lv_is_locked lv_is_origin lv_is_merging_origin lv_is_external_origin lv_is_raid_with_integrityRULE: --poolmetadata not --readahead --stripesize --stripes_longlvconvert --thin LV_linear_striped_raid_cache_writecache_vdo_error_zeroOO: OO_LVCONVERT_POOL, OO_LVCONVERTOP: PV ...ID: lvconvert_to_thin_with_dataDESC: Convert LV to a thin LV, using LV as thin-pool data volume.FLAGS: SECONDARY_SYNTAXAUTOTYPE: thinRULE: all and lv_is_visibleRULE: all not lv_is_locked lv_is_origin lv_is_merging_origin lv_is_external_origin lv_is_raid_with_integrityRULE: --poolmetadata not --readahead --stripesize --stripes_longlvconvert --type cache --cachepool LV LV_linear_striped_raid_thinpool_thinpooldata_vdo_vdopool_vdopooldata_thin_error_zeroOO: --cache, OO_LVCONVERT_CACHE, OO_LVCONVERT_POOL, OO_LVCONVERTOP: PV ...ID: lvconvert_to_cache_with_cachepoolDESC: Attach a cache pool to an LV, converts the LV to type cache.RULE: all not lv_is_locked lv_is_merging_origin lv_is_merging_cow lv_is_cowRULE: --poolmetadata not --readahead --stripesize --stripes_longlvconvert --cache --cachepool LV LV_linear_striped_raid_thinpool_vdo_vdopool_vdopooldata_thin_error_zeroOO: OO_LVCONVERT_CACHE, OO_LVCONVERT_POOL, OO_LVCONVERTOP: PV ...ID: lvconvert_to_cache_with_cachepoolDESC: Attach a cache pool to an LV.RULE: all not lv_is_locked lv_is_merging_origin lv_is_merging_cow lv_is_cowRULE: --poolmetadata not --readahead --stripesize --stripes_longFLAGS: SECONDARY_SYNTAXAUTOTYPE: cachelvconvert --type writecache --cachevol LV LV_linear_striped_raid_thinpoolOO: OO_LVCONVERT, --cachesettings StringID: lvconvert_to_writecacheDESC: Attach a writecache to an LV, converts the LV to type writecache.RULE: all and lv_is_visiblelvconvert --type cache --cachevol LV LV_linear_striped_raid_thinpoolOO: --cache, OO_LVCONVERT_CACHE, OO_LVCONVERT, --poolmetadatasize SizeMB, --chunksize SizeKBID: lvconvert_to_cache_with_cachevolDESC: Attach a cache to an LV, converts the LV to type cache.RULE: all and lv_is_visiblelvconvert --cache --cachevol LV LV_linear_striped_raid_thinpoolOO: OO_LVCONVERT_CACHE, OO_LVCONVERT, --poolmetadatasize SizeMB, --chunksize SizeKBID: lvconvert_to_cache_with_cachevolDESC: Attach a cache to an LV, converts the LV to type cache.RULE: all and lv_is_visibleFLAGS: SECONDARY_SYNTAXlvconvert --type writecache --cachedevice PV LV_linear_striped_raid_thinpoolOO: OO_LVCONVERT, --cachesize SizeMB, --cachesettings StringID: lvconvert_to_writecache_with_deviceDESC: Add a writecache to an LV, using a specified cache device.RULE: all and lv_is_visiblelvconvert --type cache --cachedevice PV LV_linear_striped_raid_thinpoolOO: OO_LVCONVERT, --cachesize SizeMB, --cachesettings String, --chunksize SizeKBID: lvconvert_to_cache_with_deviceDESC: Add a cache to an LV, using a specified cache device.RULE: all and lv_is_visiblelvconvert --type thin-pool LV_linear_striped_raid_cache_writecache_vdo_error_zeroOO: --stripes_long Number, --stripesize SizeKB,OO_LVCONVERT_THINPOOL, OO_LVCONVERTOP: PV ...ID: lvconvert_to_thinpoolDESC: Convert LV to type thin-pool (existing data on LV will be erased).RULE: all and lv_is_visibleRULE: all not lv_is_locked lv_is_origin lv_is_merging_origin lv_is_external_origin lv_is_raid_with_integrityRULE: --poolmetadata not --readahead --stripesize --stripes_longlvconvert --thinpool LV_linear_striped_raid_cache_writecache_vdo_error_zero_thinpoolOO: --stripes_long Number, --stripesize SizeKB,OO_LVCONVERT_THINPOOL, OO_LVCONVERTOP: PV ...ID: lvconvert_to_thinpool_or_swap_metadataDESC: Convert LV to type thin-pool (variant, use --type thin-pool).DESC: Swap metadata LV in a thin pool (variant, use --swapmetadata).FLAGS: PREVIOUS_SYNTAXRULE: all and lv_is_visibleRULE: all not lv_is_raid_with_integrityRULE: --poolmetadata not --readahead --stripesize --stripes_longAUTOTYPE: thin-poollvconvert --type cache-pool LV_linear_striped_raid_error_zeroOO: OO_LVCONVERT_CACHE, OO_LVCONVERT_POOL, OO_LVCONVERTOP: PV ...ID: lvconvert_to_cachepoolDESC: Convert LV to type cache-pool (existing data on LV will be erased).RULE: --poolmetadata not --readahead --stripesize --stripes_longRULE: all not lv_is_raid_with_integritylvconvert --cachepool LV_linear_striped_raid_cachepool_error_zeroOO: --type cache-pool, OO_LVCONVERT_CACHE, OO_LVCONVERT_POOL, OO_LVCONVERTOP: PV ...ID: lvconvert_to_cachepool_or_swap_metadataDESC: Convert LV to type cache-pool (variant: use --type cache-pool,DESC: existing data on LV will be erased).DESC: Swap metadata LV in a cache pool (variant: use --swapmetadata).FLAGS: PREVIOUS_SYNTAXRULE: all and lv_is_visibleRULE: all not lv_is_raid_with_integrityRULE: --poolmetadata not --readahead --stripesize --stripes_longlvconvert --type vdo-pool LV_linear_striped_raid_cacheOO: --name LV_new, --virtualsize SizeMB, OO_LVCONVERT_VDO_POOL, OO_LVCONVERTID: lvconvert_to_vdopoolDESC: Convert LV to type vdopool (existing data on LV will be erased).RULE: all and lv_is_visible lv_is_writableRULE: all not lv_is_locked lv_is_origin lv_is_merging_origin lv_is_external_origin lv_is_virtual lv_is_raid_with_integritylvconvert --vdopool LV_linear_striped_raid_cacheOO: --name LV_new, --virtualsize SizeMB, OO_LVCONVERT_VDO_POOL, OO_LVCONVERTID: lvconvert_to_vdopool_paramDESC: Convert LV to type vdopool (variant: use --type vdo-pool,DESC: existing data on LV will be erased).RULE: all and lv_is_visible lv_is_writableRULE: all not lv_is_locked lv_is_origin lv_is_merging_origin lv_is_external_origin lv_is_virtual lv_is_raid_with_integrityFLAGS: SECONDARY_SYNTAXAUTOTYPE: vdo-poollvconvert --splitcache LV_cachepool_cache_thinpool_vdopool_writecacheOO: OO_LVCONVERT, --cachesettings StringID: lvconvert_split_and_keep_cacheDESC: Detach a cache from an LV.lvconvert --uncache LV_cache_thinpool_vdopool_writecacheOO: OO_LVCONVERT, --cachesettings StringID: lvconvert_split_and_remove_cacheDESC: Detach and delete a cache from an LV.FLAGS: SECONDARY_SYNTAXlvconvert --swapmetadata --poolmetadata LV LV_thinpool_cachepoolOO: --chunksize SizeKB, OO_LVCONVERTID: lvconvert_swap_pool_metadataDESC: Swap metadata LV in a thin pool or cache pool (for repair only).FLAGS: SECONDARY_SYNTAXlvconvert --merge LV_linear_striped_raid_thin_snapshot|VG|Tag ...OO: --background, --interval Number, OO_LVCONVERTID: lvconvert_mergeDESC: Merge LV that was split from a mirror (variant, use --mergemirrors).DESC: Merge thin LV into its origin LV (variant, use --mergethin).DESC: Merge COW snapshot LV into its origin (variant, use --mergesnapshot).RULE: all not lv_is_locked lv_is_pvmove lv_is_merging_origin lv_is_virtual_origin lv_is_external_origin lv_is_merging_cowFLAGS: SECONDARY_SYNTAXlvconvert --mergethin LV_thin ...OO: OO_LVCONVERTID: lvconvert_merge_thinDESC: Merge thin LV into its origin LV.RULE: all not lv_is_locked lv_is_pvmove lv_is_merging_origin lv_is_virtual_origin lv_is_external_origin lv_is_merging_cowRULE: all and lv_is_visiblelvconvert --mergesnapshot LV_snapshot ...OO: --background, --interval Number, OO_LVCONVERTID: lvconvert_merge_snapshotDESC: Merge COW snapshot LV into its origin.RULE: all not lv_is_locked lv_is_pvmove lv_is_merging_origin lv_is_virtual_origin lv_is_external_origin lv_is_merging_cowRULE: all and lv_is_visiblelvconvert --splitsnapshot LV_snapshotOO: OO_LVCONVERTID: lvconvert_split_cow_snapshotDESC: Separate a COW snapshot from its origin LV.RULE: all not lv_is_locked lv_is_pvmove lv_is_origin lv_is_external_origin lv_is_merging_cowFLAGS: SECONDARY_SYNTAXlvconvert --type snapshot LV LV_linear_stripedOO: --snapshot, --chunksize SizeKB, --zero Bool, OO_LVCONVERTID: lvconvert_combine_split_snapshotDESC: Combine a former COW snapshot (second arg) with a formerDESC: origin LV (first arg) to reverse a splitsnapshot command.RULE: all not lv_is_locked lv_is_pvmoveRULE: all and lv_is_visiblelvconvert --snapshot LV LV_linear_stripedOO: --chunksize SizeKB, --zero Bool, OO_LVCONVERTID: lvconvert_combine_split_snapshotDESC: Combine a former COW snapshot (second arg) with a formerDESC: origin LV (first arg) to reverse a splitsnapshot command.RULE: all not lv_is_locked lv_is_pvmoveRULE: all and lv_is_visibleFLAGS: SECONDARY_SYNTAXAUTOTYPE: snapshotlvconvert --repair LV_cache_cachepool_mirror_raid_thinpoolOO: --usepolicies, --interval Number, --setactivationskip Bool, --poolmetadataspare Bool, OO_LVCONVERTOP: PV ...ID: lvconvert_repairDESC: Replace failed PVs in a raid or mirror LV.DESC: Repair a thin pool.DESC: Repair a cache pool.RULE: all not lv_is_locked lv_is_pvmoveRULE: --poolmetadataspare and LV_cache LV_cachepool LV_thinpoolRULE: --setactivationskip and LV_cache LV_cachepool LV_thinpoollvconvert --replace PV LV_raidOO: OO_LVCONVERTOP: PV ...ID: lvconvert_replace_pvDESC: Replace specific PV(s) in a raid LV with another PV.RULE: all not lv_is_locked lv_is_pvmovelvconvert --startpoll LV_mirror_raidOO: OO_LVCONVERTID: lvconvert_start_pollDESC: Poll LV to continue conversion.RULE: all and lv_is_convertinglvconvert LV_mirror_raidOO: OO_LVCONVERTID: lvconvert_plainDESC: Poll LV to continue conversion (also see --startpoll)DESC: or waits till conversion/mirror syncing is finishedFLAGS: SECONDARY_SYNTAXlvconvert --raidintegrity Bool LV_raidOO: --raidintegritymode String, --raidintegrityblocksize Number, --integritysettings String, OO_LVCONVERTOP: PV ...ID: lvconvert_integrityDESC: Add or remove data integrity checksums to raid images.OO_LVCREATE: --addtag Tag, --alloc Alloc, --autobackup Bool, --activate Active,--contiguous Bool, --ignoreactivationskip, --ignoremonitoring, --major Number,--metadataprofile String, --minor Number, --monitor Bool, --name String, --nosync,--noudevsync, --permission Permission, --persistent Bool, --readahead Readahead,--reportformat ReportFmt, --setactivationskip Bool, --wipesignatures Bool,--zero Bool, --setautoactivation BoolOO_LVCREATE_CACHE: --cachemode CacheMode, --cachepolicy String, --cachesettings String,--chunksize SizeKB, --cachemetadataformat CacheMetadataFormatOO_LVCREATE_POOL: --poolmetadatasize SizeMB, --poolmetadataspare Bool, --chunksize SizeKBOO_LVCREATE_VDO: --compression Bool, --deduplication Bool, --vdosettings StringOO_LVCREATE_THINPOOL: --discards Discards, --errorwhenfull Bool, --pooldatavdo Bool, OO_LVCREATE_VDO, OO_LVCREATE_POOLOO_LVCREATE_RAID: --regionsize RegionSize, --minrecoveryrate SizeKB, --maxrecoveryrate SizeKB,--raidintegrity Bool, --raidintegritymode String, --raidintegrityblocksize Number, --integritysettings Stringlvcreate --type error --size SizeMB VGOO: OO_LVCREATEID: lvcreate_error_volDESC: Create an LV that returns errors when used.FLAGS: SECONDARY_SYNTAXlvcreate --type zero --size SizeMB VGOO: OO_LVCREATEID: lvcreate_zero_volDESC: Create an LV that returns zeros when read.FLAGS: SECONDARY_SYNTAXlvcreate --type linear --size SizeMB VGOO: OO_LVCREATEOP: PV ...IO: --mirrors 0, --stripes 1ID: lvcreate_linearDESC: Create a linear LV.FLAGS: SECONDARY_SYNTAXlvcreate --size SizeMB VGOO: OO_LVCREATEOP: PV ...IO: --mirrors 0, --stripes 1ID: lvcreate_linearDESC: Create a linear LV.AUTOTYPE: linearlvcreate --type striped --size SizeMB VGOO: --stripes Number, --stripesize SizeKB, OO_LVCREATEOP: PV ...ID: lvcreate_stripedDESC: Create a striped LV (also see lvcreate --stripes).FLAGS: SECONDARY_SYNTAXlvcreate --stripes Number --size SizeMB VGOO: --stripesize SizeKB, OO_LVCREATEOP: PV ...ID: lvcreate_stripedDESC: Create a striped LV.AUTOTYPE: stripedlvcreate --type mirror --size SizeMB VGOO: --stripes Number, --stripesize SizeKB,--mirrors PNumber, --mirrorlog MirrorLog, --regionsize RegionSize, OO_LVCREATEOP: PV ...ID: lvcreate_mirrorDESC: Create a mirror LV (also see --type raid1).FLAGS: SECONDARY_SYNTAXlvcreate --mirrors PNumber --size SizeMB VGOO: --stripesize SizeKB, --mirrorlog MirrorLog, OO_LVCREATE_RAID, OO_LVCREATEOP: PV ...IO: --stripes 1ID: lvcreate_mirror_or_raid1DESC: Create a raid1 or mirror LV.DESC: Implicit type is defined by lvm.conf global/mirror_segtype_default.AUTOTYPE: raid1AUTOTYPE: mirrorlvcreate --type raid --size SizeMB VGOO: --mirrors PNumber, --stripes Number, --stripesize SizeKB,OO_LVCREATE_RAID, OO_LVCREATEOP: PV ...ID: lvcreate_raid_anyDESC: Create a raid LV (a specific raid level must be used, e.g. raid1).lvcreate --mirrors PNumber --stripes Number --size SizeMB VGOO: --stripesize SizeKB, OO_LVCREATE_RAID, OO_LVCREATEOP: PV ...ID: lvcreate_raid_anyDESC: Create a raid10 LV.AUTOTYPE: raid10lvcreate --type snapshot --size SizeMB LVOO: --snapshot, --stripes Number, --stripesize SizeKB,--chunksize SizeKB, OO_LVCREATEOP: PV ...ID: lvcreate_cow_snapshotDESC: Create a COW snapshot LV of an origin LVDESC: (also see --snapshot).FLAGS: SECONDARY_SYNTAXlvcreate --snapshot --size SizeMB LVOO: --stripes Number, --stripesize SizeKB,--chunksize SizeKB, OO_LVCREATEOP: PV ...ID: lvcreate_cow_snapshotDESC: Create a COW snapshot LV of an origin LV.AUTOTYPE: snapshotlvcreate --type snapshot --size SizeMB --virtualsize SizeMB VGOO: --snapshot, --chunksize SizeKB, OO_LVCREATEOP: PV ...ID: lvcreate_cow_snapshot_with_virtual_originDESC: Create a sparse COW snapshot LV of a virtual origin LVDESC: (also see --snapshot).FLAGS: SECONDARY_SYNTAXlvcreate --type thin-pool --size SizeMB VGOO: --thinpool LV_new, --stripes Number, --stripesize SizeKB,--thin, OO_LVCREATE_THINPOOL, OO_LVCREATEOP: PV ...IO: --mirrors 0ID: lvcreate_thinpoolDESC: Create a thin pool.lvcreate --thin --size SizeMB VGOO: --stripes Number, --stripesize SizeKB, OO_LVCREATE_THINPOOL, OO_LVCREATEOP: PV ...IO: --mirrors 0ID: lvcreate_thinpoolDESC: Create a thin pool.FLAGS: SECONDARY_SYNTAXAUTOTYPE: thin-poollvcreate --size SizeMB --thinpool LV_new VGOO: --stripes Number, --stripesize SizeKB,--thin, OO_LVCREATE_THINPOOL, OO_LVCREATEOP: PV ...IO: --mirrors 0ID: lvcreate_thinpoolDESC: Create a thin pool named in --thinpool.FLAGS: SECONDARY_SYNTAXAUTOTYPE: thin-poollvcreate --type cache-pool --size SizeMB VGOO: --stripes Number, --stripesize SizeKB,--cache, OO_LVCREATE_CACHE, OO_LVCREATE_POOL, OO_LVCREATEOP: PV ...ID: lvcreate_cachepoolDESC: Create a cache pool.lvcreate --type cache-pool --size SizeMB --cachepool LV_new VGOO: --stripes Number, --stripesize SizeKB,--cache, OO_LVCREATE_CACHE, OO_LVCREATE_POOL, OO_LVCREATEOP: PV ...ID: lvcreate_cachepoolDESC: Create a cache pool named by the --cachepool argDESC: (variant, uses --cachepool in place of --name).FLAGS: SECONDARY_SYNTAXlvcreate --type thin --virtualsize SizeMB --thinpool LV_thinpool VGOO: --thin, OO_LVCREATEIO: --mirrors 0ID: lvcreate_thin_volDESC: Create a thin LV in a thin pool.FLAGS: SECONDARY_SYNTAXlvcreate --type thin --virtualsize SizeMB LV_thinpoolOO: --thin, OO_LVCREATEIO: --mirrors 0ID: lvcreate_thin_volDESC: Create a thin LV in a thin pool named in the first argDESC: (variant, also see --thinpool for naming pool).FLAGS: SECONDARY_SYNTAXlvcreate --virtualsize SizeMB --thinpool LV_thinpool VGOO: --thin, OO_LVCREATEIO: --mirrors 0ID: lvcreate_thin_volDESC: Create a thin LV in a thin pool.AUTOTYPE: thinlvcreate --virtualsize SizeMB LV_thinpoolOO: --thin, OO_LVCREATEIO: --mirrors 0ID: lvcreate_thin_volDESC: Create a thin LV in the thin pool named in the first argDESC: (also see --thinpool for naming pool.)FLAGS: SECONDARY_SYNTAXAUTOTYPE: thinlvcreate --type thin LV_thinOO: --thin, --snapshot, OO_LVCREATEIO: --mirrors 0ID: lvcreate_thin_snapshotDESC: Create a thin LV that is a snapshot of an existing thin LV.FLAGS: SECONDARY_SYNTAXlvcreate --thin LV_thinOO: --snapshot, OO_LVCREATEIO: --mirrors 0ID: lvcreate_thin_snapshotDESC: Create a thin LV that is a snapshot of an existing thin LV.FLAGS: SECONDARY_SYNTAXAUTOTYPE: thinlvcreate --snapshot LV_thinOO: OO_LVCREATEIO: --mirrors 0ID: lvcreate_thin_snapshotDESC: Create a thin LV that is a snapshot of an existing thin LV.AUTOTYPE: thinlvcreate --type thin --thinpool LV_thinpool LVOO: --thin, OO_LVCREATEIO: --mirrors 0ID: lvcreate_thin_snapshot_of_externalDESC: Create a thin LV that is a snapshot of an external origin LV.lvcreate --snapshot --thinpool LV_thinpool LVOO: OO_LVCREATEIO: --mirrors 0ID: lvcreate_thin_snapshot_of_externalDESC: Create a thin LV that is a snapshot of an external origin LV.FLAGS: SECONDARY_SYNTAXAUTOTYPE: thinlvcreate --type vdo --size SizeMB VGOO: --stripes Number, --stripesize SizeKB,--vdo, --virtualsize SizeMB, --vdopool LV_new, OO_LVCREATE_VDO, OO_LVCREATEOP: PV ...IO: --mirrors 0ID: lvcreate_vdo_volDESC: Create a LV that returns VDO when used.lvcreate --vdo --size SizeMB VGOO: --stripes Number, --stripesize SizeKB,--virtualsize SizeMB, --vdopool LV_new, OO_LVCREATE_VDO, OO_LVCREATEOP: PV ...IO: --mirrors 0ID: lvcreate_vdo_volDESC: Create a VDO LV with VDO pool.FLAGS: SECONDARY_SYNTAXAUTOTYPE: vdolvcreate --vdopool LV_new --size SizeMB VGOO: --stripes Number, --stripesize SizeKB,--virtualsize SizeMB, OO_LVCREATE_VDO, OO_LVCREATEOP: PV ...IO: --mirrors 0ID: lvcreate_vdo_volDESC: Create a VDO LV with VDO pool.FLAGS: SECONDARY_SYNTAXAUTOTYPE: vdolvcreate --type thin --virtualsize SizeMB --size SizeMB --thinpool LV_new VGOO: --stripes Number, --stripesize SizeKB,--thin, OO_LVCREATE_THINPOOL, OO_LVCREATEOP: PV ...IO: --mirrors 0ID: lvcreate_thin_vol_and_thinpoolDESC: Create a thin LV, first creating a thin pool for it,DESC: where the new thin pool is named by the --thinpool arg.FLAGS: SECONDARY_SYNTAXlvcreate --virtualsize SizeMB --size SizeMB --thinpool LV_new VGOO: --stripes Number, --stripesize SizeKB,--thin, OO_LVCREATE_THINPOOL, OO_LVCREATEOP: PV ...IO: --mirrors 0ID: lvcreate_thin_vol_and_thinpoolDESC: Create a thin LV, first creating a thin pool for it,DESC: where the new thin pool is named by --thinpool.FLAGS: SECONDARY_SYNTAXAUTOTYPE: thinlvcreate --type thin --virtualsize SizeMB --size SizeMB LV_new|VGOO: --stripes Number, --stripesize SizeKB,--thin, OO_LVCREATE_THINPOOL, OO_LVCREATEOP: PV ...IO: --mirrors 0ID: lvcreate_thin_vol_and_thinpoolDESC: Create a thin LV, first creating a thin pool for it,DESC: where the new thin pool is named in the first arg,DESC: or the new thin pool name is generated when the firstDESC: arg is a VG name.FLAGS: SECONDARY_SYNTAXlvcreate --thin --virtualsize SizeMB --size SizeMB LV_new|VGOO: --stripes Number, --stripesize SizeKB,OO_LVCREATE_THINPOOL, OO_LVCREATEOP: PV ...IO: --mirrors 0ID: lvcreate_thin_vol_and_thinpoolDESC: Create a thin LV, first creating a thin pool for it,DESC: where the new thin pool is named in the first arg,DESC: or the new thin pool name is generated when the firstDESC: arg is a VG name.FLAGS: SECONDARY_SYNTAXAUTOTYPE: thinlvcreate --size SizeMB --virtualsize SizeMB VGOO: --stripes Number, --stripesize SizeKB, --snapshot, --thin,OO_LVCREATE_THINPOOL, OO_LVCREATEOP: PV ...IO: --mirrors 0ID: lvcreate_thin_vol_with_thinpool_or_sparse_snapshotDESC: Create a thin LV, first creating a thin pool for it.DESC: Create a sparse snapshot of a virtual origin LVDESC: Chooses type thin or snapshot according toDESC: config setting sparse_segtype_default.FLAGS: SECONDARY_SYNTAXAUTOTYPE: thinAUTOTYPE: snapshotlvcreate --type cache --size SizeMB --cachepool LV_cachepool VGOO: --stripes Number, --stripesize SizeKB,--cache, OO_LVCREATE_CACHE, OO_LVCREATE_POOL, OO_LVCREATEOP: PV ...ID: lvcreate_and_attach_cachepoolDESC: Create a new LV, then attach the specified cachepoolDESC: which converts the new LV to type cache.lvcreate --size SizeMB --cachepool LV_cachepool VGOO: --stripes Number, --stripesize SizeKB,--cache, OO_LVCREATE_CACHE, OO_LVCREATEOP: PV ...ID: lvcreate_and_attach_cachepool_v2DESC: Create a new LV, then attach the specified cachepoolDESC: which converts the new LV to type cache.FLAGS: SECONDARY_SYNTAXAUTOTYPE: cachelvcreate --type cache --size SizeMB LV_cachepoolOO: --stripes Number, --stripesize SizeKB,--cache, OO_LVCREATE_CACHE, OO_LVCREATE_POOL, OO_LVCREATEOP: PV ...ID: lvcreate_and_attach_cachepool_v3DESC: Create a new LV, then attach the specified cachepoolDESC: which converts the new LV to type cache.DESC: (variant, also use --cachepool).FLAGS: SECONDARY_SYNTAXlvcreate --cache --size SizeMB LVOO: OO_LVCREATE_CACHE, OO_LVCREATE_POOL, OO_LVCREATE,--stripes Number, --stripesize SizeKBOP: PV ...ID: lvcreate_new_plus_old_cachepool_or_lvconvert_old_plus_new_cachepoolDESC: When the LV arg is a cachepool, then create a new LV andDESC: attach the cachepool arg to it.DESC: (variant, use --type cache and --cachepool.)DESC: When the LV arg is not a cachepool, then create a new cachepoolDESC: and attach it to the LV arg (alternative, use lvconvert.)FLAGS: SECONDARY_SYNTAXAUTOTYPE: cachelvcreate --type cache --size SizeMB --cachevol LV VGOO: --stripes Number, --stripesize SizeKB, OO_LVCREATE_CACHE, OO_LVCREATEOP: PV ...ID: lvcreate_and_attach_cachevol_for_cacheDESC: Create a new LV, then attach the specified cachevolDESC: which converts the new LV to type cache.lvcreate --type cache --size SizeMB --cachedevice PV VGOO: --stripes Number, --stripesize SizeKB,--cachesize SizeMB, OO_LVCREATE_CACHE, OO_LVCREATEOP: PV ...ID: lvcreate_and_attach_cachedevice_for_cacheDESC: Create a new LV, then attach a cachevol created fromDESC: the specified cache device, which converts theDESC: new LV to type cache.lvcreate --type writecache --size SizeMB --cachevol LV VGOO: OO_LVCREATE, --cachesettings String, --stripes Number, --stripesize SizeKBOP: PV ...ID: lvcreate_and_attach_cachevol_for_writecacheDESC: Create a new LV, then attach the specified cachevolDESC: which converts the new LV to type writecache.lvcreate --type writecache --size SizeMB --cachedevice PV VGOO: OO_LVCREATE, --cachesize SizeMB, --cachesettings String, --stripes Number, --stripesize SizeKBOP: PV ...ID: lvcreate_and_attach_cachedevice_for_writecacheDESC: Create a new LV, then attach a cachevol created fromDESC: the specified cache device, which converts theDESC: new LV to type writecache.lvdisplayOO: OO_REPORTING, --all, --history, --segments, --mapsOP: VG|LV|Tag ...IO: --partial, --ignoreskippedclusterID: lvdisplay_generallvdisplay --columnsOO: OO_REPORT, --history, --segmentsOP: VG|LV|Tag ...IO: --partial, --ignoreskippedclusterRULE: --noheadings not --headingsID: lvdisplay_columnsDESC: Display output in columns like lvs.lvdisplay --colonOO: OO_REPORTING, --all, --history, --segmentsOP: VG|LV|Tag ...IO: --partial, --ignoreskippedclusterID: lvdisplay_colonDESC: Generate colon separated output.lvextend --size PSizeMB LVOO: --alloc Alloc, --autobackup Bool, --force, --mirrors Number,--nofsck, --nosync, --noudevsync, --reportformat ReportFmt, --resizefs,--stripes Number, --stripesize SizeKB, --poolmetadatasize PSizeMB,--type SegType, --fs String, --fsmode StringOP: PV ...ID: lvextend_sizeDESC: Extend an LV by a specified size.lvextend LV PV ...OO: --alloc Alloc, --autobackup Bool, --force, --mirrors Number,--nofsck, --nosync, --noudevsync,--reportformat ReportFmt, --resizefs, --stripes Number, --stripesize SizeKB,--type SegType, --fs String, --fsmode StringID: lvextend_pvDESC: Extend an LV by specified PV extents.lvextend --poolmetadatasize PSizeMB LV_thinpool_linearOO: --alloc Alloc, --autobackup Bool, --force, --mirrors Number,--nofsck, --nosync, --noudevsync,--reportformat ReportFmt, --stripes Number, --stripesize SizeKB,--type SegTypeOP: PV ...ID: lvextend_pool_metadataDESC: Extend a pool metadata SubLV by a specified size.lvextend --usepolicies LV_snapshot_thinpool_vdopoolOO: --alloc Alloc, --autobackup Bool, --force, --mirrors Number,--nofsck, --nosync, --noudevsync,--reportformat ReportFmt, --resizefs,--type SegType, --fs String, --fsmode StringOP: PV ...ID: lvextend_policyDESC: Extend an LV according to a predefined policy.lvmconfigOO: OO_CONFIGOP: String ...ID: lvmconfig_generallvmdevicesID: lvmdevices_listDESC: Print devices in the devices file.lvmdevices --checkID: lvmdevices_checkOO: --refreshDESC: Check the devices file and report incorrect values.lvmdevices --updateOO: --delnotfound, --refreshID: lvmdevices_updateDESC: Update the devices file to fix incorrect values.lvmdevices --adddev PVOO: --deviceidtype StringID: lvmdevices_editDESC: Add a device to the devices file.lvmdevices --deldev PV|StringOO: --deviceidtype StringID: lvmdevices_editDESC: Remove a device from the devices file.lvmdevices --addpvid StringOO: --deviceidtype StringID: lvmdevices_editDESC: Find the device with the given PVID and add it to the devices file.lvmdevices --delpvid StringID: lvmdevices_editDESC: Remove the devices file entry for the given PVID.lvreduce --size NSizeMB LVOO: --autobackup Bool, --force, --nofsck, --noudevsync,--reportformat ReportFmt, --resizefs, --fs String, --fsmode StringID: lvreduce_sizelvremove VG|LV|Tag|Select ...OO: --autobackup Bool, --force, --nohistory, --noudevsync,--reportformat ReportFmt, --select StringID: lvremove_generallvrename VG LV LV_newOO: --autobackup Bool, --noudevsync, --reportformat ReportFmtID: lvrename_vg_lv_lvlvrename LV LV_newOO: --autobackup Bool, --noudevsync, --reportformat ReportFmtID: lvrename_lv_lvlvresize --size SSizeMB LVOO: --alloc Alloc, --autobackup Bool, --force,--nofsck, --nosync, --noudevsync, --reportformat ReportFmt, --resizefs,--stripes Number, --stripesize SizeKB, --poolmetadatasize PSizeMB,--type SegType, --fs String, --fsmode StringOP: PV ...ID: lvresize_sizeDESC: Resize an LV by a specified size.lvresize LV PV ...OO: --alloc Alloc, --autobackup Bool, --force,--nofsck, --nosync, --noudevsync,--reportformat ReportFmt, --resizefs, --stripes Number, --stripesize SizeKB,--type SegType, --fs String, --fsmode StringID: lvresize_pvDESC: Resize an LV by specified PV extents.lvresize --poolmetadatasize PSizeMB LV_thinpoolOO: --alloc Alloc, --autobackup Bool, --force,--nofsck, --nosync, --noudevsync,--reportformat ReportFmt, --stripes Number, --stripesize SizeKB,--type SegTypeOP: PV ...ID: lvresize_pool_metadataDESC: Resize a pool metadata SubLV by a specified size.lvsOO: --history, --segments, OO_REPORTOP: VG|LV|Tag ...IO: --partial, --ignoreskippedcluster, --trustcacheID: lvs_generalRULE: --noheadings not --headingslvscanOO: --all, --blockdevice, --ignorelockingfailure,--readonly, --reportformat ReportFmtIO: --partial, --cache_longID: lvscan_generalOO_PVCHANGE: --autobackup Bool, --force, --reportformat ReportFmtOO_PVCHANGE_META: --allocatable Bool, --addtag Tag, --deltag Tag,--uuid, --metadataignore Boolpvchange --all OO_PVCHANGE_METAOO: OO_PVCHANGEIO: --ignoreskippedclusterID: pvchange_properties_allDESC: Change properties of all PVs.pvchange OO_PVCHANGE_META PV|Select ...OO: --select String, OO_PVCHANGEIO: --ignoreskippedclusterID: pvchange_properties_someDESC: Change properties of specified PVs.pvresize PV ...OO: --setphysicalvolumesize SizeMB, --reportformat ReportFmt, --autobackup BoolID: pvresize_generalpvck PV ...OO: --labelsector NumberID: pvck_generalDESC: Check for metadata on a devicepvck --dump DumpType PVOO: --settings String, --file String,--pvmetadatacopies MetadataCopiesPV, --labelsector NumberID: pvck_dumpDESC: Check and print LVM headers and metadata on a devicepvck --repairtype RepairType PVOO: --settings String, --file String, --labelsector NumberID: pvck_repair_typeDESC: Repair LVM headers or metadata on a devicepvck --repair --file String PVOO: --settings String, --labelsector NumberID: pvck_repairDESC: Repair LVM headers and metadata on a devicepvcreate PV ...OO: --dataalignment SizeKB, --dataalignmentoffset SizeKB, --bootloaderareasize SizeMB,--force, --labelsector Number, --metadatatype MetadataType,--pvmetadatacopies MetadataCopiesPV, --metadatasize SizeMB,--metadataignore Bool, --norestorefile, --setphysicalvolumesize SizeMB,--reportformat ReportFmt, --restorefile String, --uuidstr String, --zero BoolID: pvcreate_generalRULE: --norestorefile not --restorefileRULE: --bootloaderareasize not --restorefilepvdisplayOO: OO_REPORTING, --maps, --segments, --shortOP: PV|Tag ...IO: --partial, --ignoreskippedclusterID: pvdisplay_generalpvdisplay --columnsOO: OO_REPORT, --segmentsOP: PV|Tag ...IO: --partial, --ignoreskippedclusterRULE: --noheadings not --headingsID: pvdisplay_columnsDESC: Display output in columns like pvs.pvdisplay --colonOO: OO_REPORTING, --segmentsOP: PV|Tag ...IO: --partial, --ignoreskippedclusterID: pvdisplay_colonDESC: Generate colon separated output.pvmove PVOO: --abort, --alloc Alloc, --atomic, --autobackup Bool, --background,--interval Number, --name LV, --noudevsync, --reportformat ReportFmtOP: PV ...ID: pvmove_oneDESC: Move PV extents.pvmoveOO: --abort, --background, --interval NumberID: pvmove_anyDESC: Continue or abort existing pvmove operations.pvremove PV ...OO: --force, --reportformat ReportFmtID: pvremove_generalpvsOO: --segments, --allpvs, OO_REPORTOP: PV|Tag ...IO: --partial, --ignoreskippedcluster, --trustcacheID: pvs_generalRULE: --noheadings not --headingspvscanOO: --ignorelockingfailure, --reportformat ReportFmt, --exported, --novolumegroup,--short, --uuid, --allpvsID: pvscan_displayDESC: Display PV information.pvscan --cache_longOO: --ignorelockingfailure, --reportformat ReportFmt,--major Number, --minor Number, --noudevsyncOP: PV|String ...IO: --backgroundID: pvscan_cacheDESC: Record that a PV is online or offline.pvscan --cache_long --activate ayOO: --ignorelockingfailure, --reportformat ReportFmt,--major Number, --minor Number, --noudevsync, --autoactivation StringOP: PV|String ...IO: --backgroundID: pvscan_cacheDESC: Record that a PV is online and autoactivate the VG if complete.pvscan --cache_long --listvg PVOO: --ignorelockingfailure, --checkcomplete, --vgonline, --udevoutput,--autoactivation StringID: pvscan_cacheDESC: Record that a PV is online and list the VG using the PV.pvscan --cache_long --listlvs PVOO: --ignorelockingfailure, --checkcomplete, --vgonlineID: pvscan_cacheDESC: Record that a PV is online and list LVs using the PV.pvscan --listlvs PVID: pvscan_cacheDESC: List LVs using the PV.pvscan --listvg PVID: pvscan_cacheDESC: List the VG using the PV.vgcfgbackupOO: --file String, --foreign, --ignorelockingfailure, --readonly,--reportformat ReportFmtOP: VG ...IO: --partialID: vgcfgbackup_generalOO_VGCFGRESTORE: --force_long, --metadatatype MetadataTypevgcfgrestore VGOO: OO_VGCFGRESTOREID: vgcfgrestore_by_vgDESC: Restore VG metadata from last backup.vgcfgrestore --file String VGOO: OO_VGCFGRESTOREID: vgcfgrestore_by_fileDESC: Restore VG metadata from specified file.vgcfgrestore --list VGOO: OO_VGCFGRESTOREID: vgcfgrestore_list_by_vgDESC: List all VG metadata backups.vgcfgrestore --list --file StringOO: OO_VGCFGRESTOREOP: VGID: vgcfgrestore_list_by_fileDESC: List one VG metadata backup file.OO_VGCHANGE: --autobackup Bool, --ignoremonitoring,--noudevsync, --reportformat ReportFmt, --select String, --forceOO_VGCHANGE_META: --addtag Tag, --deltag Tag,--logicalvolume Uint32, --maxphysicalvolumes Uint32, --alloc Alloc, --uuid,--pvmetadatacopies MetadataCopiesPV, --vgmetadatacopies MetadataCopiesVG,--physicalextentsize SizeMB, --resizeable Bool,--detachprofile, --metadataprofile String,--setautoactivation Boolvgchange OO_VGCHANGE_METAOO: --poll Bool, OO_VGCHANGEOP: VG|Tag|Select ...IO: --ignoreskippedclusterID: vgchange_propertiesDESC: Change a general VG attribute.DESC: For options listed in parentheses, any one isDESC: required, after which the others are optional.vgchange --monitor BoolOO: --sysinit, --ignorelockingfailure, --poll Bool, OO_VGCHANGEOP: VG|Tag|Select ...IO: --ignoreskippedclusterID: vgchange_monitorDESC: Start or stop monitoring LVs from dmeventd.vgchange --poll BoolOO: --ignorelockingfailure, OO_VGCHANGEOP: VG|Tag|Select ...IO: --ignoreskippedclusterID: vgchange_pollDESC: Start or stop processing LV conversions.vgchange --activate ActiveOO: --activationmode ActivationMode, --ignoreactivationskip, --partial, --sysinit,--readonly, --ignorelockingfailure, --monitor Bool, --poll Bool,--autoactivation String, OO_VGCHANGEOP: VG|Tag|Select ...IO: --ignoreskippedclusterID: vgchange_activateDESC: Activate or deactivate LVs.vgchange --refreshOO: --sysinit, --ignorelockingfailure, --poll Bool, OO_VGCHANGEOP: VG|Tag|Select ...IO: --ignoreskippedclusterID: vgchange_refreshDESC: Reactivate LVs using the latest metadata.vgchange --systemid String VG|Tag|SelectOO: --select String, --majoritypvsID: vgchange_systemidDESC: Change the system ID of a VG.vgchange --lockstartOO: --select StringOP: VG|Tag|Select ...ID: vgchange_lockstartDESC: Start the lockspace of a shared VG in lvmlockd.vgchange --lockstopOO: --select StringOP: VG|Tag|Select ...ID: vgchange_lockstopDESC: Stop the lockspace of a shared VG in lvmlockd.vgchange --locktype LockType VGID: vgchange_locktypeDESC: Change the lock type for a shared VG.vgckOO: --reportformat ReportFmtOP: VG|Tag ...ID: vgck_generalDESC: Read and display information about a VG.vgck --updatemetadata VGID: vgck_update_metadataDESC: Rewrite VG metadata to correct problems.vgcreate VG_new PV ...OO: --addtag Tag, --alloc Alloc, --autobackup Bool, --clustered Bool, --maxlogicalvolumes Uint32,--maxphysicalvolumes Uint32, --metadataprofile String, --metadatatype MetadataType,--physicalextentsize SizeMB, --force, --zero Bool, --labelsector Number,--metadatasize SizeMB, --pvmetadatacopies MetadataCopiesPV, --vgmetadatacopies MetadataCopiesVG,--reportformat ReportFmt, --dataalignment SizeKB, --dataalignmentoffset SizeKB,--shared, --systemid String, --locktype LockType, --setautoactivation BoolID: vgcreate_generalvgdisplayOO: OO_REPORTING, --short, --activevolumegroupsOP: VG|Tag ...IO: --partial, --ignoreskippedclusterID: vgdisplay_generalvgdisplay --columnsOO: OO_REPORTOP: VG|Tag ...IO: --partial, --ignoreskippedclusterRULE: --noheadings not --headingsID: vgdisplay_columnsDESC: Display output in columns like vgs.vgdisplay --colonOO: OO_REPORTING, --activevolumegroupsOP: VG|Tag ...IO: --partial, --ignoreskippedclusterID: vgdisplay_colonDESC: Generate colon separated output.OO_VGEXPORT: --reportformat ReportFmtvgexport VG|Tag|Select ...OO: --select String, OO_VGEXPORTID: vgexport_someDESC: Export specified VGs.vgexport --allOO: OO_VGEXPORTID: vgexport_allDESC: Export all VGs.vgextend VG PV ...OO: --autobackup Bool,--force, --zero Bool, --labelsector Number, --metadatatype MetadataType,--metadatasize SizeMB, --pvmetadatacopies MetadataCopiesPV,--metadataignore Bool, --dataalignment SizeKB, --dataalignmentoffset SizeKB,--reportformat ReportFmt, --restoremissingID: vgextend_generalOO_VGIMPORT: --force, --reportformat ReportFmtvgimport VG|Tag|Select ...OO: --select String, OO_VGIMPORTID: vgimport_someDESC: Import specified VGs.vgimport --allOO: OO_VGIMPORTID: vgimport_allDESC: Import all VGs.vgimportclone PV ...OO: --basevgname VG, --import, --importdevicesID: vgimportclone_generalvgimportdevices VG|Tag|Select ...OO: --select String, --foreign, --reportformat ReportFmtID: vgimportdevices_someDESC: Add devices from specific VGs to the devices file.vgimportdevices --allOO: --foreign, --reportformat ReportFmtID: vgimportdevices_allDESC: Add devices from all accessible VGs to the devices file.vgimportdevices --rootvgOO: --auto, --reportformat ReportFmtID: vgimportdevices_rootDESC: Add devices from root VG to the devices file.vgmerge VG VGOO: --autobackup Bool, --list, --poolmetadataspare BoolID: vgmerge_generalvgmknodesOO: --ignorelockingfailure, --refresh, --reportformat ReportFmtOP: VG|LV|Tag ...ID: vgmknodes_generalOO_VGREDUCE: --autobackup Bool, --force, --reportformat ReportFmtvgreduce VG PV ...OO: OO_VGREDUCEID: vgreduce_by_pvDESC: Remove a PV from a VG.vgreduce --all VGOO: OO_VGREDUCEID: vgreduce_allDESC: Remove all unused PVs from a VG.vgreduce --removemissing VGOO: --mirrorsonly, OO_VGREDUCEID: vgreduce_missingDESC: Remove all missing PVs from a VG.vgremove VG|Tag|Select ...OO: --force, --noudevsync, --reportformat ReportFmt, --select StringID: vgremove_generalvgrename VG VG_newOO: --autobackup Bool, --force, --reportformat ReportFmtID: vgrename_by_nameDESC: Rename a VG.vgrename String VG_newOO: --autobackup Bool, --force, --reportformat ReportFmtID: vgrename_by_uuidDESC: Rename a VG by specifying the VG UUID.vgsOO: OO_REPORTOP: VG|Tag ...IO: --partial, --ignoreskippedcluster, --trustcacheID: vgs_generalRULE: --noheadings not --headingsvgscanOO: --ignorelockingfailure, --mknodes, --notifydbus, --refresh,--reportformat ReportFmtIO: --partial, --cache_longID: vgscan_generalOO_VGSPLIT: --autobackup Bool, --poolmetadataspare BoolOO_VGSPLIT_NEW: --alloc Alloc,--maxlogicalvolumes Uint32, --maxphysicalvolumes Uint32,--metadatatype MetadataType, --vgmetadatacopies MetadataCopiesVGvgsplit VG VG PV ...OO: OO_VGSPLIT, OO_VGSPLIT_NEWID: vgsplit_by_pvDESC: Split a VG by specified PVs.vgsplit --name LV VG VGOO: OO_VGSPLIT, OO_VGSPLIT_NEWID: vgsplit_by_lvDESC: Split a VG by PVs in a specified LV.configOO: OO_CONFIGOP: String ...ID: lvmconfig_generaldumpconfigOO: OO_CONFIGOP: String ...ID: lvmconfig_generaldevtypesOO: --aligned, --binary, --nameprefixes, --noheadings,--nosuffix, --options String, --reportformat ReportFmt, --rows,--select String, --separator String, --sort String, --unbuffered, --unquotedID: devtypes_generalfullreportOO: OO_REPORTOP: VG ...IO: --partial, --ignoreskippedcluster, --trustcacheID: fullreport_generalRULE: --noheadings not --headingslastlogOO: --reportformat ReportFmt, --select StringID: lastlog_generallvpoll --polloperation PollOp LV ...OO: --abort, --autobackup Bool, --handlemissingpvs, --interval NumberID: lvpoll_generalformatsID: formats_generalhelpOP: String ...ID: help_generalversionID: version_generalpvdataID: pvdata_generalsegtypesID: segtypes_generalsystemidID: systemid_generaltagsID: tags_generallvmchangeID: lvmchange_generallvmdiskscanOO: --lvmpartition, --readonlyID: lvmdiskscan_generallvmsadcID: lvmsadc_generallvmsarOO: --full, --stdinID: lvmsar_generalvgconvert VG ...OO: --force, --labelsector Number, --bootloaderareasize SizeMB,--metadatatype MetadataType, --pvmetadatacopies MetadataCopiesPV,--metadatasize SizeMB, --reportformat ReportFmtID: vgconvert_generalCreating directory %s.%s/block/bdiremovableslavetraceuevent%sblock/%s/%s/devclustered-userspace %u %s clustered-%s%s %u nosync block_on_error 1 handle_errors%s %s %c %d%u %u %s%s%s%s%s %s %lu %s %d %u rebuild %u min_recovery_rate %u max_recovery_rate %u write_mostly %u max_write_behind %u region_size %u raid10_copies %u delta_disks %d data_offset %d%s %d%s metadata2 passthrough writeback writethrough migration_threshold %u %s %lu%s %s %s %u %d high_watermark %llu low_watermark %llu writeback_jobs %llu autocommit_blocks %llu autocommit_time %llu fua nofua cleaner max_age %u metadata_only pause_writeback %u meta_device:%s recalculate journal_sectors:%u interleave_sectors:%u buffer_sectors:%u journal_watermark:%u commit_time:%u bitmap_flush_interval:%u sectors_per_bit:%llu allow_discardsRetrying metadata scan.Couldn't find uuid.Invalid uuid.gethostnamenohostname%s/.lvm_%s_%d_%d# Hint only%s = [%s]Device %s: %s is %lu%s.missing deviceDevice not added.No devno %u:%u in dev cache.deviceiddeviceid filter initialised.Sysfs filter initialised.mpath filter initialised.md filter allocation failedsignature filter initialised.MD filter initialised.compositeComposite filter initialised.LVM type filter initialised.dev_iter allocation failed.Reading hint filehints_version:%d.%dglobal_filter:scan_lvs:devices_file:devs_hash:scan:pvid:devn:%d:%dadd hint %s %s %d:%d %saccept hints found %dread_hint_file close errno %dFound PVID %s on %sAdding pvid to hash failed %sDestroy lvmcache content O_EXCLRWRO%s: Not using O_NOATIME%s: Not using O_DIRECTOpened %s %s%s%sLeaving section (%s).Skipping: Deactivating %s.deactivatingdeactivated (reverting) pool only thin onlySkipping: Resuming %s%s%s.Resuming LV %s%s%s%s. if activeresumed origin without snapshotsSkipping: Suspending %s%s.already suspendedRequiring flush for LV %s.suspend_lvsfailed suspendMonitoredUnmonitored%s %s for events%s[%d]Pool %s is unlocked.Pool %s is locked.Creating %sFailed to set uuid for %sLoading table for %s.Unable to resume %s. (Ignoring.)Couldn't create path for %s/%s.WARNING: Ignoring RAID1 stripe sizeFailed to get %s target versions%s 0 %u %s %d fix_padding block_size:%u internal_hash:%sNo parameters supplied for %s target %u:%u.Adding target to (%u:%u): %lu %lu %s %sWARNING: bad metadata header on %s at %llu.Ignoring mda on device %s at offset %luMetadata location on %s at %llu has offset 0.Skipping read of already known VG metadata with matching mda checksum on %s.Reading metadata summary from %s at %llu size %d (+%d)WARNING: invalid metadata text from %s at %llu.WARNING: invalid metadata text from file.WARNING: metadata on %s at %llu has invalid summary for VG.WARNING: metadata on %s at %llu has invalid VG name.WARNING: bad metadata text on %s in mda%dFound metadata summary on %s at %llu size %llu for VG %sReading mda header sector from %s at %lluFailed to read metadata area header on %s at %lluWARNING: wrong checksum %x in mda header on %s at %lluWARNING: wrong magic number in mda header on %s at %lluWARNING: wrong version %u in mda header on %s at %lluWARNING: wrong start sector %llu in mda header on %s at %lluFailed to write mda header to %s.Not enough space to build temporary file string.Internal error: Metadata inconsistency: Not all flags successfully exported.Could not allocate memory for string list buffer.Failed to duplicate directory path %s.WARNING: Device %s: %s is %lu and is unexpectedly less than sector.WARNING: Ignoring %s = %lu for device %s (not divisible by 4KiB).Ignoring unknown multipath_wwids_file.multipath wwids file not foundmultipath wwids read %d from %sThe specified --deviceidtype %s is unknown.WARNING: ignoring unknown device_id type %s.The specified --deviceidtype %s is not available for %s.WARNING: ignoring deviceidtype %s which is not available for device.Replacing device id %s old %s new %sdevice_id_add %s pvid %s matches entry %p dev %s with same pvid %sdevice_id_add %s pvid %s matches entry %p dev %s with same device_id %d %sdevice_id_add %s pvid %s matches entry %p dev %s with same devname %sWARNING: adding device %s with PVID %s which is already used for %s device_id %s.WARNING: adding device %s with idname %s which is already used for missing device.Using separate entries for partitions of same device %s part %d %s part %d.WARNING: adding device %s with idname %s which is already used for %s.Add device with duplicate PV to devices file?Adding new entry to devices file for %s PVID %s %s %s.Updating existing entry in devices file for %s that matches %s %s.device_id_add %s pvid %s matches entry %p dev %sstr_list_to_str: string allocation failed.Internal error: connections must be initialized before filtersFailed to create global regex device filterFailed to create regex device filterLVM type filter allocation failedFailed to create lvm type filterdeviceid filter allocation failedFailed to create deviceid device filterNo proc filesystem found: skipping sysfs filterUsable device filter allocation failedUsable device filter mode allocation failedUsable device filter initialised (scan_lvs %d).Failed to create usable device filterNo proc filesystem found: skipping multipath filtermpath filter allocation failedPartitioned filter allocation failedFailed to create partitioned device filterFailed to create signature device filterFirmware RAID filter allocation failedFirmware RAID filter initialised.Composite filters allocation failed.Allocation of persistent filter failed.Allocation of device filter for persistent filter failed.Persistent filter initialised.Failed to create persistent device filter.Couldn't create hash table for persistent filter.Partitioned filter initialised.Internal error: Unable to attach pool to %s/%s that is not cache or thin volume.WARNING: sysfs path for %s attribute is too long.Skipping "%s" (symbolic link to directory).Skipping "%s" (different filesystem in directory).Checking fd limit for num_devs %u failed %dChecking fd limit for num_devs %u want %u soft %lld hard %lldSetting fd limit for num_devs %u soft %lld hard %lldWARNING: permission error setting open file limit for scanning %u devices.WARNING: cannot set open file limit for scanning %u devices.dev_iter values allocation failed.ignore hints with unknown version %d.%dignore hints with version %d.%d current %d.%dignore hints with different global_filterignore hints with different filterignore hints with different or unreadable scan_lvsignore hints with different devices_file: not enabled vs %signore hints with different devices_file: %s vs %signore hints with invalid devs_hashignore hints with read_hash %u count %u calc_hash %u count %uignore hints: no device matches devices file entry for %signore hints: devno %u:%u does not match %u:%u for %signore hints: no devices file entry for %sIgnoring lvmcache info for dev %s because dev %s was requested for PVID %s.lvmcache_info allocation failedSaving initial duplicate device %s previously seen on %s with PVID %s.Initial duplicate already in list %sChanging pvid on dev %s from %s to %sChanging labeller on dev %s from %s to %sInternal error: vginfos list should be emptyCannot open device %u:%u with no valid paths.%s: Already opened read-only. Upgrading to read-write.dev_open(%s) called while suspendedFailed to open device path %s (%d).%s: fstat failed: Has device name changed?Leaving critical section (%s).LV %s has open %d snapshot(s), not deactivating.Deactivated volume is still %s present.Not using origin only for suspend of %s.Internal error: LV %s missing from preload metadata.Internal error: LV %s (%s) missing from preload metadata.Checking VDO pool status for LV %s.WARNING: Failed to get uuid for dtree node %s._sysfs_get_kernel_name: failed to allocate temporary buffers_sysfs_get_kernel_name: dm_snprintf failedCould not locate device kernel name in sysfs path %s_sysfs_get_kernel_name: output buffer too smallCouldn't find snapshot COW device uuid %s.Couldn't find merging snapshot uuid %s.Using udev_flags 0x%x for activation of %s._deps: task run failed for (%u:%u)_deps: failed to get info for (%u:%u)Inconsistent dtree major number: %u != %uInconsistent dtree minor number: %u != %uInternal error: Pool %s is already unlocked.Internal error: Pool %s is already locked.Create dm_task creation failed for %sFailed to set device name for %sInternal error: Unable to get DM task info for %s.Reload dm_task creation failed for %s.Insufficient space for target parameters.Insufficient space in params[%zu] for target parameters.Target parameter size too big. Aborting.Suppressed %s identical table reload.Resume of table of extended device %s delayed.Table size changed from %lu to %lu for %s.%sGC@?@?D?G? @@?@@BCC<<<<<<<<<<<<<<<<<< #L$tIV2 %s %lu %u %lu %u %s %s %s read_only error_if_no_space no_discard_passdown ignore_discard skip_block_zeroing%s %s %d %lu %d%s%s%s%s%s%s%s %lucompression oncompression offindex-enableindex-disableParsing VDO status: %sRenaming %s (%u:%u) to %sName "%s" too longFailed to suspend %s (%u:%u) boolean array with values of type:Failed to duplicate filename.config_tree allocation failedLoading config file: %sFailed to load config file %s%H:%M:%S.%06d some losing %s resilienceCan't convert %s LV %s to %s.Adding metadata LVs to %s._extractedCan't convert %s to %s.Sending daemon %s: helloDaemon %s returned error %dprotocoldaemon_opensanlock lvmlock LV removedseqno = description = creation_time = -- Check confirm arg %s no info.Checking %s to confirm %.32s.Incomplete rangespecificationFailed to create config node.Removed %sRenamed %s to %sSELinux context resetselabel_open failed: %ssetfscreatecon%s: mknod for %s failed: %schownCreated %sUnstackingStackingdaemon_close in VG sub %s lockd %s result: bad responselockd %s result: no op_resultresult_flagsNO_LOCKSPACESNO_GL_LSNO_LMDUP_GL_LSWARN_GL_REMOVEDSH_EXISTSowner_host_idowner_generationowner_namelockd %s result: %dlockd_vg_update %svg_updatestart_waitLock start failedFailed to format %s device number for %s as dm target (%u,%u)Can create VDO data volume path for %s.Correcting VDO virtual volume size from %lu to %lu.V4 %s %lu %u %lu %u deduplication %s compression %s maxDiscard %u ack %u bio %u bioRotationInterval %u cpu %u hash %u logical %u physical %uExpected vdo target for %s and got %s.VDO needs message for compression %u(%u) and deduplication %u(%u).semid %d: sem_ctl GETVAL failed for cookie 0x%x: %sFailed to set a proper state for notification semaphore identified by cookie value %u (0x%x) to initialize waiting for incoming notifications.Udev cookie 0x%x (semid %d) waiting for zeroCould not set wait state for notification semaphore identified by cookie value %u (0x%x): %sRename dm_task creation failed for %sFailed to set name for %s rename.Non empty new name is required.Failed to mangle new device name "%s"New device name mangled [%s]: %s --> %sdm_task_set_newname: strdup(%s) failedFailed to rename %s (%u:%u) to %sFailed to build dev path for "%s".build_dm_name: Allocation failed for %zu %s %s.%s not found in config: defaulting to %dFailed to allocate config file.Internal error: config_file_read_fd: expected file, special file or profile config source, found %s config source.Failed to allocate circular buffer.WARNING: Metadata location on %s at offset %llu begins with invalid name.WARNING: Checksum error on %s at offset %llu.Internal error: _cmp_field_string_list: unknown list typeFailed to create bitset for regex match counter.Internal error: _cmp_field_string_list: unsupported string list type found, expecting either AND or OR list for selection field %sstruct mda_list allocation failedInvalid directory value, %s: not an absolute name.Invalid directory value, %s: name too long.Can't convert %s LV %s to %s with odd number of stripes.Can't convert %s LV %s to %s with != 2 legs.Internal error: Bogus new_image_count converting %s LV %s to %s.Can't convert %s LV %s to %s with < 3 legs.Reordering areas for raid10 -> raid0 takeover.Removing %u component LV pair(s) to %s.N number of data_copies "--mirrors N-1" may not be larger than number of stripes.Minimum of %u stripes needed for conversion from %s to %s.Adding %u component LV pair(s) to %s.Extracting last image component pair of %s temporarily.Adding extracted last image component pair back to %s to convert to %s.Reordering areas for raid0 -> raid10_near takeover.Updating VG metadata and reloading %s LV %s.%s: Opening daemon socket to %s for protocol %s version %d.%s: Daemon socket path too long.socket connect error %d for %sDaemon %s: requested protocol %s != %sDaemon %s: requested protocol version %d != %dFailed to remove sanlock LV %s/%sskip invalid metadata with len %llu at %llumetadata at %llu length %llu crc %08x vg %s seqno %u id %sWARNING: parse error for metadata at %lluWARNING: unexpected terminating bytes for metadata at %lluWARNING: metadata from multiple VGs was found.Failed to extract full metadata text at %llu, skipping.Check confirm arg %s no PVID foundCannot use device %s: it changed during prompt.Badly quoted character at end of expressiondm_report_field_uint64: dm_pool_alloc faileddm_report_field_uint64: uint64 too big: %ludm_report_field_int32: dm_pool_alloc faileddm_report_field_int32: int32 too big: %ddm_report_field_uint32: dm_pool_alloc faileddm_report_field_uint32: uint32 too big: %udm_report_field_int: dm_pool_alloc faileddm_report_field_int: int too big: %dFailed to allocate target segment area.Internal error: %s cfg tree element not declared as array.Failed to create default array node for %s.Node %s was not removed by udev. Falling back to direct node removal.A non-block device file at '%s' is already presentThe node %s should have been renamed to %s by udev but old node is still present. Falling back to direct old node removal.Unable to unlink device node for '%s'The node %s should have been renamed to %s by udev but new node is not present. Falling back to direct node rename.Unable to rename device node from '%s' to '%s'selabel_lookup failed for %s: %sPreparing SELinux context for %s to %s.Resetting SELinux context to default value.%s not set up by udev: Falling back to direct node creation.Insufficient memory to stack mknod operationCould not signal waiting process using notification semaphore identified by cookie value %u (0x%x)Closing daemon socket (fd %d).Can't report LV and PV fields at the same time in %sreport type "%s"%s%s.Subreport of type "%s" for VG %s contains columns which lead to change of report type. Add these columns to proper subreport type.Converting thin%s segment type for %s to %s is not supported.For pool data volume conversion use %s.For pool metadata volume conversion use %s.lockd %s result: reply error %dMissing global lock: global lock was lost by removing a previous VG.To enable the global lock in another VG, see lvmlockctl --gl-enable.HGGH(HhHHXG0I0IIJPJJIHIRQOOO@P@P@P@POOQOOOOOOOOOOOOOOOO@POOOOOOOOOOOOOOOOOOOOOOOOOOOPPOLPqqqqqtq\qDq4q$qqqppppppptpdpTpDp4pmmlooDonnl4nnmmtmdnttthtXt@t(tttssssxsXsHs8s(sssrrqxr_free_vgblocked_mirrors%d:%d %d:%d%s: %s device %s not usable.invalid snapshotsfrozen raidunusable_thins%sblock/dm-%d/vdo/%sFailed to build kvdo path.%skvdo/%s/%sstrtool_mlog_LV %s in not partial.%s has enough space for %s.%s_iorigraid5_lsraid6_zrraid5raid6raid10_near (same as %s%s)Failed to hash mda.Livelvfullname snprintf failedWriting hint file %d# info: duplicate_pvs # info: duplicate_vgnames # Created by %s pid %d %shints_version: %d.%d global_filter:%s scan_lvs:%d devices_file:%s devices_file:. devs_hash: %u %u unlink_newhints errno %d %sclose %s errno %dInterrupted initialization ofFailed to wipe signatures onInterrupted initializationFailed to initializeclose and reopen rw %s%s logical volume %s.BLKZEROOUTScan failed to open %u:%u %s.Scanning submitted %d readsScan failed to read %s.Scan failed to process %s%s: No lvm label detectedFailed to read vg %s from %sVG %s not found on %sFailed to open crypt path %s.crypt%sfs/btrfs/%s/devicessscanfdevice/filesystem_xfs.cXFS geometry openXFS geometry ioctlFailed to parse %s '%s'.%sdev/block/%u:%u/slaves%sblock/%s/device/wwidscsi_debugpvids: devs: differdevice is an md componentdevice is partitioneddevice has a signaturedevice is missing sysfs infodevice type is unknowndevice is not in devices filedevice is not in devices listdevice is an LVdevice is filteredlvmpolld failed to process a request. The reason was: %s.lvmpolld couldn't handle a request. It might be due to daemon internal state. The reason was: %s.Unexpected response %s. The reason: %s.%s: Empty device %s not usable.%s: Suspended device %s not usable.%s: Scanning mirror devices is disabled.%s: Mirror image %d marked as failed.%s: Mirror log device marked as failed.%s: Mirror device %s not usable.WARNING: Incorrect snapshot table found for %u:%u.WARNING: Incorrect snapshot-origin table found for %u:%u.%s: Invalid %s device %s not usable.%s: Frozen %s device %s not usable.WARNING: Cannot get thin-pool major:minor for thin device %u:%u.WARNING: %s: Thin's thin-pool needs inspection.%s: Error device %s not usable.WARNING: %s frozen raid device (%u:%u) needs inspection.%s: I/O blocked to mirror device._get_glv_str: dm_snprintf failedFailed to allocate string for new LV name.Can't rebuild raid with integrity.Can't replace any devices in %s LV %s.Unable to replace devices in %s while it is not in-sync.Unable to repair %s/%s. Source devices failed before the RAID could synchronize.You should choose one of the following: 1) deactivate %s/%s, revive failed device, re-activate LV, and proceed. 2) remove the LV (all data is lost). 3) Seek expert advice to attempt to salvage any data from remaining devices.Unable to replace RAID images while the array has unassigned areas.Logical volume %s does not contain devices specified to %s.%s does not contain devices specified to %s.Unable to %s all PVs from %s at once.Unable to %s more than %u PVs from (%s) %s.Unable to %s all the devices in a RAID10 mirror group.Failed to prevent PVs holding image components from being used for allocation.Failed to replace %u devices. Attempting to replace %u instead.%u extents needed to repair %s.Not enough space on %s for %s.Failed to allocate replacement images for %s.Failed to remove the specified images from %s.%s not allowed when converting %s LV %s.%s not allowed for LV %s when converting from %s to %s.Internal error: New segtype is not defined.Internal error: %s logical volume %s is not a user of %s.Removing historical connection between %s and %s.Internal error: historical_glv_remove: historical LV %s/-%s not found Historical LV %s/-%s already on removed list WARNING: Ignoring invalid string in config file entry allocation/cling_tag_listWARNING: Ignoring empty string in config file entry allocation/cling_tag_listWARNING: Ignoring string not starting with @ in config file entry allocation/cling_tag_list: %sWARNING: Ignoring empty tag in config file entry allocation/cling_tag_listNot using free space on %s: Matched allocation PV tag %s on existing parallel PV %s.Matched allocation PV tag %s on existing %s with free space on %s.Eliminating allocation area %u at PV %s start PE %u from consideration: PV tag %s already used.skip hint hash but found label %sexclude md component from hints %sscan:%s pvid:%s devn:%d:%d vg:%s Wrote hint file with devs_hash %u count %uwrite_hint_file close errno %dscan_dev_close %s no DEV_IN_BCACHE setscan_dev_close %s already closedVolume %s is not active locally (volume_list activation filter?).Name too long - device not cleared (%s)%s: not found: device not clearedFailed to open %s for wiping and zeroing.Wiping known signatures on logical volume %s.Metadata logical volume %s will be fully zeroed.Initializing %s of logical volume %s with value %d.Falling back to direct zeroing.%s logical volume %s with value %d and size %s.Metadata logical volume %s not fully zeroed and may contain stale data.Scanning %d devices for VG infoProcessing data from device %s %u:%u di %d.Ignoring additional label on %s at sector %llu%s: Label for sector %llu found at sector %llu - ignoring.Label checksum incorrect on %s - ignoringClear pvid and info for no lvm header %slabel scan found duplicate PVID %s on %sWARNING: scan failed to get metadata summary from %s PVID %sScanned devices: read errors %d process errors %d failed %dFound label at sector %llu on %sZero areas not allowed for segment %sMissing offset in areas array for segment %s.Bad offset in areas array for segment %s.Internal error: Cannot find pv name %s outside of _read_vg()WARNING: Failed to read metadata text at %llu off %llu size %llu VG %s on %sFound metadata text at %llu off %llu size %llu VG %s on %sFailed to generate backup filename (for removal).No file system info from blkid for %sCannot find active LUKS dm-crypt device using %s.Checking crypt device %s on LV %s.Failed to get crypt device size %s.No file system info from blkid for dm-crypt device %s on LV %s.Failed to get crypt data offset.Couldn't create btrfs devices path for %s.Couldn't create rdev path for %s.Couldn't get mount point for %s.xfs geometry blocksize %llu datablocks %llu fs_last_byte %llu from %s %s%sdev/block/%u:%u/loop/partscanSysfs path for partscan is too long.Sysfs path to check mpath components is too long.WARNING: Path %s is not a directory.Failed to create sysfs wwid path for %ssearched_devnames %s file pvids %d %u devs %d %u search pvids %d %u devs %d %udev_cache_index_devs: dm_snprintf failed._dev_cache_iterate_sysfs_for_index: %s: failed to get major and minor numberWARNING: Configuration setting %s is disabled. Using default value.device is rejected by filter configdevice is restricted internallydevice is a multipath componentdevice is too small (pv_min_size)device is not in a usable stateVG info not dropped before rescan of %sVG info not found after rescan of %sChecking transient status for LV %s.;TKi epKsK$O|QȂ Rۂ[[kT|O8Y^h r 8ʃ ݃X /4C@M$WaDz| $ d„0˄Մp"JD^#:!<* F4GAHsH|IJJ(KMdN`OPՆP߆QSXYZ$[.\7^[0_v`a͇bhc,d\eef#f-f7 iDiMiVi_ jh4jq\jzjjjj$kkkkˆlˈ,lԈTl݈|llllm mnxo5tp?r[tdtmuvy }}ى<~pXt @0xNXbl v HpdhŠ̊֊ػ @@&0:ؿDN(XPbxlv,ċ<׋xw8 )`3G@dndٍ L  < I Sg|zLtߎ+8/EMdFWZaPalX\0p+5?`isx}LH̐%.L'<'XȒ(KLhLLLȝM8LM؞`MhMHNNDO8OxPQXQ(,RRػRhTSS(SxdTTXLUU(VxdVXVV(|WxWXLXXhXYLYhYZ$[H[[X \L\x\(\]8D]]]^x4^8P^^ _ L_2b4tbx=dc8>c>c>c>c>d?d?,d(?@dh?Xdx?ld?d?d@dXA8eLtf8SfXgY ghZ?A D|EȅG8I\8KXKMOd8QS 8VlVhWЈX,HY[܉[ ^x__d8ftfhgg@hii jDklnth(T,`XhԒ؜8T8xhX|4tؖ Lx((08|(DdH|HXX(  L&6tJTL8XZbԧfff0gDhpHhiĨk48lP8q(z8zzԪ8|0}~īh@(HxHHDxLįh8̱0زx(hHTxd8x̷Hȹh̺ hĻph8 x HD(XlhhX x !!!08"P"p"(#x##$ h$,H&8'' X+,8..</l024D6h9H;<8=Lh>>>X@Tx@lAAB C88DXDx(EG0HLKKKLMDOQ@SZ8_L_tdxfDghijhXlqr<tuHw w0xylXz8{|(8|<l(X((4|HH4(8(X<hH,xXX,(`8(L8` 8 ((X3T83h38A8DtHxJ0JLKtL(RRSShT<Y8]|]a4ghhhHuXv(wXx0Hyxz{{~Ȁ lh$`8Ȍ$Ȑا0بh8 DxHxHX|ؽȾ8@8L,HtXXdxx8x(4(x(TlhXDHp(XL$H( 8 Hx8-`x./1P2x7D=ChCD(DXDDE XE,xH8I xJ\ (K xL XO (R HW@ Yl xp q4 (rT rh v v x0x`xy{{8hț8P(++.|01 34877D7pOXdY(](ag\ Xk k l (#Xx#H#$ %%%X%,&xH&t&&(@'H'p./X//$00041x 1 1 ,2$3H33$4`4X4 05#5$5%6&46'X6(6*6X+7h-D7XI9Nh:N:N:xO:O ;P,;Qp;hT;U(<hXl<Y<\ =]p=^=x_=x`>ah>b>Xc>hy?({,@{`@@0A8A BxB F4FlFFF8 G8Gh4HH(HIJlJJKPVx?VH@VA WEWG\XHX8IXHJ8YJlYLYLZMHZxNZ8P [R[S8\W\8Z,]]]^^H_$^_<^``^g^jP_l_n`(o\`Hq`sas,abhcHcc8LdeȢ,eXteex8ffȧfg,g@gȨTgبhg|gggg(g8gHgXhhhx0hDhXhlhhȩhةhhhhhh ixLiiجi(ixiȭ jHjhpjjjXjk8kHXkxkذkkXklر@lhlXllزlmX0mhDmطmmhn(nhHo8oprDssHttuuhv,vXv8vv(vXvhXwxwHww8Hxxx($dyx(z)hz*z8+z+ {,d{.{(9|:4}?}@}8E`~G~(G~G~HI0ILJh(KLMDNpQS<UH[[Ђb\HbtdHklHl\lp(mXmmmnhoh(ppqxt88{d~ȃhؖpXP8ȨX 8lȌ8px؎8LhhXА4`hВh(ȓ(4H`h`| L8xXH4Lhd|HИhX $H8`xXH8Й0x| Ț  d   P(@؝((\H(8lx($XH  !`"t("H""СH##8X$p$%+T-.1Ph1d1xh2334,(4@84T55ԥX67$8P9:GIHK|HLxNN4OxPHQQЩRhS8T(HUTxVXW̪XX,HYxYZH[,(\d(^ЬHc@dHfȭg HiP8j8klthmmHnȯnoop88qTqpqrذs$Xtp(uv@vTvhw|w(www̲xxxXy0yDyX(zlhzzzгX{{ |4x|\|(}}̴}x~XD|(8T|ȃ(ж(؈,hXиHHhHT$(<ȗTXl Th|(8HX̼hxȝ0DXtXԽؠX,ءTإXԾئX$8اL`XtبXĿةXت<XdثXج(Hxd|hH Ȼh((X<PdxX$Hhx0h\|H<8T,x80hLx88pHD <8pX L!(#%%& '8(.hx4@4T5?AXDD8H8K4RV`[`hhr\H(hh؛08DXDHX,H|x xD\t(88,8t((H x 4H|8<HPXd!(,(X/H>(AXExFHJRpxSVY0Y|Z]0^L`ab0Hdl8fg0(ik(m,8uxvw XxPxxxHyX(0HLhhȢ$THd88lȷ88X4H0tx`84Hxh   p  &X D (FP G I I(JDHJ`xJ|JJK(L,MlNOQtTZ@\dXixq vXv~lH80TȨhHh8T(p(L8(h8Tx| PX8X(xH8Xh4(X   ( 8!L!`!!!!(!$"L"8t""""hD###X$l$$X$$$h%$%D%X%hx%%%(%8%&8&(`&X|&& &8 &h ' ,'8 |'('@(h((()x ))) *A,BP,hD,xE,E-F8-8G\-Gx-H-H-8I-XJ.JD.XL\.P.Q/Y/Z/b0c0(m0m 1r|1H4ا 5855x466H078|7788xH9\99x,:x:h:XX;;;<<<xX=8=l>4?`?X??x? @@A LA%Ah/B/Bh1 Cx4C4C5C6D6XDZEbFxpG(zHIzI8tK8MMM8NNؿP_@_xE `Fl`G`hH`(Ppa(RahSbTdbYb]dAĨDEFH$HItIJxLMNlOxR`UH\lxaܭgggȮh h i4ijmHnpqlsбsht0u|zȲx@8lX0ؑDhĵ8(|P8`8Hع0X  `8  Ի8 H8(h(<̽84H(Ծh (<PX dH#H%ؿ%X&$&P')0|1X4H5T98:;(AHGH`8IOQDRhSHTXgg Xh Xi\lplt@huT(vv(ww\8xxxxyy(Ȃh(@phh؋LX،D8Hȣh(dh X(D( (8%x.PEIIXJJXL`P8k8m(n(p p$qrxswxyX~HhT8XH$dȘP<,xX<|$h(\((-X6(7@:;X?8AhXCDEDFXG8IP(XY8Zh`jXkk mtXoxp{x~<Ȉ8h 8Ȓؘtئ(ȫhx h@ȮT(X0  H8 ȸX Hx 8 \  |  xP  X$h|(H8H8x\(hlh((%X')(./H0<x456l78$X9p9:;,=x8=>(BDHpKXL8M$MhSW Y`Z[ x]8 c dX!Hf!g8"gL"m"h$X$ȃ$hh%%X%&L&&H,'H`'X'X0(()Hl))ع(*8`*L+<,,,X$--X-h...h/00d111H2(2t333H4\44zRx $FJ w?:*3$"D8(L\pHBBB B(A0A8G 8A0A(B BBBG HJaQAA N ABD _FBAH EABHKwFEB E(A0A8DP 8D0A(B BBBF |DHMFBE B(D0H8GpSxFdxApxHbxApF 8A0A(B BBBC  8F0A(B BBBE 0PnFIG N JGK eFBPX pQFNQ J(G0A8DPX\`EhKpKPL 8D0A(B BBBD hR"FBB B(A0A8G L@LC1 8A0A(B BBBH DCHCYCAC CICV WCTCMCACkCHC`HVFBE B(A0A8DPz 8D0A(B BBBD S 8J0D(B BBBG tXV[FEE E(D0D8G[GEBY[ 8D0A(B BBBB FKEN\3 @XCEG@` AC GHHPJXB`I@{HHPGXB`I@ 4Y9FBB B(A0A8D`ShJpHxBI`p 8D0A(B BBBA lhLpPxBI`uhGpHxBI`rhNpHxBI`NhJpJxBI`bhKpMxHI`HhJpExBI`EhJpHxBI`QhDpBxBM`chGpBxGN`|hMpExBI`VhJpJxBI`tD]FBB B(D0A8DA 8D0A(B BBBE IHJBIKGBIha9FBB B(A0D8D@X 8D0A(B BBBF DHKPIXB`I@HKPLXB`O@(16@lHbFIB B(D0C8G`D 8D0A(B BBBF DhJpGxBI`hKp@xAS`0`pdFGB B(D0D8DGJBIL 8D0A(B BBBF NdATLhFBA D(D@z (D ABBD DHKPIXB`I@LHjPHHA@XhFBB B(A0A8GPC 8D0A(B BBBK DXK`IhBpIPH jFBA D(D@C (D ABBC DHKPIXB`I@XLjFBB B(A0A8GPC 8D0A(B BBBK DXK`IhBpIPd$lDFAD | ABF D(K0I8B@I b(J0I8B@I W ABC ` ABE p nsFBB B(D0D8DHIBI 8A0A(B BBBH MdAp tZFBB E(I0D8DGJBIL 8D0A(B BBBB NdA xFGB E(A0D8DcHIBI~ 8D0A(B BBBI MbAWHJII KV 4 {FDD n ABA ABH |AFBB E(A0D8G@ 8D0A(B BBBJ D }FBD D(D0S (D ABBH ~8M@]8D0LX }(FBE I(C0 (D BBBE m(D BBB| ~FBB B(A0A8D_NARFdAT 8D0A(B BBBH DJHBNh( FFBB B(A0A8DpxFdxApT 8D0A(B BBBH DxKDBIp H X H D EDDPrXM`\XCPT AAG GXH`GhBpIP@ FAA D`dhHpJxII`T  DABA 4< AHD K AAF @AAHt fFEE E(A0D8G@n 8D0A(B BBBD 4 FAA G L!  AABI \ eFBB D(A0 (D BBBK e (D BBBA z(D BBBXaFFE B(D0A8G1RTAj 8A0A(B BBBE 1H[AMWBK[ASNA HZ jJGBI HJBIaMM ^ HS g HR XX$FIA A(D0 (D ABBE u (D ABBJ D(G DBB' 0 ̕EG0_ AD H/ FBB B(D0G8GM\C^ 8A0A(B BBBD HJBINOHZ' (̟FKG`a ABA (0FKG`g ABA (FGJ`o DBA ($FGJ`u DBA `P|WFMU A(I0z (F BBBH K (A BBBF h (C BBBG 8xFHA Q ABE P ABE DdFFA D(D` (D ABBA AhNpF`88FFB A(D` (D BBBA Ltإ FBD D(D0k (D ABBH a (D AEBC H@ A <H@ D |oFBB B(D0D8DP 8A0A(B BBBK ? 8C0A(B BBBE D 8F0A(B BBBE L|Щ[FBB A(G0 (D BBBI D (A BBBE (FBA qBBD@(FSO G(A0A8GD 8D0A(B BBBA 1ACCSH]ERNEAJEFSmEFMFGT|LFOFGPfMFOLlMFOLlMFOSaMFOQNaAAKoBFFA|NdARPBOLtD_NAJLHCSnNTAzNcAPSABPaBNtDoNmAOVB[ RE 'L^BNPWAdCnAl KQ DFnAMVBNYAPSBUFnAXFBB A(A0 (A EBBD I8O@W8A0p (D BBBF  FEF B(A0D8G` 8D0A(B BBBE [hMp\hA`hMpAxABAc`hFpJhF`hOpShB`hMpUhA`~hKpWhA`hJpHxHFFS` hMpAxABAO fhSpHxFDAN`4 FFD A(D0(A ABB(HHL D D L K M Kt6Hm  , T@BBB B(A0D8DPXC`hXHPG 8D0A(B BBBA HBBA D(J0n (G DBBH g(D ABB8 FHB B(H0I8GMYAX 8D0A(B BBBE _M]Bd ML @ PP _ ML O MT X PJ _ MJ _ MJ _ MJ _ MJ _ MJ _ MJ _ MJ _ MJ _ MJ _ MJ _M\Ad MJ ] FB D |6FAK { ABH h ABE O AEC DhtFAK  ABH h ABE M ABH H0@ H H0| D H$FID D(D0i (G DBBE }(D ABBH4xFID D(D0i (G DBBE }(D ABBHFID D(D0i (G DBBE }(D ABBL $FBB A(A0# (C BBBH g (A BBBB lFLB B(A0A8DgIdBIcB 8A0A(B BBBA <  FHB I(H0G8GMYAX 8D0A(B BBBE _M]Bd MT H PP _ ML _ MT _ MT _ MT _ MT j MJ _ MJ H MJ _ MJ _ MJ _ MJ _ MJ Z JE ` CE ` CE I FE bFX!AAG h AAE W(I0d(A f(H0^(A D AAH [(H0_(B ,(BAD  ABC \X FLA  BBI h BBD M(N0_(D A BBE e BBG 8 FBA A(D` (D ABBD @HEAD m(s0L(H  MMK P AAF 8 Z  P BHB B(H0G8G MO  MP M\A} 8D0A(B BBBC _MYAM MP O MT j MJ +FHB B(F0D8N ML `M\AX 8D0A(B BBBA  MQ ` MS X PP EPYAQ PP ,!< FHB B(H0I8G MM _MZEX 8D0A(B BBBH  MQ _ ML X PP   PP |MYAyPYAi MJ _ MJ E MJ _ MJ _ MJ x ME d DJ Z JE ^ JE S QE YJ""BBB B(D0D8DpZ 8D0A(B BBBE xK[xAp@xFIxAprxM_xFpWxMYxBpT#&#h#&.FBB B(A0A8G~ 8A0A(B BBBC H_aA^LBbKEFN^TUD MS %O\Aj LL HRCVT<$4BBB E(A0A8D@ 8D0A(B BBBF HLP[HA@$85ZtQ K IL$x59BBD H(D0u (M HGIJ y (A ABBI %h9FBB B(D0I8JO]A^ 8D0A(B BBBG M]DlQVIoNgBbMRJMuBPH8%AFBA A(D0y (D ABBH X%TCFBB B(A0A8DpE 8D0A(B BBBA lxMMxApT&D FIB B(A0A8G 8A0A(B BBBC LCaAP]A.MMPK|&NFIB B(A0D8D@ 8C0A(B BBBC [ 8A0A(B BBBK K 8F0A(B BBBF 4\'PPEKD M DAJ n CAF L'PTFQB J(D0A8GB 8A0A(B BBBA 'SFIA D(G0 (D ABBD k (D ABBD h (D ABBG S (G DBBF h (D ABBG 4h(tUFAG k DBA z DBH H(UFIA A(D0] (D ABBE D(G DBB4(PVaFHD } ABF l CBG 8$)WFBA D(D0u (D ABBA H`) XFFA A(D0U (D ABBH D(D DBBH)PXFBF A(A0` (D BBBF G(A EBB\)XFIB B(A0H8G 8D0A(B BBBI EBAPX*`FBA D(G?MTTK^ (D ABBF P*`cFBA  BBA Q BBK e BBG h BBD +d~K V H+Pe FBB A(D0 (A BBBE 8F@a8A0\h+kfFIB B(A0D8GHZAw 8D0A(B BBBI H+$nFPD B(H0L8DP 8D0A(B BBBJ ,xv (,tv <,pv P,lv d,hv x,dv ,`v ,\v ,Xv{GD E jT,vBBE B(A0A8D@` 8D0A(B BBBB aHMPTHA@(,-0wFDD t ABK DX-w FON K ABG x ABE E CBF D-\x8FOR K ABK t ABI d(a0O(C D-Ty8FOR K ABK t ABI d(a0O(C D0.Lz8FOR K ABK t ABI d(a0O(C x.D{(.{BFG  DBF .t| 4.p|cFBE A(D0E(F ABB/|4/ }EZ A GH ]JA I G H K ,T/}HO I TC hAI A /(~Hq G x H I/~uH y G /~H M K H/\BEB G(D0y (D BBBI S(A EBL(,0Eg L ~H bDAX0$FBB B(A0A8Dp* 8D0A(B BBBG xNSxApUxPWxDp\xCCBZp_xWDAABIpQxIMBUpP1sFOJ D(A0G 0A(A BBBA PHbCT1HFEE B(D0C8G`hPpThA`N 8C0A(B BBBE hLp]hA` 8A0A(B BBBE s 8C0A(B BBBA r hPpN IhKpihB`F 8A0A(B BBBA AhOpfhD`PhWpDxBBAS`MhQpNxAS`NhMpLxAQ`t\2BBB B(A0A8G L@LC 8D0A(B BBBA WCTCOCACuCTCMCACd2IBEB E(G0A8D@S 8A0A(B BBBI H 8C0A(B BBBD L<3pFBA A(D0Z (D ABBG ] (A ABBE |3QFGB B(A0D8G 8D0A(B BBBE XBBBBRGHFSx 4eFHB B(A0A8DPXD`VXAPM 8A0A(B BBBG G 8C0A(B BBBE lXH`jXGPH4FBB B(A0H8G 8D0A(B BBBD p4qFBE B(D0A8JaHAf 8D0A(B BBBG GCHN\H5ĜgFBB B(A0D8G 8D0A(B BBBH cNdA`5ԠBBB D(D0 (A BBBD _ (A BBBJ p (A BBBI H 6 QBEE E(A0D8GP 8D0A(B BBBG X64FLL B(D0D8JP 8D0A(B BBBD RXT`NhOp[PRXK``XBPXO`AhIprPMXF`cXBPd XI`PhFpL 4XF`LXHPfXO`PhOp_PIXD`XXFPh XH`EhO @ XG`Q z XG`H xXG`H<7FEJ E(H0A8J 8D0A(B BBBD T7ĭFFB D(D0G`hMpUhA`x 0A(A BBBD [ hMpP L7FBB B(A0A8FD 8F0A(B BBBI H08|FHE E(D0C8K`n 8D0A(B BBBK P|8FBB A(A0D@ 0D(A BBBD OHcPVHA@X8lFBA A(G0a (D ABBE  (D ABBH w8C@x8A08,9fFAD J ABH y DBA Lh9FBB I(D0D8J 8D0A(B BBBD l9FBB B(A0D8GAXApCUAB 8A0A(B BBBA H(:DBED A(K0 (D ABBF p(D ABBDt:FRA  ABA M ABH t ABA H:FBB E(D0H8J 8A0A(B BBBD L;FBB I(D0D8J 8D0A(B BBBI X;Ll;ZFBB I(D0D8J( 8D0A(B BBBF P;*FLD (P0R(H X ABD _ CBD t ABI D<|PFHD } ABF H ABE E CBF \X<uFEB B(H0D8J 8D0A(B BBBG N\A\<uFEB B(H0D8J 8D0A(B BBBG L\A(=|FAM SAE C K4D=EAD C AAA e CAG X|=FBA A(D0~ (F ABBI D (J ABBM e(C ABB`="FBB B(A0D8DP 8F0A(B BBBJ e8C0A(B BBBH<>FBB B(G0D8D` 8D0A(B BBBD ,>4EW D }l GAM E h> BBB E(A0C8D 8D0A(B BBBA N\A NJ $?X+TVLExH BBB B(A0A8G L@LI*INJQIBID 8A0A(B BBBF SICJPJPJIIdITJOIAIITJPIBIFIMJiIEIpH,^BBB B(A0A8G I!z!K!o!A! 8A0A(B BBBH _!T!O!A!($IBFH AB@PIBBA G L""E"j"b  ABBJ IMtIlFBB H(A0A8Dpr 8D0A(B BBBI BxJKBNp:xhGVHDSp(J( MYA} 8D0A(B BBBD  FV K[AbV[IaMaHBZnCx[[I[NBPFCO9FUBGJBImLTF|HoAcRIERGIIpA(s}NHsM=HT `dsMFDD D(L0f (A ABBF D8M@c8B0g8F@P8A0D (A ABBB D (M FGKG X 8M@c8F0]8F@O LsNFBB B(A0A8G 8A0A(B BBBB l@tSBBJ E(D0D8G`hFpWhA`x 8D0A(B BBBG DhMpWhD`HhNp\hE`PtTFBB G(A0D8DR^AHY\ 8D0A(B BBBK DaAHIH]HHILWAWCVAc LR u LO IPNDDStKHB]NSBMPQBB LS D PL t PL DOWAq PE v[ v[,v[C@v[=Tv[ <hv[FAG C DBI T(R0T(A NABvd\rKK\v\EFPD E(A0A8NP 8F0A(B BBBA c8C0A(B BBB8$w]jFBB A(A0V(A BBB`w ^tw^EP(w^FDD ~ DBN w^MEP K hw^MEP K hw^MEP K hx_MEP K hFBB A(A0G I o 0A(A BBBE <8$FBB A(G L! (D BBBI HxFEE E(D0D8D@f 8D0A(B BBBD LĄș FBE D(D0e (D BBBD X (A BBBI 8QFED A(Dp (D ABBD TPuFEB B(A0A8DpxMcxAp` 8D0A(B BBBB <ԠFBB A(G I p (A BBBF PdFNI B(A0D8Dw` 8D0A(B BBBE 4<>BBA G I   DBBG @tfBAD  DBA z DBH k DBG 4gEJ A D L 8܆FBA D(J (A ABBE 8FBD D(J (A ABBA HTBBB A(D@B (G EBBC u(D BBB0<FAD J  AABA ԇ,QAC DKF C D$BBB B(A0G I  0D(B BBBH H`loBBB A(A0G I  0D(A BBBF T}BBB B(A0A8G L@I@p 8D0A(B BBBA P BBB B(A0A8G L1 8D0A(B BBBI LXt BBB B(A0I8G? 8D0A(B BBBK (BHG` ABE ԉxBBB B(A0A8G L@L`Lb&bOb`bBbO bNbYbAbwbGbO R 8D0A(B BBBA NbIbHbFb[bibTbObAbrbTbObBbbGbHbAbKb@ bGbHbFbL wbCbPbAbbIbLbLbKbDLBAA ([0U(F W ABF p ABE 0(FAG s DBI KDBD\FAA G I >  AABF H k J HFBB B(A0A8G L@I@@N@g@E@S@C@p@A@\ 8D0A(B BBBA @G@H@AAK@G@B@H@FAK@y@A@H@BAS@a@Q@K@A@I@M@F@KAO@o@G@H@AAL, FEB B(A0A8JfFDIHPiDDDAKHSNGFKPOIAPrYIDPcJbAOy 8D0A(B BBBG gPLBDAXQQHK]QKCXTVLAXWiGGBIlVDDDAKJSPJIK`wLMADFFVRANDUl NGBDHE QQEDHPp QAAJ Z^XAOgM_A_NcEBIH_` FNE B(A0A8G@-HFPWHA@D 8D0A(B BBBH  HFPE dDH FBI B(A0D8F`  8C0A(B BBBJ 8A0A(B BBB( ԏ(vFAL s DBD th FPJ B(H0A8JgHAEL]AbKcAJO_BLOCIRPC^ 8A0A(B BBBI ]MVBMVBLXA}]dBSKBN`BhNVB} fmFDMH NYAJYAF[ND3YU (E^tؑ&FBB B(D0D8Gp 8D0A(B BBBK xMYxDpXxbPxApZxN[xApP FEE B(A0C8JT NN HTDNPYD^ 8D0A(B BBBJ .IaB^PWDqP^B$ H@c E fHPPYHC@L,P FEB B(A0D8G- 8D0A(B BBBK X| `FBB L(A0A8LPz 8D0A(B BBBE 4XK`YXAP0ؓ$FNA G`  DABG X |BFB G(D0D8D 8D0A(B BBBJ ]JVA@hBHL A(D0Gp 0D(A BBBF H0FBE B(D0D8N` 8A0A(B BBBG L FJB E(D0A8D 8A0A(B BBBG \HFJB B(D0A8G 8D0A(B BBBA tLcA` FBB E(A0D8NOLHIi 8D0A(B BBBK `$FJE I(A0A8G 8D0A(B BBBE MeAPMeBhIlA NN K MV K MV DUHK\@ MV D UHKJ \X*BBE A(D0 (D BBBG b (D BBBD G(A EBBlD*DFEB E(D0A8G 8D0A(B BBBD TjAMYA|2MFBB H(D0A8J 8D0A(B BBBC MZAgMZDHcB49Q FBB B(A0A8GHBBBADBBB] 8D0A(B BBBD DYZA YK  MR b SJ  (D FBB E(A0A8GRaAENIASaNIASJNIASJNIASJNIAS 8D0A(B BBBH RR`BFgBFdAM(MFAA AB@FPI D(A0GXS`RXEP^XE`hXAPX 0D(A BBBD XL`]XAPr XK`M D XJ`Z L XV`V Y XI`F P|AFEB B(A0D8J\WD 8D0A(B BBBE PH`EtGEBBBABBBNZUA` ZE (F:EC M D 4Jkdc UTPKFBB A(A0H8^@y8A0B8B@LHJPI0A(D BBBK4BBE B(D0D8GmBqHAfBADU 8D0A(B BBBE EFpFhAg[ADgBHRA9UgAtREU KZ #YZEPqPYA QZ BFBJVAtZMB PQ kF` IV A TJ GOXAL]BD DE RMJAN,USBXRIINbLx~FBB D(D0 (D BBBC b (D BBBD H$؁\BD A(D0yP0h(F ABBp|FBE A(A08W@GHMPO0h (A BBBH v8]@S8A08Q@RHHPO0w8X@DHKPO0u8d@L8B0O8Q@RHHPO0P8Q@RHHPO0P8Q@RHHPO08Z@V8F0]8]@T8B0t@\FBB A(D0y (A BBBA o8d@Q8A0F8X@EHKPN0x8Q@SHHPK0E(A BBBԉFBD D(D0h8W@GHMPO0V8Z@a8A0M (G ABBO E8Q@RHHPO0T (A ABBG D8Z@Z8A0DHXBBB E(D0D8DPS 8D0A(B BBBI 0XFAA D@}  AABC ԎcFV D ((FAN0 DBA d FGB B(D0A8KpxK[xAp~ 8A0A(B BBBA DxhMxAp`FIA A(G@N (A ABBD HMPYHD@OHMPVHB@|HMPYHD@`BIH E(D0C8D@wHLPcHA@J 8D0A(B BBBG DHMP\HA@P9FEE I(A0A8DpMxXDNTp^ xWFBI xWFLTpCxWFLTpxWFLTpcxWFLTpxWFB^pxPbxAph 8A0A(B BBBG _xMRDTpxWFLTpxWFB^pxWFB^p]xWFLTp-xWFB^pTxWFLTpK xWFBE pxXDNTpMxXDNTpqxXDNTpG xWFBE rx]ZxFpfxWFLTpKxWFLTpXxWFLTp]xWFB^pJxWFLTpkxWFLTpBxWFLTpFxWFB^pxWFLTplxWFLTpixWFLNpxXDKZpI xWFBE {xWFLTp| xWFBE nxWFLTpU xWFBE Nx][xFpxdGAVpdxdSxApxdTxFpxdTxApcxWFB^pzxWFB^pgxXDNTpPxdSxEpfxWFLTpD xWFBE nxWFLTphxWFLTpxXDKVpx\[xApaxdTxBp x\E )xWFLTp@xWFLTpH xWFBE LxLKBbp_ xWFBE x_JFZpJxWFLTpJxWFLTp@xWFLTpDxdRxBpC xWFBE Y xWFBE ZxFTxBpC xLKBE GxWFLTp~xWFB^pxWFLTpH xWFBE nxWFB^p xWFBE QxWFLTpIx]XxApZxWFLTpxFSxBpaxWFB^p@xWFLTpD xWFBE wxWFLTp| xWFBE wxXFA[ptx]ZxApaxdSxAp\xXFA^pw xXFAB A xWGAE Z xHBAE LxMIAVpyx][xAp,`FBB B(D0A8D`RhLp`hA`XhNpRxDM`hQpXhE`XhRpNhB` hQp^ P hQpL c 8A0A(B BBBF DhMpPxGM` hJpR ChNpZhE`|hApAxDM`hLpOxFCFX`hCpZhA`i hCpP a hTpDxAAFO ThIpWxCS`vhMp^hG` L Hq G x H I(pEAD p AAA 0FAD GP  AABA |FEE F(G0[ (C BBBG | (A BBBE K (F BBBI D8G@h8C0A(A BBBHPFEB H(A0 (D BBBC d(A EBB@JFAD MgMjAf  DABD dFBB B(A0D8D@HKPpHA@ 8D0A(B BBBA AHKPZHA@DHFEA D(G@U (D ABBK GHPP`HA@D.FBG A(D@r (D ABBA HOPSHA@ FSB E(H0G8G7KWHxMXB@kGE\I\AuKZAN FZ  OR  IW s 8D0A(B BBBH L_BVMRHIv UJ d|FBA A(G0p (D ABBF  (D ABBE D8F@k8A0N8F@h8A0L8FEK C(K0z (D ABBI  (D ABBI DFAD S AED M ABH h ABE 8FIE A(GP (D BBBG l @FED H(G0\ (F DBBH D8a@]8M0s8[@8A0B8A@T8A0F(A ABB\|_FEB B(D0A8D^ 8D0A(B BBBA KMUAdFBB E(A0D8DP| 8D0A(B BBBG HXa`ChFpYPaXF`kXAPHD'FBB B(A0A8DP 8A0A(B BBBJ L0FAI J0x  DABG |ED c DH 8xFBD D(G0l (D ABBD L@ ,FBB B(D0D8De 8D0A(B BBBF FN D f<L FAD GPgXf`OXAPX  AABE hFHE B(A0A8GN`B}MgBM]BlbPAAcFDPYMaBN]BIP_B% 8D0A(B BBBH gHB~RMAGQ_H{kLA;^LEPL]F3N\BGjIm NM  FZAJUNIqcNBXM_Bf LQ D JX dGgA?NbA|MdIUOaIp FE a TJ b FE rNbKNMdHIMcA\FIB E(D0A8DPqXD`kXAPiXT`AhGpDxGDDIAIP 8D0A(B BBBI ~ XQ`FhBpBxDK XZ`OhBpBxDWPkXP`ZXAPDQHD } ADI TABAP \p7K rBB D iD0 G m@cBA H( ABBAA(h`BBB A(A0G I s H a D  0D(A BBBG [ c H A (6AC K! A J @xFBB A(D0DP 0A(A BBBJ (FAD ABpDhFBF D(G (A ABBG BtBHMbB (C ABBJ `,FBB A(A0E (D BBBE ] (D BBBI b (D BBBD ( FAA c ABB 8H4!OAD g CBH AFBG<!PBB D(A0(A BBBKLX"\FBA A(D0 (D ABBK H (D ABBG ,h#FAD r ABH DD#FBA C(G0P8O@k8A0D (A ABBH p$FPB B(H0G8NDIkA 8D0A(B BBBG qPPG]+KTHLWA) FiD89OBB B(A0A8GPl 8A0A(B BBBD D 8D0A(B BBBG XM`\XAPG 8A0A(B BBBB @CP0:nFAD M DBB GDB 0;XFBB B(A0A8MEgB|MYBWWOAU 8D0A(B BBBJ ]MYA8@FBD D(G (D ABBG xBHFBB B(A0A8G@B 8A0A(B BBBG i 8F0A(B BBBH D 8F0A(B BBBE \XCFBB B(A0A8DP 8C0A(B BBBG D8F0A(B BBBhC FJB B(A0A8Da 8D0A(B BBBH K[A KU $xM0FBB B(A0A8J 8A0A(B BBBI yPA^VAPUIODCN  8D0A(B BBBC MhBeHJDTOEFNNTITgBCSLAWLOWJGRXBu FK f PEAL jUTAQFAXsdQHzOkAlO\BDLBMPUB^VB(QVByRG`WP RG`B MNANjNYAMNYA NOANpOUAI PJ wMTAK\Ap MG ] QFAE  QJ DO\BKRWDtPVAcNZBQNYBI NL {OHCNL_BIR]A5 LL MTWAzZ@ 4zFAG _ DBE ](M0\(A XT{5FEB H(D0D8G`E 8D0A(B BBBJ 2hJpRhH`(t8tFAD ~ DBA (FIG0H DBD \ FBI B(D0D8G{HjB 8D0A(B BBBE ,> pL$ FBB B(A0A8DHQJI 8D0A(B BBBK H`G%>2X,BFBE E(D0D8IpsxDLxAp 8D0A(B BBBA <= p\hp\Z FBE B(F0D8K^MGmMDDAEIN\A 8D0A(B BBBI  M\A NT  NM DKBBBBABBBV NM `< @FBL B(A0D@ 0D(B BBBE PkFLB D(I0J]KTAb 0D(A BBBK ,EC BEEM I H; ,hDEC I H ; lgj; |TTBJK E(I0D8L@AHEPPHA@BHMPKXF`L@F 8A0A(B BBBH ~ 8A0A(B BBBH Xh4BEB E(D0D8F` 8D0A(B BBBF hNp_hA`8xoFBB A(A0V(F BBBxBEB B(D0A8DPIXa`HXDPXG``XBPaXN`YXBPuXN`XXAPLXZ`OXDP 8A0A(B BBBJ \ABEB E(A0D8Jx 8D0A(B BBBF LLAHBIB B(A0A8DP 8A0A(B BBBG 89 PXDFGB E(F0G8GP@XL`GhHpAxAQPXXJ`QXAPZ 8A0A(B BBBB eXA`PXBPYXG`KXAPk 8C0A(B BBBE e 8C0A(B BBBG A8 PH0lFIB B(A0A8DPY 8D0A(B BBBA X|FBD D(G0X (G DBBB [ (G DBBF e(D ABB0EDG d DBF H O7 ,FBI B(A0A8D&HOGAEIkJ[AI_B^ 8D0A(B BBBE j\KA6 mFBB B(A0H8DPXM`\XAPS 8D0A(B BBBH DXM`aXAP[ 8G0D(E BBBL rXN`OhJpIPh6 P4FDD C GBF ~ CBE 4\FAA P CBC }AB@FBA  BBD A BBK uBBX<i FBB E(A0A8D@ 8D0A(B BBBD xHMP\HA@4 @L@FAA r ABC _(L0a(D A ABA q (A0B FBB B(A0A8DPXi`GXEPLXj`]hNpRPI 8A0A(B BBBA SXg`LXEP_Xg``XAPAXB`[XAPR 8F0A(B BBBF 3PFHM G(D0A8G@hH^PYHA@IHPPdHA@BHBPrHB@d 8D0A(B BBBK oH^P}HA@bH^P~HB@IH^PKHA@MHMP]HE@Lt'FBB A(GNjD (D BBBI T7BGB A(A0JKXCG 0D(A BBBH t /FEG B(D0C8DP 8D0A(B BBBI ZXL`bXAPpXJ`BhApQPXL`aXAP HIH@4 ECD x AAJ ^ AAD yE^ E E C \ tFFEB B(D0I8JFhAi 8A0A(B BBBJ 8h dFGA N ABA q ABD T FEB B(A0A8D@qHNP[HD@ 8D0A(B BBBH T ^FBB B(H0A8DP 8D0A(B BBBE FXN`YXAPT OjHl 5FBA A(D0 (D ABBA V(D DBB tFEH B(A0A8DLNTAGOMFECRHLYAKLZA_LZBwN[B_N[A_N[AP 8A0A(B BBBF p 9FEB B(A0A8DPXQ`uXAPx 8F0A(B BBBE E 8C0A(B BBBA  Ho I j A <, 0|hAF K AAD I(K0^(A FAAl @. ` \JBB A(A0u8o@[8A0B8B@T8A0A (D BBBD D(A EBB0 EU F IL ^CA I IL Pd-FIB A(A0T8h@T8A0G8N@j8A0A(A BBBlI- 0, BH F LI `CAG4FIA A(D0(A ABBL8]BB D(D0T (D BBBI G (A EBBG Dz, pXFBA D(D0p (D ABBF u (D ABBB e (D ABBB e (D ABBA t[FIB A(A0% (D BBBF h (D BBBF A (D BBBE r (D BBBD D+ 0\dBFIB B(A0A8DP 8A0A(B BBBC e8C0A(B BBB+ PFSB B(A0A8D`Q 8C0A(B BBBH  8F0A(B BBBA o 8A0A(B BBBA uhMpYhC` 8C0A(B BBBA L]FFD D(G HkA^ (D ABBG FLB E(D0A8G` 8F0A(B BBBE { 8C0A(B BBBI f 8C0A(B BBBF nhFpExDAEQ`HpFBB E(H0C8K@ 8D0A(B BBBF ]B_ H A e A ` P!FBI B(A0A8D 8D0A(B BBBA  KDBIpk($HFIB B(A0A8DPN 8D0A(B BBBD #(PdP FBE B(A0A8DP 8A0A(B BBBD DXJ`JhGpIPPXd`OXAPDd tEHD0r FAF P CAD x CAD n' 0@ FEB A(C0G@ 0D(A BBBD `FBE B(D0D8D` 8D0A(B BBBG ShDpOxDAGI`TlFDF J(A0A8G`ChKpohA`N 8A0A(B BBBG wdHFBB B(A0A8GNvBMuA 8D0A(B BBBA F\AMYAiMXA NM M]E%M"t FBB B(A0A8G 8D0A(B BBBK CYAmIBASH`B HGBIM]B:QxA4H_B$d`+FBB B(A0D8D@HFPVHA@x 8D0A(B BBBH HMP\HA@t$ @84.WFEA D(G0~ (D ABBB dp/FEB B(H0D8G 8D0A(B BBBH  8I0A(B BBBH #6jFBB B(A0A8DM_Ac 8D0A(B BBBA LEDIEBABEIN_AP 8F0A(B BBBE <A F ,=ADK @(M0_CA"  , =EDK |(M0_CAPc"  Xh$>FBB B(A0A8DP 8F0A(B BBBA QXH`aXAP! PL8@FAD b(L0a(D J CBC \ CBG b (M0Q 4!  P@,@dABAD W(M0_(D J CBC \CB)!  xAtApAlAhA(dA<`AP\AdXAxTAPALAHADA@AX FBB B(A0A8G L()(E(o(A(m 8D0A(B BBBG (E(r(A(M(g(x(B(O(p((B(](j((B(V(g((A(R(K(Y(A(i(M(M(M(s(H>FBB A(D08B@I8A0A (D BBBJ @H?d!ECG Q(C0J(A v AAJ KHH?PQJe A VT?"FBI B(D0D8D@i 8A0A(B BBBF iHFPlHH@\@hFBA D(D0 (D ABBA f (D ABBA G (D ABBA dd@(ERD  DAA W(g0L(G f GAA h GAH H(g0u(D P(g0[(A H@/FBB B(A0A8G` 8D0A(B BBBA XA'gFBB D(A0m (A BBBE {8L@^8C0t (C BBBC (tA(Hg A ]R YCv G @A)EG W AD P(M0T8T@K X(M0T8P@I 4Ax*EFG w AAE D FAE |B0+BGJ G(D0A8GxB!vvA`edCr 8D0A(B BBBE dB0FBE B(A0K8G`hmpvhD`X 8D0A(B BBBF hypWhG`C `\$C(5 FGB B(A0D8J  8D0A(B BBBK \ P N A pC:yFAG DBN cGHFW| GHFH zNOFKn OBE DC<FDD O ABH y(N0O8F@K FABT@D|=qFNQ RU  AABH mROA`POAxD>FBI B(H0D8DPXP`OXAPaXR`OXAPL 8C0A(B BBBH D8F0A(B BBBdE?FBB A(A0G 0A(A BBBC TROAqNKA(|EAde G PM T(T0KEBFFB B(A0A8G% 8A0A(B BBBH TOAdTPBhRPByTOA8F$DFLB E(I0C8QlGQBTOA 8A0A(B BBBC TOAwNOFK}NOFM(F\GEDJ DAA 8 G0HNAD u AAF d FAA N0HGHEIN K AAG kCA|G0IWEy R F4GpIVFDG0\ DBE [ DBG pGJ+FBB E(D0D8G`hQp_hH`L 8I0G(B BBBL c 8C0A(B BBBA (HHTQEAJ DAA <tH8RFKG B ABC i CBB DCB(HR|EAD k AAA (HRFAD T DBK ISFDK A(I0z (D ABBF W8M@PHTPK0r (D ABBJ S8M@THTPK0G (A ABBH e(D ABBpITqLNT L(G0G8G@Q V BBF  LNK (M0P(A c (K0Q A LPO ALN JWbEVp(JTWFAA { ABJ [(T0O(B A ABD T(O0Y(A A ABG L(F0`(A AAB,JXLDA Q HBD (JXE{ P PF `AKpJ4YFPR G0\8G@GHGPQ0j  AABA d8P@S8A0%8L@V8A0\8T@P8B0I8M@X8A0lKp[9Ha G DK[FBB B(A0A8G L@I@L 8D0A(B BBBE [@GA^@B@{@HAY@A@|@MAPAPAI@I@MAU@A@i@FAKAFAN@EG P- G  ԥMFEB B(D0A8G\VDCmLHROHMHBADABdBRHE 8D0A(B BBBA SSSAcQACNLMYBP MO D LL NLFBB B(A0A8G 8D0A(B BBBE wL`DuEJIAIHQAIAHQE[BLbAM JI H|RFBJ H(A0D8Gv 8D0A(B BBBG ȧTSFBB E(A0D8JjAMK^ERAw 8D0A(B BBBE R[Av RN  RR \VrFBB H(D0D8GPRXM``XAPoXB`MXBPG 8D0A(B BBBK DXM`eXBP* XH`V  XX XC`aXEPq X[`H  XP`MXAPhXT`PXAP[XC`^XDPP^L0^kFBB B(A0A8G L! 8A0A(B BBBE X bFIB B(A0A8DRcCX 8A0A(B BBBK HܩcFED H(I0z (A ABBH q(C ABBH(4d4BIB B(A0A8G 8D0A(B BBBB dt(eBBB H(A0D8G 8A0A(B BBBH  8J0H(G IBBE ܪgD EL4hFBH B(A0D8G 8A0A(B BBBD @HtiFLB A(A0G 0A(A BBBA L jFEE D(I0f (A ZBBF  (A BBBG 8ܫkTFFD A(G` (A ABBH XlFBB B(A0A8D`r 8A0A(B BBBB ^hRpJxGR`dthnZFHE B(A0A8J 8D0A(B BBBE N 8A0A(B BBBH Lܬ`oFBB B(A0A8D 8A0A(B BBBA D,pmFSI B(H0A8 0A(B BBBA `trFEE E(G0C8IP 8A0A(B BBBG t8O0A(B BBBHحsFBE I(A0A8Gp 8F0A(B BBBK L${FAD Y(O0^(A W FBG L(G0^(C A ABH @t8|FGD GPv  DBBJ GXH`HhBpIP@}FHA ` BBE { BBI vBB$~qFV D U K $X~ 8T~RHy PT~F%FBB B(A0A8GHhAK\B 8A0A(B BBBA JJgBI`AHcBH_D0 HO HJINhIBL`Bm MM { XE g XE HBBIpHBBIK^Aq MJ  IJ n jM [N]B]n(8uFDD l ABC 80tFEA D(G0H (D ABBH lC 04nFJD O ABJ zABEMܱEMEMEM40nFJD O ABJ zAB,h4FEG0_8u@IBBE0)HP P)HP P,в̤FEG0_8h@IBBJ0<,FBD D(G (A ABBH p@FBB E(D0D8D@qH`PFHA@M 8A0A(B BBBF [ 8J0A(B BBBJ X8<FBA k(m0F(A F BBF } DBE ~ BBN T BBE @FMR G(A0F(A F BBB ~BBPThFED \(m0F(A F BBG V BBF T BBH 8FID  BBA \ GBK 0ODG ~ABEP lFEB B(A0D8Dp{ 8A0A(B BBBC kxEDJUpjxNTxAp<FDG T FBC \ ABA eFBxȵdmFBB B(A0A8DP 8A0A(B BBBE $XJ`GhBpIP=XJ`IhBpIP?XN`iXAPDu P|d8>FBB B(A0D8Dp 8A0A(B BBBA  8F0A(B BBBE e 8F0A(B BBBA A\ C ]XhBIB A(A0q (A EBBF E8O@W8D0A (A BBBI `c 0\FBE A(A0G@`HNPZHA@  0D(A BBBK HSPZHB@X| FBB B(A0A8J 8D0A(B BBBH Ma<0v8PcFIE A(J (D BBBI LFIE A(A0X (D BBBH w(A EBB,ܸ]DA  ABH   8 ,;FJA A(D0 (D ABBA \0pgdFBE E(D0A8G` 8D0A(B BBBG , 8M0H(E BBBL `d 0FBE H(A0D8D@' 8D0A(B BBBF s 8G0C(G BBBN t @HHFBB B(A0D8GR 8D0A(B BBBI pOBBE H(A0A8GP 8D0A(B BBBK }XK`HXAPXD`nXBPaXi`OXDPTPtx(BBE E(A0H8GIDEM 8D0A(B BBBA %NRACVAEMXHAG\B`GTANoBKNBX̅;xmFIB E(D0D8DP= 8D0A(E BBBA X 8A0A(B BBBF c 8F0A(B BBBA  8F0A(B BBBA OP\0\tFBB B(A0A8GbIaD| 8D0A(B BBBB  x\FIB B(A0A8D@`HMP`HB@D 8D0A(B BBBG a HMPR sHFPTHA@#HFPTHA@,Z @LPH` A h$ FBB B(A0A8G L@LB 8D0A(B BBBF BNB_BBB'BRB\BAB@BNBUBICKB (Bd@ BBB B(A0A8G L@LB+ 8D0A(B BBBG BLBaBAB4(B\BJB B(A0D8JKGTA\ 8D0A(B BBBA HHBFL I(D0D8J [ 8D0A(B BBBI I Q S D M E S F s [ W E 3 i R A } U V B { R U A  J D B I I B I V  J K H \ d b W D  O F H \  K d H  G F A V K L B  F T A  F K B m F L A Y F L B L  D7%FBD D(D0E (A ABBA `8J@R8F0<8FDG W(M0T(F I ABE {FBx<9FBB B(A0A8Gp 8A0A(B BBBE e 8F0A(B BBBA h 8F0A(B BBBA ;.H\ I;.H\ I;.H\ I ;.H\ I(;.H\ ID<.H\ IX`<FBA D(D0q8[@S8A0D (A ABBE H (C ABBA <,HZ I<<FHA G@qHdPOHA@Y  DBBD T=FDE B(A0A8D``hgpLhD` 8D0A(B BBBB Tp>QFGB B(A0A8D`hbpFhA` 8D0A(B BBBB T?FDE B(A0A8D``hgpLhD` 8D0A(B BBBB 8  AFGD c FBD i FBA l\`CFBB B(D0D8Dz 8A0A(B BBBD A[dHFdA!} LI FGB A(D0DPGX_`FXAPX 0A(A BBBK \<@KFBB A(A0D`hMpUhA`w 0A(A BBBH hMp\hF`[|`hRfFBB A(A0DP3 0A(A BBBE nX\`FXAPXK`ZXDPXM`]XGP({PlHVFBB B(A0A8GMYBC 8A0A(B BBBH G]Ad^FBH D(D08J@\8F0A (A BBBH  (A BBBG v (J BBBJ |8J@R8F0 (F BBBG Hz 0hDbKHV B jltb%FHB B(A0D8GPdGJm 8D0A(B BBBC \GYB0z ,j%FAD ~ ABD HkFBB B(D0D8GG 8D0A(B BBBA XIBcO\FQNBJUA[OBxJ\APbNH\A y@zFBB B(A0A8DJFTFUHJBIM`Bz 8A0A(B BBBD W MT w MT kEx C e A LFBB E(A0D8J/FWA0 8D0A(B BBBH F`BFTAJ^BFUBw>pFEE B(H0A8GZDiAJY_D 8A0A(B BBBA <ЗYFBB B(D0D8G 8A0A(B BBBH \ADTL^DEPHRA+PtBPeGodPAO[VGZeFy[xA,WvL ` tRHy P\RHy PSEMSEM(SEMlSEMSEM8LJ eT(HHPl`FDD J ABE  ABI k ABB m ABH 4ܭFBD k BBE RGB4DFBD k BBE RGB00mFJG M DBF vDBDd{FGA  ABG Z(K0^(C A ABF  2H` ID7He Ih2H` I$H s(\0F(A T F ("HM LD"HM LT`FLB A(A0GvcRD| 0D(A BBBE @TFIA JrcIAe  DBBJ @AFIA Jr_IAe  DBBF <@FHA G@qHiPOHA@Y  DBBG <\FHA G@qHiPOHA@Y  DBBG @FDA Q(n0O(A I BBI nBBhSHY G j$Hg A N J TDHQFDB B(A0D8D`hhpFhA` 8D0A(B BBBB DPJFEA D(D0k (D ABBH 8L@^8A0XBBB B(A0A8G I!!T!_!B!I 8D0A(B BBBG "!W!M!A!!R!Y!A!pl BBB B(A0A8G L! 8A0A(B BBBB !V!{!A!B!A!Y!A!, FGB B(D0D8GC 8A0A(B BBBC IKAMOBSWAd3o|(FHA A(D0J (D ABBI U8D@U8A0v (D ABBB Z (D ABBE (D ABBHFAA D08H@^8A0m  AABG V8M@c8A0 PLED b AD t[4D EAG q AAH k FAF 4EHG E AAE mCAs( 0sFDD ~ ABA $8pFGD XDB`=Ew$|]FGD EDB((El G M K R F L$FGD DB$]FGD EDB$ FGD ~DBH4H\@FKA JZEB\C  DBBJ DFKA JZEB\  DBBA DFKA JZEB\  DBBA l8dFAA GPxXB`AhHpDxNIBACCANPX  FABJ GXH`GhBpIPXFBB B(A0D8G@?HIPOHA@A 8F0A(B BBBH (*D (,@FAG0E DBG (XFAG0E DBG HRXE` K gP\XEe F gXE` K g$XE` K g(D(Er I g I m C pXE` K g< 8PE[ H ghPE[ H g$BEAG rAA ,Ef(%HY<@EAG y AAH ^ AAH KFA<HR(D,EOZ[ FAH H'LdFGE B(D0L8N 8D0A(B BBBD d(FEE A(G0q (G EBBG Z8M@\8A0G (A BBBF e(D BBBX<FBA D(D0 (D ABBF  (D ABBI X8M@X8A0D~KAD b ABK D(K0^(C AABD(4LKR_FW H 4`EJgNdFW AA i{J} I j\P_FGD D(GHZBFTF^ (A ABBE <,PFFB D(G (A BBBK Hl(BAA GDICO  AABE !FBB B(D0D8DSPAg 8D0A(B BBBC V_B$SYBPELFBAR|hBJVADHFHFKx~B!BFA{[EKEHIAIIaA_H|EicCISBXeMHnCmBFkAGABBkBh IV )c LeFBE D(D0K (D BBBF n (A EBBH LeFBE D(D0K (D BBBF n (A EBBH LL FBD A(G0~ (C ABBF { (A ABBG ZEJ D AA EN A AK mEJ W AA NH @ A $EJ F AJ (HtEAG0Y AAH teEJ O AA (DFAG0r DBJ (8FNG ` DBG fSLFQI H(D0A8G 8A0A(B BBBA `Xd!FDB B(A0A8D@f 8A0A(B BBBD | 8A0D(B BBBG l"FHE B(A0K8KDdACPG 8A0A(B BBBA d,)FBB A(A0D@P 0D(A BBBE i 0D(A BBBD HgPQHA@*FBB B(A0A8G L@LE8EKE^EDE{ 8D0A(B BBBA vE\EVEAE}EHEFEAE\EA EHEFEFEB 4h2RGHP2y FBB B(A0D8D@ 8D0A(B BBBF 0 8A0A(B BBBE D 8I0H(G IBBO pXiFFB E(D0D8F 8A0A(B BBBF BFDGFDXnJFBB B(A0A8G L!w"L!I!A!S"G!B!s!R"O!A!W 8A0A(B BBBH W!T"O!A!|pFBB B(A0A8G I k Q c B ` Q H D z 8A0A(B BBBH W T O A hqFBB B(A0A8G I!!N![!B!A 8A0A(B BBBD G!J!\!A!_!K!_!D!K!K!^!C!W!`!I!D!a!P!O!A!DsFFB H(A0D` 0A(A BBBA dXtRHy P4teFBA H(D0D(F ABB4teFBA H(D0D(F ABBH uBIB B(A0D8D 8D0A(B BBBK <vPvdvxvHvSBLB B(A0A8DP 8D0A(B BBBA Dw FBA A(D@R (F ABBE HMPXHA@ xPBBB B(A0A8G L$$K$Y$E$[$z$r$B$U 8D0A(B BBBD Q$K$D$A$a$J $L$D$A$K v$S$`$A$` $S$G$A$E A$I$T$A$I$N$P$N$N$A$A$I$|e!FBB E(D0D8G 8D0A(B BBBH GTAGUB,WOBWMNEIMWBPN^B`YJGIYERAKHAEEPACGUBGUB~ILAGTAKRALLBPWA~L\A[ EB WLRBLLB( vETJ IAR A u( HWK LFI K z($ X{DQJ NFI D z0P  BAD G0p  DABK 0 QDJ J(H0^(A DAA4 WFED g BBF MGB4 WFED g BBF MGB4( DWFED g BBF MGB4` lWFED g BBF MGB  < GF K \ L OI IAD A p I N R @ L]JAG f AAF  DAA ZF D hBBB B(A0D8D@} 8F0A(B BBBC ` 8F0A(B BBBA k 8C0A(B BBBI | 8C0A(B BBBH H8F0A(B BBB |BBB E(D0A8JRiGHEEEEM 8D0A(B BBBE gTVH:LFBjLQBQJBMHLEI@ I < d|FEE A(D0D (D BBBE lBBD C(G0R (A ABBF U (A ABBE z (F ABBK T8M@GHBPI0\xDBLG B(D0D8J ] K O A x 8D0A(B BBBJ tP(BJG D(A0JJIA{ 0D(A BBBF |4 0,8DPP7BJG D(A0JJOAu 0D(A BBBA @<T8hD|P\,HctFBB B(A0A8G L##D#d#B##O#d#A#z#M#_#E#e 8A0A(B BBBE D#M#m#A#^#G#L#G#F#A#I#[#N#M#K#K#G #M#R LxtFEB E(A0D8G< 8D0A(B BBBI `7FBB B(A0E8DP 8A0A(B BBBD u 8C0A(B BBBA L,BEE B(A0A8J 8D0A(B BBBA 0|FAA D0a  AABG \\FJE E(A0D8G 8D0A(B BBBF D[EBI*$8^L `tFIB B(A0A8JGGEEEEEf 8A0A(B BBBB PFCH FLB H(A0H8Gpq 8D0A(B BBBF HTvFEE B(D0D8F@ 8F0A(B BBBI  8A0A(B BBBH HMPMXF`N@HNP[HF@HPQFBE G(D0A8D@ 8D0A(B BBBI 4dFAA k DBG kAE4PFDD s DBI D ABI pFBE B(A0D8G`hNpahB` 8D0A(B BBBC hMp\hA`hMp\hA` .+`\FBB A(D0 (I BBBI i (A BBBH q(H GGPD|P9FEA T EBI U BBG F(G0V(A HHzFBB B(D0D8D@ 8D0A(B BBBC X|FEB E(F0D8LPgXX`rXCP 8D0A(B BBBF xl4FAD G ABK D(a0_(A Y CBE E(P0X(D A ABC \(c0P(F n(P0k(M XFEE B(D0D8GPEXY`rXCPX 8D0A(B BBBG LD8 FGB I(A0K8G@r 8D0A(B BBBF XBEE E(A0I8QP` 8D0A(B BBBG {XJ`iXAP4FDD N FBD FBH(d FBB B(D0D8D` 8D0A(B BBBJ Lt^FBE E(D0A8K 8D0A(B BBBK LFFB B(A0A8G= 8A0A(B BBBH xFFB B(A0A8DpUxCexHpa 8D0A(B BBBG nxIcxHpm xZG G xZE Dl]FBA A(D@ (A ABBG DHLP^HC@4FAG g DBE h DBB ,&FAI  ABE P@FJE A(A0G@mHLPRXA`I@k 0D(A BBBG 4(wOAD ABGH Lp FBB B(A0A8G 8A0A(B BBBA \0#FBE E(A0A8G 8A0A(B BBBH HpA|&fFEB I(F0F8Q~PdBhRgALI[Bm 8D0A(B BBBK 4TIB8izE0L: FEB B(A0A8GArAp 8A0A(B BBBK }RQWKajAN^AvNbA}I_BbKcBmpHAI^BKgB NO {[\Bg KO I KO W KO oEfAK IO 7eID CE aQ`AdY FJE B(K0D8O  8A0A(B BBBA  K g B  Z { D I I U A  h H A 6 h H D  M Y A  k H B K k I B J N \ A L8yFEB E(A0D8D[ 8D0A(B BBBE p{DFEA A(G0* (D ABBI C (D ABBD  (A DBBF 8_@{8A0h FIB E(A0D8G`PhNp_hJ`ChVpdhA`LhNpehB` 8A0A(B BBBE hLp[hA`= 8A0A(B BBBA [hNpNhJ`WhGpihB`vhFpihC`ahNp]hH`$ 8F0A(B BBBG m 8F0A(B BBBD DXL`YXAPI 8A0A(B BBBK pl&FBE E(A0o8M@NHEPI0O (E BBBK o (E BBBF u (E BBBH x&rFBH A(A0Dp 0D(A BBBG HxMzxBpBxIxBpdxN`xApx\OxApP\'FFB B(A0D`hWpHxBI`A 0D(B BBBA P',BPJ J(A0H8D@HKPTHA@D8A0A(B BBB(ȫ!FEB B(D0A8DnCAH^ZKAr 8D0A(B BBBE D FF }OFISd OFIB ^ OFIE MFFOR,((EU F e K R F FX)1FFB B(D0H8Ia 8D0A(B BBBE NIlJf_\KMVBM`BLWAMcAfKYAKmJ(L\HIlJIKQA C^EJO`BL[QANMUBH`*KFBB L(K0A8G 8D0A(B BBBE 4*BBA G L!z  ABBI *xFFB E(D0D8GUMYA^ABIl 8D0A(B BBBA GTcP?J]BOPANJWBhNB_MUBx+$2FBE F(A0Gp 0D(A BBBE VxYZxHpZxN]xFpxERxApxNVxBpXD,FEE B(A0D8GPF 8D0A(B BBBG |Xe`HXAP,l2 FBB B(A0A8G L"( 8A0A(B BBBE "S"Z"B""F"T"A""G"t"B"^"I"L"B"]"P"\"A"X"M"^"D"\\- }FEE B(A0A8DP< 8A0A(B BBBB XI`KXAP-RHy P-T4FBB B(A0A8G 8A0A(B BBBE |JBDbAMPBBBBBIlp. BIB B(A0D8D~FlARFdAx 8D0A(B BBBE ."FFEB B(A0A8GsfEEEDBEEEHAFBIW 8F0A(B BBBK $l/`$fEAC MDK/$rFBB B(D0D8D_lVPX 8F0A(B BBBE PCFOzIA$lLHahLDJxBJFC(\0`,sH[M E(B0ID D (0,sH[M E(B0ID D ,0-HiM H(B0ID K | D D0-FED f(M0N8E@I A BBE t GBK D,1.FED B(m0B8B@I A BBH p GBG t1H/1D/FBB H(A0D8GP 8A0A(B BBBG e 8F0A(B BBBD k 8F0A(B BBBF D 8F0A(B BBBE MXM``XFP(241FBB B(A0A8DPXG`cXAPg 8F0A(B BBBF d XJ`S b 8F0A(B BBBA p8F0A(B BBB|22=FBB D(D08M@U8O@e8A0M8Z@H8D0E (A BBBF ^ (F BBBF x(F BBB`834FEB B(D0D8I]EBSg 8A0A(B BBBG \37FBA A(D0 (F ABBF u (F ABBH k (F ABBJ L38BNQ F(G0D@YHZPKHA@ 0D(A BBBA L4:fFFE E(A0D8G 8D0A(B BBBE 6KbB WL ]TBOUHO_E\4QFFB E(D0A8Dl 8F0A(B BBBI rHA$P5SAG I n AH x5T"FFE E(A0D8G, 8D0A(B BBBE `qBBIAOWAaPOAH6\YBEE B(F0A8DPi 8D0A(B BBBA L6Z FBB B(A0A8G 8A0A(B BBBB HMuA`IBJYBD6,gfFAG`f ABI nhGpJxBI`ohkpFhA`7 `D07زBEA A(D0(A ABB|L>@BBE B(D0D8GJ 8D0A(B BBBG YM_DpSKDYNSA>BBE B(A0A8GDP_C^ 8A0A(B BBBF HGHFHtGHFH|MMDJ\h?$BDD I  AABI xJ`CRVNOFJ<?oDEE A(D0 (A BBBC @0(@K A D@(K A `@4t@@ @cHZ@8 @46FBB B(D0A8Gh 8D0A(B BBBC "M^BHRAOeBiECFIKXD)SPOLHIA KIHAKA\HAXFBI I(A0D8GP 8A0A(B BBBH B K A 4,BFAG u DBG f DBD LdB8FBB B(A0A8G 8A0A(B BBBA (BFED r SBJ HB\FEB B(A0A8Dp 8D0A(B BBBH ,,CKTGGIW A 0\CmECP A DAB DGAC`C8Ev E CLCdjFEH A(D0[ (D BBBC l (D BBBA $(DKR S zT LAHPDgaBB A(A08F@a8A0w (K BBBA DFG EA ,D@\G  BE @ EK DeE@ K QEBBB A(A0G I  M ] F  0D(A BBBI  G H F H a G H F ` Ed0&FEB B(A0A8N LEHDGGGGGGGGALGBBNABAGHBApMTT^DIEFDLBIBK&TSF  8D0A(B BBBJ DIEFGLBIBKMMaBBAFFAGHAA[\FMQAHQONAINBAEIiHKBABIkGKEABIACLFRKYwWRAGLFTNQNRMBJCLFTNYLGQFLILGACDTI LGACDB iKFAMDMOLH*FFA A(Gk (D ABBG HIAH8,4T_HH`,;BBB B(G0C8J` 8D0A(B BBBG p8IT-YBBD A(Lp?xAFDHAGHIALpc (D ABBG xKbxApI@04Hk$IEW A q A KI@0bJ0lPJ0>NDB B(A0A8D8A0A(B BBBAhJ2[d^ XJ(3@J3)FBA A(G L@LD (A ABBA HJ4BAA G I \  DABI x N O F G `(KD5BBB B(A0A8G I Z N N C S Z 8A0A(B BBBF 4K5mBAD n ABH iAB,K6Bp F G^ YHY I 4K6zBAH A ABA fAB,,L7BAD [ ABK 8\L7BFD B ABG Z AEH @L8!BBA A(G L"e (D ABBI L:AI Fq G ,M=AC M G L0MEBDA F(M0 (A ABBA  (A ABBA lMFIB B(H0A8DL_GXj 8A0A(B BBBF \GJEPN_ETMBnTMANOFNWTRAENOFNP@Q[4FBE K(A0G@f 0D(A BBBG _HNPOXF`H@@Q\FAA DP|  AABD   LFNF QT^[H_ I \Q^ECI K(K0_(C D AAA J(F0Q(A F AAF D (N0N D(N0pTR8_FMD A(J@SHOPNHF@X (A ABBJ bHOPUHC@l HQPWHB@LHLPY U HGPE HR`EGL M(K0_(A I AAE c(O0H(A FAAS`FEB B(A0D8FS[L 8A0A(B BBBF KBA@NdEOrA| Uo REBBBDDDDDGBBKFDFFCBV!MXBA GT l(ThOBII E(D0A8FPZXF`JXFPsXI`NhGpAxBIPL 8D0A(B BBBF `TtiFBB B(D0A8D`OhKpghA`D 8D0A(B BBBH d hKpN dTkaFBE A(D0J 0A(A BBBA HMdChOyAdUmFBB B(A0A8G L@LDb 8D0A(B BBBD DTDLDADDMDMDPDMDnDRDQDADU\qZFBB B(A0A8H Q GСءMTTMС6ءTLءAСnءOQءAС 8D0A(B BBBE yءEBEaСءMPTHС| ءOE kءLMHIСaءPMءBС\VwOFBA D(J (A ABBE \OyAMdCD\Wy$FAA G L!y!T!L!A!v  DABF 0WzFMD u DBF dDB@W${FJL D(D0G`g 0D(A BBBC 4X{FAH D ABJ fABTTX8|)FEB E(A0D8DPi 8D0A(B BBBG XJ`_XAPX~BBB B(A0A8G L@I@@Q@a@A@^ 8D0A(B BBBI w @Q@X x @Q@W R @Q@U K @Q@T 4@Y<FHA G  AABA 0xYFAA D`o  AABA 0YFIA G`e  AABH 8YFJD G(L0\(A D ABE 0ZFKD D  AABK PZESPi DK tZxESPj DJ ZESPW DE 8ZpJFBA A(D0 (D ABBG 4ZFBA D(D0q(D ABBL0[܉FMD  DBG q DBI l DBF s DBG [\Hx H | D [8xEB I gx[FBB B(A0D8JI]A^ 8D0A(B BBBC s IT tK\A<@\̎OBB D(D0t(A BBBJΌ\<FFB B(A0A8G 8D0A(B BBBA HOAkIJFPNBHNA\]\+FDE I(D0A8G 8D0A(B BBBB nDKBTp],FIE B(D0A8F`jhFpJhF`j 8D0A(B BBBH h]FIE E(K0A8FP\XM`PhFpOPx 8D0A(B BBBB IXM`PhMpOP44^XFAH ^ ABH fAB`l^М{BBB B(A0D8G@WHNP]HA@L 8D0A(B BBBH yHIP^HG@L^)FJE D(A0b (D BBBJ f (D BBBH  _̞Uas<_HP_ܟFBE B(D0H8H@ 8D0A(B BBBA (_EDD0x DAE L_FJA D(G0 (A ABBH i (D ABBA L`FAD g ABK | ABA H(o0P(D A ABA h`TSFEE D(H0 (L BBBA } (C BBBJ e (A BBBD  (C BBBF \8Q@`8H0g8Q@`8F0Y8H@i8D0[ 8H@B L aFBE B(D0A8J 8D0A(B BBBE \a`$FEB B(D0A8G 8D0A(B BBBF G 8G0A(B BBBE cNZBEFAiL_B~NNKFM\AlbԮ)FBB E(D0A8LZ 8A0A(B BBBD NLQA@HNAb!FBB E(A0A8I 8A0A(B BBBD hHQA_PZAROBiIbEL`NJHkv EE  EE Lc`c @tcAAJS DAD gNOFKcĹctc̹[BB D(A0A (A DBEG ^ (A BBBC D (A DBEH \(A EBEGXdDld@BBB B(D0A8DpxKGxAplx]LHUp^xOKFEAJpc 8A0A(B BBBJ HdhBBE E(A0A8DP 8D0A(B BBBN p@e<BEE A(H0 (D BBBH R (A BBBG j (A BBBG f (D BBBA `e BEE B(I0D8D@ 8A0A(B BBBF A 8C0A(B BBBA `fTBBE B(D0D8G`z 8D0A(B BBBG hKp\hA`_hRpUhA`(|fZBDD HEB0f{ADG0M DAJ NCAHf0GBEB E(A0E8D@ 8D0A(B BBBD H(g4(BGB B(H0G8GPl 8D0A(B BBBD ttgBMG B(A0H8OPXJ`YXAPlXM`VXAPI 8M0F(G DBBF XJ`QhHpRPlg09BBB B(A0D8G@~ 8D0A(B BBBA H_PWHB@ZHMPqHA@LHIPmHA@P\hBBB B(A0A8G L@I@ 8D0A(B BBBA dhFBA A(G{ (A ABBF lGHFPd GHFE Pi FAA Q ABD P(T0L(D A ABA a(T0L(A Lli%FBB B(A0D8D 8D0A(B BBBD i iPP`i.FBJ A(D0 (F BBBD q (C BBBF S (F BBBA TjXTEJ8pjLFCD t ABD  ADJ jzdj FBE E(A0D8D`j 8D0A(B BBBF DhNp]hA` hNpZhA`(kk\@k|FBE E(D0D8D@y 8A0A(B BBBG T8A0A(B BBBXkFBB B(A0A8G`$ 8D0A(B BBBJ 4hKpVhA`dkFIB B(A0A8Dpc 8A0A(B BBBJ  8D0A(B BBBE HdlFBB B(A0A8D 8D0A(B BBBB Xl|BBE B(D0A8D 8A0A(B BBBG zH^C m 2BEE B(A0A8N- 8D0A(B BBBH JN_B H[I NL ] HJ YFdA FE qbGAQ^B NJ 3 NJ Hm;BEI E(A0D8GP 8D0A(B BBBH @@n,=FEB D(A0G@ 0D(A BBBF Tn@BBB B(D0D8G`hIp^hC`X 8A0A(B BBBE \npB[FBB B(D0D8J 8D0A(B BBBF SbA|FHE E(D0D8GOFFRV 8A0A(B BBBE {LFFN\FDDBJW FDAF HTFJD F(D@ (A ABBE U(A ABB-FFE H(A0D8J  M F F ]  L [ A   \ F B  _ q A M K ^ A h 8D0A(B BBBE D  K Q  F H A f B B B M  P Z B HFJB B(A0A8L@U 8D0A(B BBBA <@FBB B(G0D8GP}XM`QhOpIPFXO`PXBPBXB`bXBP^XD`GXAPYXI`]XAP 8F0A(B BBBH AXM`QhLpIPFXO`TXAPBXB`eXBPbXD`GXBPXXN`SXAPJXN`\XBPXXG`]XAPUXL`TXAPOXK`[XAP(8]EAG0L AAE ddHFBB E(A0A8L`hJp_hA`] 8D0A(B BBBD [h^pOhA`x̋FBE E(A0A8G@F 8D0A(B BBBB HNPYHB@7HQPYHA@HGPkHA@]HOP@HTFAA JS_G|  DABA T FBB D(A0GRcA~ 0D(A BBBA t!+FEI B(D0C8GMULEEBBBEEEEEEBBEEBBBBBEBBEEEEBBELqMULEEEEEEEBEEEEEEEBBEEBBBBBEBBEEELQULEIySRLEEEEBBBEEBBBEEBEEEEEEBBEEBBBBBEBBEEELjMULEEEEEEBBBBEEEEEEEBBEEBBBBBEBBEEEEBBELI 8D0A(B BBBE DSRLEEEBEEBBEEEEEEEBBEEBBBBBEBBEEELkMUIBBIdSZHMULEEEBIJSRLI/MULEEEBEEBBEEBBEEEEBBBBEEEEEEEBBEEBBBBBEBBEEELSRLBBEEEEBBBEEEEEEBBEEBBBBBEBBEEEL&IbBdSRLEEBBEEEEEBEEEEEEEBBEEBBBBBEBBEEELgUIBEEEEILRBULEEEILgA HH KGfAJ DJ  GL \ HH B\ITHTA|\@GqFIE H(D0D8Dp`xVQIIp 8D0A(B BBBE xMLxApxHBGIpܓͰ p OJFDE B(A0A8J 8A0A(B BBBD I[BlLwAIIZArPUAQsAe1FBB D(D0o (D BBBE l (A DIBD V8V@H8C0b (A EBBE [ (D BBBC p (D BBBF D8thFBB B(A0D8DP8A0A(B BBBDhFEE B(D0H8I@h8A0A(B BBB8ȕ4iFDD h ABG YCBLiBOD D  DBBG IDDGGGNTXjFBB B(A0A8G L* 8A0A(B BBBE '*P*^*A**R*M*D*Q* *[*M*K*\**R*M*D*L*0~ FFB B(A0A8J 8D0A(B BBBG MVB`MVBDDLODABBILMUAm NJ > NR cI_A OL D OL TFHA JEmAO  AABG lFfC4<FJ[GGUb EA @tXFFB D(D0O 0A(A BBBG n\ИFBE A(A0d (A BBBF _ (C BBBH Z(A BBB0<Hl D t D @P܍FAG M DBG b DBH QDBFFBB B(A0A8G L@LFFBFTFAFFGFHFAFXFcFTFMFAFJ 8D0A(B BBBD JFbFOFBF| FGFHFAFO 0D( FBA L@j  DBBI HxFEB B(D0A8G@ 8D0A(B BBBH |ĚFIB B(A0A8D`hNpchA` 8D0A(B BBBE hMp\hB`hKpWhA`A hKpI Do `d FBB B(D0A8GJOfB J_A H]AOZBg 8A0A(B BBBA MZAM]Hp<FDE E(D0A8Dp 8A0A(B BBBE QxIhxAp 8A0A(B BBBC LܥrFBB B(A0D8G 8D0A(B BBBG h FIB B(H0D8DPXK`MhNpMPB 8C0A(B BBBA BXM`YXAP8lpFEA I(D0 (D ABBA T <НFAG w DBE H IBM eDBH|FBB B(A0D8G` 8D0A(B BBBJ \FBB B(A0D8G`hYpFhB`D 8D0A(B BBBH [hWpUhB` hMpQ DhFpMxTN`khFplhA` hWpS  hMpJ l@FBB B(D0A8GPXM`jXAP 8C0A(B BBBD T 8F0A(B BBBE XlFBB E(A0A8DZLfB;bEIIX 8D0A(B BBBA -hTMJSBUnTMdI\AhqA[ NH JWBKk[AbNVAXoEBYWAI YB wjVHrMȠ Xt&FGE B(D0D8GM^Aj 8A0A(B BBBH DH*FBB B(A0A8G L**l*Q*B*\*J*P*A*r 8A0A(B BBBE u*P*`*B**b*U*A**T*]*A* *I*V*A**I* ע**4,JtE KP_ C DE ^COpdXFSB B(A0A8D`ohEpJxBGEEDBEQ`a 8D0A(B BBBB HآFBB E(D0D8G 8D0A(B BBBG $FJE B(A0A8D` 8D0A(B BBBH ehJpJxJGKQ`hPpLxBBBI`hMpahA`LFBB B(A0A8G L@I@ 8D0A(B BBBF S@MATAPAI@e@IASAOAO@i@GAP@A@U@KA^ADAM@r @MAE R@TAO@B@@IAOAOAS@\@HAHAHAS@| @IAOAOAE R @IAOAHAE d@RAHADAM@`@TAHADAI@e@DAHAAAS@s @FAHAAAB b @FAKAFAE J @KATAHAE \@FAHAHADxnFBB B(A0A8DpxHBFBBAHBEVp 8D0A(B BBBA xHBBBBABBEVp<D:FIA D(G, (A ABBC @(DHFBB A(A0D@ 0A(A BBBG `lPFBB E(D0D8Gb 8A0A(B BBBF \ 8M0H(G IBBK \ЦFBB L(A0D8J 8D0A(B BBBA |HFA0|FEB D(C08H@GHBPBXB`AhBpBxBI0 (A BBBI w (C BBBH u (C BBBJ b (C BBBA ȧFIB D(D0w8K@JHBPBXB`AhBpBxBI0] (D BBBF M8K@JHBPBXB`AhBpBxBI0+ (D BBBK r (D BBBD p 04FDD N CBG LjTȨFEB E(D0C8KJTAPTrCh 8D0A(B BBBD nBVASB[AdIGEs[@EUcBI@FMQ A(A0G 0A(A BBBH 0ԩ8bFAG d DBH ^ABxtLFBB E(A0C8T  8D0A(B BBBG MTTJkMTTKLHVBNP G(OJHFKZ (D ABBD ԪXnBBB B(A0A8G L"o 8D0A(B BBBG !"T"L"B""T"M"A""G"["B"c"T"L"B"{"M"F"N"O"c"T"L"A" +BBB E(D0D8GQWDBEVY 8D0A(B BBBF MHHZNHDCQ<VNDBEQYVID_IEWDnDGT,,5@ FEE B(A0A8DJhFIHLJEAbNOJSj 8A0A(B BBBI RM_BM^CD 8A0A(B BBBF ` 8F0A(B BBBI OTAL`Bg OL MoBhMgA(<=FAQ0N DBD =\FBB E(D0D8GPhXM`gXFPXM`XXBPy 8D0A(B BBBK eXN`VXGPiXL`WXAPnXK`\XFPLXM`YXDPD@NDH z ABI K LLE ~ CBE 8ȮAFEA D(G0t (D ABBD AFFH B(A0I8GJSALHFKn 8A0A(B BBBF xMRRI8CFBA A(J (A ABBA HȯDdFEI B(D0A8D` 8D0A(B BBBI HEFBB B(A0A8Dpr 8D0A(B BBBG @`GFBB D(A0G 0D(A BBBG HHFED G(G0k (C ABBH D(F ABBLLI#FAD G0E8O@QHIPN0d  AABJ j8O@P8F0@@,JEDG S AAK ^(I0](A I AAH txJFBB B(A0A8GZ 8C0A(B BBBE LZAZ 8A0A(B BBBF 8KFFB B(D0D8J 8D0A(B BBBF (PkAMPJUTOIGNfOCAFGNWOIGNvKJINMUBKKAJHLSm JJ fN\BKJCN48YEAG0D8s@H8C0U AAJ Hp%*cD`2 MD2Y 2* 2 3Z 4b >  ( 04 h$X4   0uD4'cD4 FP(6 cD@7 cD07$ B7& F:08m\" @p8G"H$FQUD8n tD -H:  F8@;"B$< F? F@F2A F8CFE"F.G " G I!O"bDG8N"  $8:#] $F@$g $F%y F&**D O' XP(D Q)YDR* FR+ S, FU-pDW..0D(X/AKDxY0X3D@Z1I-D]20^2DP^3q$``4hDa5KDF6ID@e7UDe8UDPf9hDh:F8k; "@MDk< UDn=& iD7 o>qiDq?@uUDhu@R DuAvjDwBj  qDD6!Hw C DwD  D6!8xE  pDpyF D(zGF DzH pjD@zI pD(}J}YD~K  FH~L cDM,  cD@!N?  eD[ Oc  FPq pcDPQ pDR FS FT FF U FPV FȆW F?X! FFY; FPZP F[i F\z FȊ] FX^ F@x_ F` Fa F؎b Fxc  FFБd Fؔe Ff DXg.  D? HhK  D؛pi\  D(jg pkr bDly  pm6] @ n " Fآo  p  q  pr  sr ^ؤtb u  H v "cD@w "Fاx "FHy* z   `{ p|    Щ}  (~  P  d*  ?0  (5  s{; 6DO  Ьb xV  F F52g "@ Fx "@ F      uD    F 2D *DF *DF$ 0>Q4Dh @ Pt F9DH`DDKDp WDF cD/6ظO pDfPYDxF]DFDFD|D}D|DH F  F8 ^DNcHt dD dD F."`DpA"dDUX"FUm"BcD("BDx lDh lD lD/FY Fr"lDp"lDU("FU` F"FU*"B FP@ DQa@n uD - @uDx'VDxDDF h3D9DVDYD  k"YD04 @C S Ht"B d"BaD"BYD cD@cDsDx   YD 9D@6 $H& $9D[8AKDdx_KD`YDd{YD Fd8 F "D>D`>D?D?D8cD! lD1`?"B|Dh:"B|D ODX eD xD   EDP @ ! ED$ | @ "D F  F F Fƽ F H F  D H% sD(  D0* 3 + ; + D - W "(- M lD- a$D . j'DX. q . lD.  {D/  eDhA  eDA B  eDAB   C  CD  pD8E ' 0E 8 F`F A F(G R [G c H@H l HH  }`I   I J   JJ   "pK   "KpK   "@LL  DPM  DM  D@N  D'N  DA@O Q D0O _ D[@P m DP { D@Q } DQ DhR DR  $S8S  WD`T  $TT  YDUU  DV 4 F@X   FY! g ID^q0Z"  XZ#  Z$#"B X]%  uD8^& "BuD_' !|DPa(0 p  ` @ @  0 7 @f 2 G O M k i PM Y 5 W `X X %thin-pool@%thin fb *@rp@F*fP`*m@F* @ 0 P 0 @ 0 )8)`,JCpEp*)@>*RPGDF*iilllmmiiQhkpl0esdide@mdloop*ramdisk6device-mapper?mdpMdasd@dac960^nbdeidazccissubd`ataraiddrbdrbdemcpowerpower2i2o_blockiseries/vdgnbdaoexvdvdiskps3diskvirtblk+mmc7blkextHfiocmtip32xxmvtms}skdscmbcachenvme@zvolVxDMPzramnoneQQudevR S{....@.. ... .... .. ..@. .@../\/ //5/O/d/p/.///O.@/@ @ @ @@`@ 7@@002 666 7`0 pp))P:<P>)/@/ p)P8<   ` Г ` `  ` p  0 ` p @ P P ` ` p 0 И p Д ` ` `  agotodayyesterdaySunday,Sun,Monday8Mon8TuesdayDTueDWednesdayPWedPThursday\Thu\FridayhFrihSaturdaytSattnoonmidnightsecondԩsecԩsԩminuteminmhourhrhAMPM(day4week@monthLyearXyrXJanuaryJanFebruaryFebMarchMarAprilAprMayĪJuneЪJunЪJulyܪJulܪAugustAugSeptemberSepOctoberOctNovember Nov DecemberDec{,3@NZfnvƦԦ )7GUboy§06 < 8 9 A > PV X 4 W 0X X ;;X;W;;; : ;гEUгkgwk8{a; C{1s{+v C1qp5Cq0@0@0@0@PY0PY@f0f@]0]@gG0gG@ZF0ZF@GýνE0GýνE@!D0!D@6[06[@)Z0)Z@'!.0'!.@ӽ!ڽ0ӽ!ڽ@!ƴ0!ƴ@!0!@0@ Z 0 Z @ 0 @ 0 @ 0 @0@H1s{+v 1qp5q0@H0H@"a0"a@U30U3@0@0@> ~0> ~@c2v0c2v@U3u0U3u@ֳt0ֳt@,) ;Ѻg|:5o` Ј p P p P Ц P ` H`%@% %%%%%%%%`%P%0% %%%%%%p%P%@% %%%%%%%%`%P%0% %%%%%%%p%`%@% %%%%%%%`%@% %%%%%%p%`%@%0%%%%%%%`%@% %%%%%%%p%@%0%%%%%%p%@% %%%%%%`%@%0%%%%л%%%`%P% %%%%%%p%`%@% %%%%%%%`%@% %%%и%%%%p%P%@% %%%%%%%%`%@% %%%%%%%`%@%0%%%%%%%%%`%P%0% %%&lv_uuidLV UUID lv_nameLV2 (lv_full_nameLVC hlv_pathPathPD lv_dm_pathDMPathD lv_parentParentC  lv_layoutLayoutPz  lv_roleRole {  lv_initial_image_syncInitImgSync P lv_image_syncedImgSynced"  lv_mergingMerging`!  lv_convertingConverting  lv_allocation_policyAllocPol 4 lv_allocation_lockedAllocLock@  lv_fixed_minorFixMin  lv_skip_activationSkipAct0 P lv_autoactivationAutoActЂ xlv_when_fullWhenFull  lv_activeActive# J lv_active_locallyActLocal$  lv_active_remotelyActRemote:  lv_active_exclusivelyActExcl{  |lv_majorMaj0 @ lv_minorMin0 x@lv_read_aheadRaheada @lv_sizeLSizeW b@lv_metadata_sizeMSizeu  seg_count#Sege originOriginE &origin_uuidOrigin UUIDPF X@origin_sizeOSizeZ  lv_ancestorsAncestorsPN  lv_full_ancestorsFAncestorsO  lv_descendantsDescendantsPQ X lv_full_descendantsFDescendantsR  raid_mismatch_countMismatches  raid_sync_actionSyncAction  raid_write_behindWBehind`f X raid_min_recovery_rateMinSyncf  raid_max_recovery_rateMaxSync g  raidintegritymodeIntegModeq  raidintegrityblocksizeIntegBlkSizes  integritymismatchesIntegMismatchest (move_pvMovePT P&move_pv_uuidMove UUID@U convert_lvConvert`B &convert_lv_uuidConvert UUIDA mirror_logLog: X&mirror_log_uuidLog UUID; data_lvDataP< &data_lv_uuidData UUID= metadata_lvMeta= h&metadata_lv_uuidMeta UUIDp> pool_lvPool@? &pool_lv_uuidPool UUIDP@ @lv_tagsLV Tags0 žlv_profileLProfile  lv_lockargsLLockArgs lv_timeCTimepv lv_time_removedRTime`w  lv_hostHost @lv_modulesModulesp h lv_historicalHistorical` Ӿ writecache_block_sizeWCacheBlkSizeg  lv_kernel_majorKMaj  lv_kernel_minorKMin @lv_kernel_read_aheadKRaheada lv_permissionsLPermsP  lv_suspendedSuspended@  lv_live_tableLiveTable X lv_inactive_tableInactiveTable  lv_device_openDevOpen~ 2data_percentData%0o snap_percentSnap%n metadata_percentMeta%o 8copy_percentCpy%Syncp sync_percentCpy%Syncp  cache_total_blocksCacheTotalBlocks L cache_used_blocksCacheUsedBlocks ` cache_dirty_blocksCacheDirtyBlocks s cache_read_hitsCacheReadHits`  cache_read_missesCacheReadMisses  cache_write_hitsCacheWriteHits  cache_write_missesCacheWriteMisses kernel_cache_settingsKCacheSettings kernel_cache_policyKCachePolicy ѿ kernel_metadata_formatKMFmt  0lv_health_statusHealth  kernel_discardsKDiscards` X lv_check_neededCheckNeeded  lv_merge_failedMergeFailed`  lv_snapshot_invalidSnapInvalidP vdo_operating_modeVDOOperatingMode vdo_compression_stateVDOCompressionState ( vdo_index_stateVDOIndexState0h X vdo_used_sizeVDOUsedSizepX  vdo_saving_percentVDOSaving%h  writecache_total_blocksWCacheTotalBlocks`  writecache_free_blocksWCacheFreeBlocks 7 writecache_writeback_blocksWCacheWritebackBlocks  writecache_errorWCacheErrors U lv_attrAttr% pv_fmtFmt n&pv_uuidPV UUIDP @dev_sizeDevSizem 8 pv_namePV  pv_majorMaj  pv_minorMin @ pv_mda_freePMdaFree\ h@ pv_mda_sizePMdaSize]  pv_ext_vsnPExtVsn0e @@pe_start1st PE@V @@pv_sizePSize@\ @@pv_freePFreel @@pv_usedUsed[ X@pv_attrAttr4 @ pv_allocatableAllocatableP @ pv_exportedExported @ pv_missingMissingp @ pv_pe_countPEb @ pv_pe_alloc_countAllocb 8@pv_tagsPV Tags0 ž@ pv_mda_count#PMda@n h@ pv_mda_used_count#PMdaUsen @@pv_ba_startBA Start@V @@pv_ba_sizeBA Size@V @ pv_in_usePInUseP6 @ pv_duplicateDuplicate P@pv_device_idDeviceIDPx @ pv_device_id_typeDeviceIDTypePy xvg_fmtFmt n&vg_uuidVG UUID0 vg_nameVG vg_attrAttrP7  vg_permissionsVPerms  vg_extendableExtendable ) vg_exportedExportedP B vg_autoactivationAutoAct  vg_partialPartialp Y vg_allocation_policyAllocPol0 o vg_clusteredClustered`  vg_sharedShared9 @vg_sizeVSizeY @vg_freeVFree\ vg_sysidSYS ID0  vg_systemidSystem ID0 vg_lock_typeLockType@ P vg_lock_argsVLockArgs x@vg_extent_sizeExt0`  vg_extent_count#Extb  vg_free_countFreeb  max_lvMaxLVb  max_pvMaxPVb 8 pv_count#PVb  vg_missing_pv_count#PV Missingd p lv_count#LVpe  snap_count#SNf  (vg_seqnoSeqb  vg_tagsVG Tags0 žvg_profileVProfile  vg_mda_count#VMdad  vg_mda_used_count#VMdaUse`d 8@ vg_mda_freeVMdaFree`_ h@ vg_mda_sizeVMdaSize^  vg_mda_copies#VMdaCpsd segtypeType  stripes#Str b  data_stripes#DStr0b @@reshape_lenRSizei p reshape_len_leRSize`j  data_copies#Cpyb  data_offsetDOffk  new_data_offsetNOffj  parity_chunks#Parb @@8stripe_sizeStripe0` h@region_sizeRegion0` @chunk_sizeChunkZ  thin_count#Thinsg @discardsDiscards0  cache_metadata_formatCMFmt  cache_modeCacheMode  zeroZero  transaction_idTransIdp 8 thin_idThIdc @seg_startStartPY  seg_start_peStartb @seg_sizeSSizeY @@seg_size_peSSizec hseg_tagsSeg Tags0 ž seg_pe_rangesPE RangesP  seg_le_rangesLE Ranges seg_metadata_le_rangesMetadata LE Ranges` XdevicesDevicesP  metadata_devicesMetadata Devs seg_monitorMonitorh ( cache_policyCachePolicy X cache_settingsCacheSettings  integrity_settingsIntegSettings   vdo_compressionVDOCompression  vdo_deduplicationVDODeduplication  vdo_minimum_io_sizeVDOMinimumIOSize @vdo_block_map_cache_sizeVDOBlockMapCacheSize 8 vdo_block_map_era_lengthVDOBlockMapEraLength` ` vdo_use_sparse_indexVDOSparseIndex *@vdo_index_memory_sizeVDOIndexMemorySize` @ vdo_slab_sizeVDOSlabSize  vdo_ack_threadsVDOAckThreads  vdo_bio_threadsVDOBioThreads`  vdo_bio_rotationVDOBioRotation E vdo_cpu_threadsVDOCPUThreads` ( vdo_hash_zone_threadsVDOHashZoneThreads ` vdo_logical_threadsVDOLogicalThreads`  vdo_physical_threadsVDOPhysicalThreads  vdo_max_discardVDOMaxDiscard` @ vdo_header_sizeVDOHeaderSize`  vdo_use_metadata_hintsVDOMetadataHints Hvdo_write_policyVDOWritePolicy  pvseg_startStartb  pvseg_sizeSSizeb [devtype_nameDevType  devtype_max_partitionsMaxParts   devtype_descriptionDescription y log_seq_numSeqb log_typeLogType log_contextContext log_object_typeObjType  log_object_nameObjName (log_object_idObjID 0log_object_groupObjGrp 8log_object_group_idObjGrpID @log_messageMsg 1 Hlog_errnoErrno0 > Llog_ret_codeRetCode0 E1R Ve ie e xe @0 @ P ` p ! *Q@B(PQ"B(Q B(Q B(("&(( DB )QB%Qc@b) '0)@ H)QP&` %R)@ p)(RЮ z)QPB e)])hR )))))R`)R@ES@))@%*0X@8S0"&`-*hS@&4*S=*S@ iS B*TpI*PT`* TS*T \*e* *Tp".!** ""**B#* UB$`UB%^U@B&*U&'*U(*VD@)* V$**PV0+r+s,+xV0s&-$+V .-+V /6+V0?+M+1i+(W2y++3+XW4+W5N+6++P7+W`"&8++&9,W:,None,Bool0Number@2,SNumber2",PNumber1%,Uint32ЬStringЬVGЬLVЬPV Tag Select Ь,,ActivationMode 0F,Active 0M,CacheMetadataFormat0XCacheMode `V,Discards@q,MirrorLog ,SizeKBp{,SSizeKB,SizeMB,SSizeMB,PSizeMBp,NSizeMB,RegionSize ,Extents0,SExtents@,PExtents,NExtents ,Permission 52MetadataType ЬXXUnitsXSegType 0XAlloc!`,LockType"-Readahead # 3!-MetadataCopiesVG$3-MetadataCopiesPV%@4unused&  YPollOp'6-WriteMostlyPV (A-SyncAction )N-ReportFmt *0b-ConfigReport +@YConfigType ,YRepairType -@YDumpType. y-HeadingsType /,ConstString 0,ConstNumber 12 000000    E9   E helpHelpR ?HelpRsdide@mdloop*ramdisk6device-mapper?mdpMdasd@dac960^nbdeidazccissubd`ataraiddrbdrbdemcpowerpower2i2o_blockiseries/vdgnbdaoexvdvdiskps3diskvirtblk+mmc7blkextHfiocmtip32xxmvtms}skdscmbcachenvme@zvolVxDMPzram"` PK g # X OP P  Ѝ   `}~HGIjipkp  80749E;;(4$4'P5&5"@#@! 5,`-` 5)5%57`a`ap0*+ 3p.p4/rpq`J@Kж\жLж]жMжXж^ж( A C R selectedSelectedUPb helpHelpR ?HelpRA A A C C :C 2D (D ! $D ](6D r(AD uJD 8 \D A F lD @xb pD b oD `b rD 0c  hc uD c 8 c xD d _0d ~D `d  d H c x        P >%>%o8  (X&3- o*ooo+oo(o U&0P@PPP`PpPPPPPPPPPQQ Q0Q@QPQ`QpQQQQQQQQQRR R0R@RPR`RpRRRRRRRRRSS S0S@SPS`SpSSSSSSSSSTT T0T@TPT`TpTTTTTTTTTUU U0U@UPU`UpUUUUUUUUUVV V0V@VPV`VpVVVVVVVVVWW W0W@WPW`WpWWWWWWWWWXX X0X@XPX`XpXXXXXXXXXYY Y0Y@YPY`YpYYYYYYYYYZZ Z0Z@ZPZ`ZpZZZZZZZZZ[[ [0[@[P[`[p[[[[[[[[[\\ \0\@\P\`\p\\\\\\\\\]] ]0]@]P]`]p]]]]]]]]]^^ ^0^@^P^`^p^^^^^^^/sys/@p&@p&Pp&Pp&`p&`p& 1 p&p&1 LVM-/dev/mappernone SIGINTSIGTERM8&8&H&H& &`&`&&&&&&& & &Ј&Ј&&&&& & &0&0&A&`m`&&X&X&&&&& & &0&0&@&@&P&P&&& &&&&&Ў&Ў&&&liblvm2cmd.so.2.03-2.03.33-4.el9_8.1.x86_64.debug>_7zXZִF!t/o[]?Eh=ڊ2NrUE୺^J)PTG)p}Pv5)qcz;2x(65ji ְhsMsqIzh 7NxX;}aee|A-$>L [8J:t7Gr΂XylV(x&ٌ+0 &[7{brIʡy0)[bULUth/!+v0G~7믦Bʔbysޥ͘R18!+n/6,79CE=W{PaspByD/~>ՂӋէp:a[PK0'k@y|R(˶ sMErP g=Na(6/݅Aa;LD,U:Y.!rm QU _DM %BBѢޗB՞IRiL֣g-um ^ր3,UD!3>M?L(%jqd. d߻i]eHp1&$'?7-g0WCZɻLQwgwk{5 Vi!@cCQb|P:(ߥ,"f z2N4ܳ0+ z!T|+ 0Y mWu 1?OSޕ`WF{?'1~*n?-*ofL)\r7.Ku&̤jg:Ti Q'Gchk Ç4o:5[F"mo[NCuBF5+Z넾z.<]/v+)|[J{co<[AXĪʯvsb ٰ|*QڦMMD*AS'.skU>c?K4S$J(r^'ŸP| `zע6ݛ]J_Ј/{CT. ^,#L8 Ey ;aG ^“ǹ RO1% >i= FVrEe4g}% FgS3G+1ρ/E[é,. <<`f|z+:7V!]^{4mGk#R`1q}Bv|m-Gubhҳ, ӗAvE?mBHHHZ-aDrѶmL'^i}fGBf"&=a,re5Dgy]HֈQž Y?|6hUpwN6摵#Ғ qO[X_̝P{Zf":ds\B\ȗ s瞰Zh|E3kOFI`3FRm6OLxė8F⵵<| W %ݴJo,ȖFI EPkq0J7^iۃrb%Am ŭqe[R7˥Otמ]xg0o-,f$fKڭϓɂAٞ*9DB(n\~ҭ M;!K*MCOP8DH:J[/UbqHP4{_sX+=ߣRk«\㝞AnxK[=szR@;\| ;˔] uKNV!T%GK}Lڼj.1iFkz|.Nmn 2|7hNƲ'erchwzw9[,x,}^y_Qkwy^}mӑE5U & 甮avFҺ[u!Vnc0NP]AA-mizc#nɧ.<@Ѩ+ 7`5_j<+mZ)NONVW=X ]E,zwN ީK оD`X ˂Sv=pU}648[d {T8y čڦ؏oqffR$q| SZJ2B#4KVO߶ OZ,PMͣ{ugS8 yjJوkB:,uR.хU$b(j.2,k<)2/3?`Ď׉C@hiABÚLԚԥ֯oQcD:1WR>i+ gE;AaBlL#R!fgi(rݠT8`]JO {c@?@ j"/EJ< Ty 񵘸mA*\uW@"L&CG.r ] oh^u j)fm?J5) H# k%&b 䁚a({l*??52a ojee^HAV=ݤRXLDFGl8*VԊ43ⴿ]^Oq\۬ L|4o\^Xd+WWet]Qfc,0vj"gpj)ݚAec5#}M)`!,'.P7a67䌽A6Lm#jV"$r$Z5(9>u8$΅eN<>)Qo=@>lܜ}AqUw˕VSꎏ"s" '0N7R^ӉGCee +AXtR(V6ivWìRO\ fF~Lպ:7\4 qHsmb >7"4TvSNɺՖ"rK~Ə;a3yy.kX9X{R,"r;K' q9eR NZ5Ǹh5q7~ hT2]@`2z Y:2|ՠ?mp.[ut7nqK]a% XZxVg,cX}w֗y0j<*]6*7eb7UVK4T2<ӽւC@ oywd'E6MIQq}f uܾMb% 3\ZN(.h}P'x%b:"w<;*$xb>m}١5TQQ5w=.2zĨNb qI E`" a cG4$qJӈ+L:H[zH'D$)N=@ IS۞S׻eدD9( ,M4b~%FJׁ{A֒h\CixٿbV$h??OlqF^fROlQgi-{jA%Rݷ#XS~㨖^&gփ6tFzTAck;8B} +Rj KP?3ȱMY yN}c4IQ%ݟ A8()Nz}F>}e fsw5ԾwjHt9pyα>͚fYȼ*o'J3WlJ8]Ʋ:hZKׁ(YO w#p t4 2vD iUb[UA<:\4]BJ5Ɲil^wp&d*|IQxeтqld8i ¼5~`3H~&YOvS}~b~i|UR,33> 06ԿMLm-ʞ6Q* #\oW!p\tjGwa&_i"l,>%2:;9w8@9]gڟξ7qe>hAZw4n/̙9<-;Qp{$":󋛶JUTདྷF] <&0#:w0z&+8l/Zv/SGiWS`8՜M Ks j1ԗq逍a`Wv{73i3~xASsPgAq*}~F.i st:X=HpH[s'@ >i۴zZ\J/{x6O:ݜ6n0i)è9rO1U@o'-_rqٌ!&CUӱ 9TV71K @?EzuRnj4핁hry&UάgV__PCMϻE WLѧGsq}UD±IO (_Yū*W"?rQP$Bf3wiH4UYwQ0d'H"eP쒑;<[dE#mܸ #xm NQcC$i)0qwY<O%m1?g oJՋ+DLTT^Dxae'5ylM[@0ѫR݈N0%Y+in*P*hz=©1g{ nND&,Z(|c€G(*98&,?芩+th?⭜}i@Ӵ }bU:)nɨF _lBλ |!i/rэSN N6b_ s6qJrWOuތx(&Ӂ] 9q)bk5>=@jEqPPDkOXDXoM=߰0=6,diH#G1\SE{;QG2[iM:;-j}y%Enj_^KHnfH_!;% X)e]b|2 {]ZAL ^a p@'GxA`|Bb3\6_3 [0/3>ack5J? .;렓5VO4ٯwA t]]S?"CU Qe&{5X3E;$ls՝z zHNa\GH^ԔҖ%~y!Tv*EЅdW0Ȋ LZٽ|~$ +Dw^P \˿*oIJ׺>3fV&`Jy!Gs՝W VmsiU8Tq%%.(" %8- TJr%u*]Gqtl@޽W4jWA0Hd<x1fYBj PedοUF.^*̺2![G(Б099 3Mb;&r^TNgC5n(N`o!bPQ¢ G|-9w&:*Z9K>D&Λl) F Yt4-D@J?{.9gȟ@ yCswI2nozȐg^!cLmrڅ60^uZXxy;Su Ew`*1[ʸ\p[}1$*_/(]#,q ,lB…401b083K_3I5kΞPu~ &6ZHvo$,o+?y5pfx<@V;}evY~|qڛTw[ڊ Z3 hE~aM.ƒ,vBcJm}LoH ]$h5F -&q2kK`0]]θH3]SBK-;z y2rvcc \[QCʫ "'A&~&9~.25={mcg_#C,eZmֳ[%`8 Bjk Iy߹ܝ}oo0x] E^Q} e88%&I~!N0;0sKOib`)|!IWa*L9 ̛a7<y~c֡Xtц< F댙[U^i/jv^Dְ܄tpSyp G>KW-nAC 5!(jmupP6LVZ~=Pm, Q[N58ک=}Ǫ srIޥ1"2:2tcF_Q!jVi얨t\JӉ©}KXYW:멚-u%TwYxF-ui_CgdPU$dtZc@w$yfY}^+?3Jst+FG W auw?̘+ BqY&/!| q &0_4N]%`ݳ$ń\}O[mXJ' wɄ02_e v?A4vj~]YG mGL~Kt6XL!GI09ٱ(Eڼ/C>$Es|jqn;ߚ0dG8j"Z _3[nY@4SEos}}Au 0mO6UxQ2$$CfV?a)h2!ZtIKB-)3Cࠡ~, l%$%HJDĺ1|7ՙC*%5{vLm+7[|r&OU`]y$_ψE p;W<<:˱ØĶu]RVn,)3N>[0!g. ) )ٮ!˗P~h+<.3D-CH>k '4]p%|:yqȨ5g`k%JbƊdRF@4. deM7PV[5,N5: iP9C(ɗqL_$hJ$ 'AI#T ]V3tTSކ4\nTϖZN <}y8A12xp =?;p])B^DRі  w!NƁ9[FNJ L;.^S|J5"6ra,}'3LcF lëB~yzX介 ]lLx@qCsk7B~a_ C۽QрcUdrLM0&rZż)o"U|C(>aE ᭌ\jQ˴r*RWfR=Ir~[/o_{/ NVwx7<Q$ߊAud'ط ZYVGђo?<$ =˹y%[ehd2IzOR a5K9 R A=%fLe!PXxUA|a# q1CN<^րcH#a"@nW[??nk49s 6G2Z, \߹y! o|lWg(f=뤝ٷxwI%RZ x4Cv?F mpc@Xү#1R9{q'`v\ߚǣoB? 'B+-*_Fvʹ?'О)|w7>_$icR^gMfAF^./4",=!E!O8Ĕr"9\8zewAMyRc$:#qXv، "0CAU|8nFւs1-t~MҌч +>i5+|2nȧ_hCLٗf|r'"{F4M+{WJ; fR{~3d@5.ϘE.ko׽ʸ9LoW&v;n?`wkTuMG;o2kcUZZ|T\IkIYJbv^ݤp* wKт\h0W:>՚[',X2D; nwP9풆T{7czk&!rnW@/ a>N߀)QTm%wީfN^,~6koxn`sVt"zgW^{L>&3Ѓ=09>~ jE~[t6NDn靼A N j=~*tiZ^\|GY0*pdh0GH·WwY ݖ$Zȍ..&Z! n>HUxlDTmc9qH4@7mGEBM̡>/JGqu*J7_7&]p&͔0uTn# !00JT'J!as,Ͷ4Iπ*y?Bc+7gR.H[bu;T/U4fQh_=~z/ Ϣl!hlw]#cO`8 ǩsw f\6i-!XJNœ 7 $SZNAF|0#LeFrzEOL1aGڍ螫;Bߋg żVV .3#Zsқ/m5 |nABeHĞچ1l^DCAKqo^' ׺ZaxcvG zL×6J# <5 FC7?%WϦ"rbka8: nR| lp{n IX6+WNhKNϦy)6/ySU\Pe{ qVT ݈.{炧1Fq3 F)` ҵ\=2?a:kBjXFVFAԣ_JDpխNpG=E<~vx:LYw7,8ӕTw2 M6\s^*zD*uøtBLٟz&W<(ea8%i}adbezvڠ)Q2FyDE0#»_x`,=s[4BW:66RB'Taf dm΄SI(d݉piR $NB^|b +1$Wy(X *8J,78s,hy7Htj-4,9hg漈{΁1vq-Q}i|Dm8*W/'wAОxp@T%剮Khd u?LWp(H.Rd(bBj>3uyƤa:IĥE'7*Zj_fVvM.Ԅkc ӄ}Mg60 Lpr4*\)< 7×Hqm)?2IE=:eC LxQ9vڞ ᎐ZpG.9}y5 h/T{ѹ{հY+=>|,d,%O WF<㞥-QZ_ لnDH[J1)LMk\Wvݐ],׀XIT"\@k,WfΪِJb {=mSc_1^Ggn 0̥$  ,6q;2( GIbuD7pܞq#!"Dr9UH^͘V 0x>^$FKݮUf rW{-aj! :y\DY `@;fi['Q,ƛ7vS#,]Qy\~bQdOe5>NC3:l` 0H^8HBDlR$1_j 4]g+,ul? .ZL|8dq>\;lXZ!{wuڎ69}[ٚ#RaA=b mSɱddo  LhE 6&Ԛ~Pb^ XY5Ī_b`sxD.M P0yꭨhj -,JF>ow$<̼YcEsKzitJmKVj 4 gLJ@Q\w)} ΂ E dwn|?DlX#a%k +bD(hT.#]{ayfXo#{^Y-@ZV?zF[*YX:/*5qda WV$U'ELfR+ib'&,"VHR=B]KH) nNt=NI}:Hsp*炒,>R s :vE ~@"9 1v+Tؿ:bXno0<\"ǻ_M:f?nsEˁ43q&L>Erΐr[|\x1K5ES !6l( /21cdT [6- U֙x3wN:SB,VX>}@rJĽ3ؘ̩I$^ڡPA+( a_>wԬi!SZB|jJe;Օ\NJc,|K98+ޒ 3]3G z0}#y.v!$]̝~ mѥ m)8,[d/FWqY.Ǽ.I(o7gŐm{ՍsEF?4j?$@OAh$r5A#B=i6q[2A2o,OaHk8e 1`ji`0jM["p0>/zqM&I@Q^jpRPڠv#l_BM{Be7rQޠ\;ܱ2B|&v&L9+5ʗ4tx3,Qb7'Q{n\F1V.oI/!'BR~99Xhg ځ}\+řr0_x]1hI%qR׶|$ڋ䮢 LJrVg!!Jo֛daH +ΩR,"l8lm%NrN+zO=pVӣa\(7ngF/3=OH)KY#0zul0WR"٦B> WF.N(nC˽ĬM[egrTE51Opg( 1YT u){ m+ lGw[&@*ެ@%vT66!9cxeL5 }P,cV3_dR?eʢ>5 -l 'G-Xh?Y+98h!k~^Hu%K8"$!iłP ՜ynfJdTCYV^Un ,YNd0$ܖn XMS):ҟ  PDzcLzwpN&Nd侐W[\7*4LyVXM|8ÓVV3t3=CIMe45+qPKMcleb"u 5ϟ} چkUq y${%q򞬴@:sҽ#Pu\+-OpրYtLaR.Orlĝ/tBBǝEq$᱾3lAp`|HuQweBe0!Vuv*9 ] i$vYV 9d $[0QwCuBHzO78]JIS_d: *oѻ{ Ls\ΗS=9geǡ5VZ-T h3<=StY#wU+fXs J&^I H \d8[pЙRqtQ,P"$+'U-ch5|"+sKP0Cd v_Ivdh}r;'T; bLk&ژRT8""q 1"e2'cRvS9BO 8H瀞V]..qt=Ns n7)4KG*Mz +{rzf`G w7Pں\oWd I7`92S>!Sv^EPBrWI({]W0zDS0Y<"Db)`\ea*raB)T<֢DŽj[̒up/MBWS97 F&19C?CB:{<Ř%_S`vܪɯn((_L]fP"!}9eӐ;@dh85Mw1Yew^G΄)*` @AѺI#`XhY|R)PbȈu1jH˵@;M9 |y =~[0풫45p&jo}*NF&T({p!x૬$vQ)O潊偖4+!'2za䇇^W[8rkM}+#ŕ jfr[m"m,+ E=֘ /|}.4`]FJX)"4âNe6{<AE6+;ǩ'm럶yįQHR: _ ;qh9Ra >}:'\P;t|\QcNWAJP Tu`BϬT Zp\@%+`v%(P'hyNyR?$XrK~30Z;g񆬻FjMct>;섏'C.Q.<廉^dG3([oƒE$6ia(Yͼ?@ܥ#ߵ`}.YU,%w3NCNca(4@/!@tʋ_d`^y'lQ0ϊЙ< SM~5ǗjԝFe X?Uz>;~osd\=P6+۲AFT|٭aʩ/Tj)af/dO?}`-bhp!H"  ѯ؏MLT;-A.zN8 gsP)qvi+=ɽzVk9o꡾1URK;BBxMsM?LȪ.eL Xωb] ՝7ꢗk u 3D 6-;%?O3 d.f&4|"O0F# 6?-T +ο?uW#Q?VUR~;}yYdi~rj^7o{UIef'(xŧ|BH=V / "rciGDؐ3'):%/㏸ 9JH sG8~k!=QD/ C+J˛R}$u-rYEKx^#;MCHNy.'³꠷|":]/6UO%YFm;lȒժ ]3Trɖ#eԦe٣ZpL*D׆)_p4VS2sqB 1FHc '.R <4L-be29>,Ҍ:P8S][$]-rU ,V/^Vg6Œˮ62`6 +!=]PVscCՄy2?P i9>؈eb.cSڭ!/~+&gQ3< 8D?4c]w+x6Ŏ <f33 +]ٟK; g8drn2o,-!X,%?2T`ѤRy~ cy4.Y7+]EyZN@lb8EͦPJчC.L0e8Uph3KT?w>#ۘ. /or;6J=^`{C4*(_yh[$dFjaz^ otыvBJ۳ }e *Fn6'-es捙.33(}0bUu$1c5w-YBGX7©f#a4%8%eGG&5"K3X'p %{˚2``.huꊶ/T :3G:툾4G–Z,6PI!IjaFAR n2I 1L76XkEl唻+WPB/vu?XHd*8(Z)$ӼQVeŽ RRݗa3ivɴ,ԧl8Ξ\\QRg2nbʇ``dހ/j@oە* }0z:_'R]+7#ӊĂNOB;)U$vS$YfagqHh>4OMFPNq]mw/ꩶZ%2)Əjߌ6AEk F#bV(&S,@Vњ1vmkdЬ(ՐLMm˓`8~&o0.o5a25ȆbH #!ȪIc?8  po7DR>'>lI+*ȅI=@@,-fW齻2"MdlyK1|ӼF88($TJ/ZSs#M<HUr(Vˑ la/9m"1^[8E$fV{{сX)ɐ!E>i0^Vr|-TSA`T~):\lܹK>M}k&`b̰р'U56WYn>aB0m;fvN@w˘]jy[M5**QZz>@H8:w?w+i.қY%Z7Y&Tpd@Gq="c>4F_ɨ1|yB4Q~s{ZQˀVom0HQcuC'!Ff] s*nHj8-$I A;5Ve9|ۙ $r6'K$cqKa/jik=\ꎍ/M4t QQ h׽Oi&{`Advbo"wC96vQj߽H!I`~87*5¤~(W|,]9i:7zL6A{ϗ#K4Mg"!u891jĸ2YxR/yjpϿt߼/Qdvײk¿|4a͚!V} :^9g#F_&@JW~!/q^89鼷6ρp6CīnA@!TwV}Q!XL,)jI{;mܽ[( $rQ3"F%ց)K;ȒF{OJDFq=zh+7qW%,-/[zlS/>' '4bT5-)܆KWpBv<+'05PCP! !2-5 OmXbCpa$Ug20.8=b@(45~7=q_v;hncbcTʐH )E S"tY#*H9ycQVyۖ0 e(,SaⵔwB ?yn`![*AzR]kZPqW%x^(;+p&+?mߌ| [BV@|ߛО %W1d\$V}I-! %b`c'Ȇw~Y_acs9P|fͲ)Y'IoFW=[<3}37(4) 'ܝ4PB.c"R 2LL dM=`6WOylEVRNO&KKnEgo\WN FdG .U <|Kz>:Z}DpB~q:1h#Q*WS.ςr⏸<$/)c0`BuOY-:™Llt É6U M4<ιB@U[zڳrb i_f#r/^yc'*yAd:sQ3(5'?[7\z<+JS3[ P^ވ#囏s L48?R(`3$9>2a$djE#%of.:24;4B|6#Qqbh;!c,"g|nX "T~:=) VJtk:3YBwܾl >tb2LFyIqNX с#+vT&DVabӑBώzƤW0}2so&EAҺ&SLё, xoLhՆMt24灌hŨuS_ VDŽ&gzuУ(ꡭAs?D߮-j?w6-[[tU8Bj_Ohor|BͮnH'qLTqA?&L> oak-Com͎7WJm\F'ocST-$O~s5[Y{"Ǟ\2+@"ot o|cc'|WBsVmjԫZ8juͻD =m0|[L©s&| 9X0KzЇ'>²m&yH 4i{;c.q7ق>=n*6KRK6(܈筥hA7/BBnj@z² bN*TKF6 W,yB}({?th6/_*;G+كW+o>F3ݞmξΨj)⎠.bfQb l=&h:KXWf"2r}r5!:L Ebn#t[.ż=x﷚?}l.F&Jof'[hnًl5NR:YǐZ'Ǜ^cLc>'s<,~GݟSt#G )t?/9qn҂aT2 ;t5I-]bb/]xxYUI̮cbYD^m(bt?F]b *!wq}~" B}6%-RWG'-x+ĊAkC "+p#.;9@f '&Z?+_Hk75c^iI|ÌWW`sqqn5lOafT*4μG/U;)7q*+t/jO( z_O-uV0oH%5hL"@tWm4Z{$'UM3Eˇ%  ZxUslERDHW9XpdWCr[R_Q^uGjuib)U4T¸:MX\Kf4^b $v\{eD*+3f"?0]xe<+f&}3|zt;t'jǍL0 J(?LuTpNޅs,~_fB јHpVh,E<8H\Xށ\ҵMes9 bi*N9!p×s+~+\`^ o2nkjNE;H2^:[Ո[fD'llPA0W[d`wk\nM.PG[bDw:2c 3c iRY}UV]-zz>ꥸ&e>y.+EpKx6~q%JbփT?ؠZ:q(]q!5v{:3TuR$$wwP:+K(g@ƊEͺ{1F52[.xy@:܀A\;Zư9晄tf+^x HN83 Ěe& sqﺸ aΔ_|4IIv-$Ku) /\_JW' }jَ VK`Fmaޑ5' TYˬCXJE/QhPD:4MnU:N#XOhɢL`mP8uRҠmz%.%>%.% >% .%x U&E&(X&(H&`&P&`/ `&`&@ `&8&o4&!